BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H14

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004146887.1|  PREDICTED: 60S ribosomal protein L13-2-like ...    281   6e-93   
ref|XP_008453835.1|  PREDICTED: 60S ribosomal protein L13-3             280   2e-92   Cucumis melo [Oriental melon]
ref|XP_011084605.1|  PREDICTED: 60S ribosomal protein L13-1             280   2e-92   Sesamum indicum [beniseed]
ref|XP_010054042.1|  PREDICTED: 60S ribosomal protein L13-2             278   1e-91   Eucalyptus grandis [rose gum]
ref|XP_011075827.1|  PREDICTED: 60S ribosomal protein L13-1-like        277   2e-91   Sesamum indicum [beniseed]
gb|KDP38855.1|  hypothetical protein JCGZ_05012                         277   2e-91   Jatropha curcas
gb|KDP21801.1|  hypothetical protein JCGZ_00588                         277   2e-91   Jatropha curcas
ref|XP_010243468.1|  PREDICTED: 60S ribosomal protein L13-1             276   9e-91   Nelumbo nucifera [Indian lotus]
ref|XP_010269352.1|  PREDICTED: 60S ribosomal protein L13-1-like        275   1e-90   Nelumbo nucifera [Indian lotus]
ref|XP_007158142.1|  hypothetical protein PHAVU_002G127900g             275   2e-90   Phaseolus vulgaris [French bean]
gb|AGV54370.1|  60S ribosomal protein L13-2-like protein                275   2e-90   Phaseolus vulgaris [French bean]
ref|XP_009795347.1|  PREDICTED: 60S ribosomal protein L13-1             274   3e-90   Nicotiana sylvestris
gb|AFK39980.1|  unknown                                                 274   5e-90   Lotus japonicus
gb|KHG24237.1|  60S ribosomal L13-2                                     273   5e-90   Gossypium arboreum [tree cotton]
gb|KHG21579.1|  60S ribosomal L13-2                                     273   6e-90   Gossypium arboreum [tree cotton]
ref|XP_006451725.1|  hypothetical protein CICLE_v10009507mg             273   8e-90   Citrus clementina [clementine]
ref|XP_009619310.1|  PREDICTED: 60S ribosomal protein L13-1             273   9e-90   Nicotiana tomentosiformis
gb|KJB22724.1|  hypothetical protein B456_004G062900                    273   1e-89   Gossypium raimondii
gb|KJB08613.1|  hypothetical protein B456_001G093800                    273   1e-89   Gossypium raimondii
ref|XP_011023520.1|  PREDICTED: 60S ribosomal protein L13-1-like        273   1e-89   Populus euphratica
ref|XP_006485662.1|  PREDICTED: 60S ribosomal protein L13-1-like        273   1e-89   Citrus sinensis [apfelsine]
ref|XP_007049063.1|  60S ribosomal protein L13                          272   2e-89   
gb|KJB42885.1|  hypothetical protein B456_007G172400                    272   2e-89   Gossypium raimondii
gb|KHG03134.1|  60S ribosomal L13-2                                     272   2e-89   Gossypium arboreum [tree cotton]
ref|XP_006478303.1|  PREDICTED: 60S ribosomal protein L13-1-like        272   2e-89   Citrus sinensis [apfelsine]
ref|XP_002529265.1|  60S ribosomal protein L13, putative                272   2e-89   Ricinus communis
ref|XP_011028035.1|  PREDICTED: 60S ribosomal protein L13-1-like        272   2e-89   Populus euphratica
ref|XP_011018407.1|  PREDICTED: 60S ribosomal protein L13-1             272   3e-89   Populus euphratica
ref|XP_006368290.1|  60S ribosomal protein L13                          272   3e-89   Populus trichocarpa [western balsam poplar]
ref|XP_006441816.1|  hypothetical protein CICLE_v10022283mg             271   4e-89   Citrus clementina [clementine]
gb|AAQ96375.1|  60S ribosomal protein L13                               271   4e-89   Solanum palustre
emb|CDP17844.1|  unnamed protein product                                271   4e-89   Coffea canephora [robusta coffee]
ref|XP_002319032.1|  hypothetical protein POPTR_0013s02860g             271   5e-89   Populus trichocarpa [western balsam poplar]
ref|XP_002304378.1|  60S ribosomal protein L13                          271   5e-89   Populus trichocarpa [western balsam poplar]
ref|XP_008467320.1|  PREDICTED: 60S ribosomal protein L13-3-like        271   5e-89   Cucumis melo [Oriental melon]
ref|XP_004143667.1|  PREDICTED: 60S ribosomal protein L13-1-like        271   6e-89   Cucumis sativus [cucumbers]
ref|XP_008238048.1|  PREDICTED: 60S ribosomal protein L13-1             271   7e-89   Prunus mume [ume]
ref|XP_004245965.1|  PREDICTED: 60S ribosomal protein L13-1-like        271   8e-89   Solanum lycopersicum
ref|XP_010056172.1|  PREDICTED: 60S ribosomal protein L13-1-like        271   8e-89   Eucalyptus grandis [rose gum]
ref|XP_010269338.1|  PREDICTED: 60S ribosomal protein L13-1-like        270   9e-89   Nelumbo nucifera [Indian lotus]
ref|XP_002519996.1|  60S ribosomal protein L13, putative                270   9e-89   Ricinus communis
ref|XP_003522855.1|  PREDICTED: 60S ribosomal protein L13-1-like ...    270   1e-88   Glycine max [soybeans]
ref|XP_003547825.1|  PREDICTED: 60S ribosomal protein L13-1-like        270   1e-88   
ref|XP_003626150.1|  60S ribosomal protein L13                          270   1e-88   Medicago truncatula
gb|AFK47578.1|  unknown                                                 270   2e-88   Medicago truncatula
ref|XP_010906706.1|  PREDICTED: 60S ribosomal protein L13-1-like        270   2e-88   Elaeis guineensis
gb|ACJ83949.1|  unknown                                                 270   2e-88   Medicago truncatula
ref|XP_009382822.1|  PREDICTED: 60S ribosomal protein L13-1-like        269   2e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010940804.1|  PREDICTED: 60S ribosomal protein L13-1             269   3e-88   Elaeis guineensis
gb|AFK36916.1|  unknown                                                 269   3e-88   Medicago truncatula
ref|XP_007209605.1|  hypothetical protein PRUPE_ppa011506mg             269   3e-88   Prunus persica
emb|CAN84167.1|  hypothetical protein VITISV_018882                     269   3e-88   Vitis vinifera
ref|XP_002874151.1|  60S ribosomal protein L13                          269   4e-88   
ref|XP_008775606.1|  PREDICTED: 60S ribosomal protein L13-1             269   4e-88   Phoenix dactylifera
gb|KHG20106.1|  60S ribosomal L13-1                                     269   4e-88   Gossypium arboreum [tree cotton]
emb|CAN80613.1|  hypothetical protein VITISV_025451                     269   5e-88   Vitis vinifera
ref|XP_010426404.1|  PREDICTED: 60S ribosomal protein L13-1-like        268   5e-88   Camelina sativa [gold-of-pleasure]
ref|NP_001276322.1|  60S ribosomal protein L13-1-like                   270   5e-88   
ref|XP_007156319.1|  hypothetical protein PHAVU_003G276400g             268   5e-88   Phaseolus vulgaris [French bean]
ref|XP_010503548.1|  PREDICTED: 60S ribosomal protein L13-1             268   5e-88   Camelina sativa [gold-of-pleasure]
ref|XP_002274000.1|  PREDICTED: 60S ribosomal protein L13-1             268   6e-88   Vitis vinifera
gb|AFK45847.1|  unknown                                                 268   7e-88   Medicago truncatula
ref|NP_001275203.1|  60S ribosomal protein L13                          268   7e-88   Solanum tuberosum [potatoes]
gb|KHN27522.1|  60S ribosomal protein L13-2                             268   7e-88   Glycine soja [wild soybean]
ref|XP_010278804.1|  PREDICTED: 60S ribosomal protein L13-2-like        268   8e-88   Nelumbo nucifera [Indian lotus]
ref|XP_003534321.1|  PREDICTED: 60S ribosomal protein L13-1 isofo...    268   9e-88   Glycine max [soybeans]
emb|CDP19062.1|  unnamed protein product                                268   1e-87   Coffea canephora [robusta coffee]
ref|XP_009149775.1|  PREDICTED: 60S ribosomal protein L13-1-like        268   1e-87   Brassica rapa
ref|XP_009150164.1|  PREDICTED: 60S ribosomal protein L13-2             268   1e-87   Brassica rapa
gb|ACU23653.1|  unknown                                                 268   1e-87   Glycine max [soybeans]
ref|XP_004499145.1|  PREDICTED: 60S ribosomal protein L13-1-like        268   1e-87   Cicer arietinum [garbanzo]
emb|CDY66119.1|  BnaC01g42370D                                          268   1e-87   Brassica napus [oilseed rape]
ref|XP_010421197.1|  PREDICTED: 60S ribosomal protein L13-3             268   1e-87   Camelina sativa [gold-of-pleasure]
ref|XP_008234598.1|  PREDICTED: 60S ribosomal protein L13-3-like        268   1e-87   Prunus mume [ume]
ref|XP_007218412.1|  hypothetical protein PRUPE_ppa011512mg             267   1e-87   Prunus persica
ref|XP_002277094.1|  PREDICTED: 60S ribosomal protein L13-1             267   1e-87   Vitis vinifera
ref|XP_009595065.1|  PREDICTED: 60S ribosomal protein L13-2             267   1e-87   Nicotiana tomentosiformis
sp|P41129.1|RL132_BRANA  RecName: Full=60S ribosomal protein L13-...    267   2e-87   Brassica napus [oilseed rape]
ref|XP_011048445.1|  PREDICTED: 60S ribosomal protein L13-1-like        267   2e-87   Populus euphratica
ref|XP_008776365.1|  PREDICTED: 60S ribosomal protein L13-1-like        267   2e-87   Phoenix dactylifera
ref|XP_002322840.2|  hypothetical protein POPTR_0016s08310g             267   2e-87   Populus trichocarpa [western balsam poplar]
ref|NP_001288976.1|  60S ribosomal protein L13-2                        267   2e-87   Brassica rapa
ref|XP_009773597.1|  PREDICTED: 60S ribosomal protein L13-2-like        266   3e-87   Nicotiana sylvestris
ref|XP_008785029.1|  PREDICTED: 60S ribosomal protein L13-1-like        266   3e-87   Phoenix dactylifera
emb|CDY05893.1|  BnaC08g20700D                                          266   3e-87   
gb|ACJ83987.1|  unknown                                                 266   3e-87   Medicago truncatula
ref|XP_006598706.1|  PREDICTED: uncharacterized protein LOC100499...    266   3e-87   
ref|XP_002877641.1|  ATBBC1                                             266   3e-87   Arabidopsis lyrata subsp. lyrata
ref|XP_009386549.1|  PREDICTED: 60S ribosomal protein L13-1-like        266   4e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003612594.1|  60S ribosomal protein L13                          267   5e-87   
gb|AFK44824.1|  unknown                                                 266   6e-87   Lotus japonicus
ref|XP_009392764.1|  PREDICTED: 60S ribosomal protein L13-1-like        266   8e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010493519.1|  PREDICTED: 60S ribosomal protein L13-3-like        265   8e-87   
ref|XP_006288673.1|  hypothetical protein CARUB_v10001981mg             265   9e-87   Capsella rubella
ref|XP_009348808.1|  PREDICTED: 60S ribosomal protein L13-1-like        265   1e-86   Pyrus x bretschneideri [bai li]
dbj|BAM64854.1|  RPL13 protein                                          265   1e-86   Beta vulgaris [beet]
ref|XP_002456870.1|  hypothetical protein SORBIDRAFT_03g044290          265   1e-86   Sorghum bicolor [broomcorn]
ref|XP_006291856.1|  hypothetical protein CARUB_v10018032mg             265   1e-86   Capsella rubella
sp|P41128.1|RL131_BRANA  RecName: Full=60S ribosomal protein L13-...    265   1e-86   Brassica napus [oilseed rape]
ref|XP_009395324.1|  PREDICTED: 60S ribosomal protein L13-1             265   1e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010918091.1|  PREDICTED: 60S ribosomal protein L13-1-like        265   1e-86   Elaeis guineensis
ref|XP_010454674.1|  PREDICTED: 60S ribosomal protein L13-3-like        265   2e-86   Camelina sativa [gold-of-pleasure]
gb|AFK40501.1|  unknown                                                 265   2e-86   Medicago truncatula
ref|XP_009151668.1|  PREDICTED: 60S ribosomal protein L13-1             265   2e-86   Brassica rapa
ref|NP_190470.1|  60S ribosomal protein L13-1                           265   2e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010671181.1|  PREDICTED: 60S ribosomal protein L13-1             265   2e-86   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAM64815.1|  RPL13                                                  265   2e-86   Beta vulgaris [beet]
gb|AAM61490.1|  60S ribosomal protein L13, BBC1 protein                 265   2e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006847908.1|  hypothetical protein AMTR_s00029p00111280          264   2e-86   Amborella trichopoda
ref|XP_006404190.1|  hypothetical protein EUTSA_v10010724mg             264   3e-86   Eutrema salsugineum [saltwater cress]
ref|XP_006655721.1|  PREDICTED: 60S ribosomal protein L13-1-like        264   3e-86   Oryza brachyantha
ref|XP_009335696.1|  PREDICTED: 60S ribosomal protein L13-1-like        264   3e-86   Pyrus x bretschneideri [bai li]
ref|XP_008369022.1|  PREDICTED: 60S ribosomal protein L13-1-like        264   3e-86   Malus domestica [apple tree]
ref|XP_010102662.1|  60S ribosomal protein L13-2                        264   3e-86   Morus notabilis
ref|XP_010677493.1|  PREDICTED: 60S ribosomal protein L13-1-like        264   3e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006394649.1|  hypothetical protein EUTSA_v10004920mg             264   4e-86   Eutrema salsugineum [saltwater cress]
ref|XP_004512380.1|  PREDICTED: 60S ribosomal protein L13-1-like ...    264   4e-86   
ref|XP_004969592.1|  PREDICTED: 60S ribosomal protein L13-1-like        264   4e-86   Setaria italica
gb|EPS71909.1|  hypothetical protein M569_02849                         263   5e-86   Genlisea aurea
ref|XP_004969597.1|  PREDICTED: 60S ribosomal protein L13-1-like        264   5e-86   Setaria italica
gb|EYU19728.1|  hypothetical protein MIMGU_mgv1a013902mg                263   6e-86   Erythranthe guttata [common monkey flower]
gb|AES82369.2|  60S ribosomal L13-like protein                          263   6e-86   Medicago truncatula
gb|ACJ86119.1|  unknown                                                 263   7e-86   Medicago truncatula
emb|CAC27142.1|  60S ribosomal protein L13E                             263   7e-86   Picea abies
ref|XP_009792303.1|  PREDICTED: 60S ribosomal protein L13-1-like        263   7e-86   Nicotiana sylvestris
ref|XP_010519493.1|  PREDICTED: 60S ribosomal protein L13-1             263   7e-86   Tarenaya hassleriana [spider flower]
gb|KJB10376.1|  hypothetical protein B456_001G197800                    263   8e-86   Gossypium raimondii
gb|ABK25466.1|  unknown                                                 263   8e-86   Picea sitchensis
ref|XP_006659160.1|  PREDICTED: 60S ribosomal protein L13-1-like        263   8e-86   Oryza brachyantha
ref|XP_008386691.1|  PREDICTED: 60S ribosomal protein L13-1             263   1e-85   
ref|XP_010233707.1|  PREDICTED: 60S ribosomal protein L13-1-like        263   1e-85   Brachypodium distachyon [annual false brome]
ref|NP_001152730.1|  LOC100286371                                       263   1e-85   Zea mays [maize]
ref|XP_009335726.1|  PREDICTED: 60S ribosomal protein L13-3-like        263   1e-85   Pyrus x bretschneideri [bai li]
ref|NP_197778.1|  60S ribosomal protein L13-3                           262   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009351877.1|  PREDICTED: 60S ribosomal protein L13-1             262   1e-85   Pyrus x bretschneideri [bai li]
ref|XP_006342488.1|  PREDICTED: 60S ribosomal protein L13-1-like        262   2e-85   Solanum tuberosum [potatoes]
ref|XP_009624483.1|  PREDICTED: 60S ribosomal protein L13-1-like        262   2e-85   Nicotiana tomentosiformis
gb|EYU45361.1|  hypothetical protein MIMGU_mgv1a013891mg                261   3e-85   Erythranthe guttata [common monkey flower]
ref|XP_004253080.1|  PREDICTED: 60S ribosomal protein L13-1             261   3e-85   Solanum lycopersicum
ref|XP_008376874.1|  PREDICTED: 60S ribosomal protein L13-3             261   3e-85   
ref|XP_008381780.1|  PREDICTED: 60S ribosomal protein L13-3-like        261   3e-85   Malus domestica [apple tree]
ref|XP_003573442.1|  PREDICTED: 60S ribosomal protein L13-1-like        261   3e-85   Brachypodium distachyon [annual false brome]
ref|XP_002440279.1|  hypothetical protein SORBIDRAFT_09g028960          261   4e-85   Sorghum bicolor [broomcorn]
ref|NP_001056613.1|  Os06g0115500                                       261   4e-85   
ref|XP_009361223.1|  PREDICTED: 60S ribosomal protein L13-3-like        261   5e-85   Pyrus x bretschneideri [bai li]
ref|NP_001148638.1|  60S ribosomal protein L13-2                        261   6e-85   Zea mays [maize]
ref|XP_004982044.1|  PREDICTED: 60S ribosomal protein L13-2-like ...    261   7e-85   Setaria italica
ref|XP_002439380.1|  hypothetical protein SORBIDRAFT_09g005460          260   1e-84   Sorghum bicolor [broomcorn]
ref|XP_008800008.1|  PREDICTED: 60S ribosomal protein L13-1-like        259   2e-84   Phoenix dactylifera
ref|XP_010550553.1|  PREDICTED: 60S ribosomal protein L13-1-like        259   2e-84   Tarenaya hassleriana [spider flower]
ref|XP_010545924.1|  PREDICTED: 60S ribosomal protein L13-1-like        259   3e-84   Tarenaya hassleriana [spider flower]
ref|NP_001155192.1|  60S ribosomal protein L13 isoform 1                259   4e-84   Zea mays [maize]
ref|NP_001078260.1|  60S ribosomal protein L13-1                        258   6e-84   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001050537.1|  Os03g0576700                                       258   7e-84   
ref|XP_006404189.1|  hypothetical protein EUTSA_v10010724mg             258   7e-84   
gb|EMT28307.1|  60S ribosomal protein L13-1                             258   8e-84   
gb|ABR18061.1|  unknown                                                 258   8e-84   Picea sitchensis
gb|ABK24025.1|  unknown                                                 258   8e-84   Picea sitchensis
ref|XP_004509537.1|  PREDICTED: 60S ribosomal protein L13-1-like        257   1e-83   Cicer arietinum [garbanzo]
emb|CDY16871.1|  BnaA09g05110D                                          256   2e-83   Brassica napus [oilseed rape]
ref|XP_009141778.1|  PREDICTED: 60S ribosomal protein L13-3             256   4e-83   Brassica rapa
dbj|BAJ99213.1|  predicted protein                                      256   6e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT10064.1|  60S ribosomal protein L13-1                             256   6e-83   
emb|CDX87152.1|  BnaC09g04670D                                          254   1e-82   
gb|AFW84113.1|  hypothetical protein ZEAMMB73_641905                    254   2e-82   
gb|EMS50076.1|  60S ribosomal protein L13-1                             254   9e-82   Triticum urartu
ref|XP_009396207.1|  PREDICTED: 60S ribosomal protein L13-1-like        252   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIZ68174.1|  60S ribosomal protein L13-1-like protein                252   2e-81   Ornithogalum longebracteatum [sea-onion]
ref|XP_006850159.1|  hypothetical protein AMTR_s00022p00239970          249   2e-80   Amborella trichopoda
gb|EMS59514.1|  60S ribosomal protein L13-1                             248   5e-80   Triticum urartu
ref|XP_010539934.1|  PREDICTED: 60S ribosomal protein L13-1-like        243   8e-78   Tarenaya hassleriana [spider flower]
ref|XP_007040896.1|  60S ribosomal protein L13                          240   5e-77   
ref|NP_190465.1|  putative 60S ribosomal protein L13-2                  231   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001770513.1|  predicted protein                                  231   3e-73   
ref|XP_001756184.1|  predicted protein                                  228   3e-72   
gb|ABF97255.1|  60S ribosomal protein L13-2, putative, expressed        227   6e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001785308.1|  predicted protein                                  228   7e-72   
ref|XP_001762920.1|  predicted protein                                  227   1e-71   
ref|XP_001761309.1|  predicted protein                                  226   3e-71   
sp|P49627.1|RL13_TOBAC  RecName: Full=60S ribosomal protein L13; ...    215   5e-67   Nicotiana tabacum [American tobacco]
ref|XP_011395748.1|  60S ribosomal protein L13-2                        208   3e-64   Auxenochlorella protothecoides
ref|XP_002962809.1|  hypothetical protein SELMODRAFT_266648             206   2e-63   Selaginella moellendorffii
ref|XP_001633643.1|  predicted protein                                  205   5e-63   Nematostella vectensis
ref|XP_002962473.1|  hypothetical protein SELMODRAFT_165483             204   9e-63   Selaginella moellendorffii
gb|KDD76767.1|  ribosomal protein L13e                                  204   1e-62   Helicosporidium sp. ATCC 50920
ref|XP_005646484.1|  ribosomal protein L13e                             201   2e-61   Coccomyxa subellipsoidea C-169
ref|XP_002154424.1|  PREDICTED: 60S ribosomal protein L13-like          197   8e-60   
emb|CCQ18590.1|  60S ribosomal protein L13                              196   2e-59   Sycon ciliatum
gb|AAT08722.1|  cold-induced protein                                    194   3e-59   Hyacinthus orientalis [common hyacinth]
ref|XP_002739297.1|  PREDICTED: 60S ribosomal protein L13-like          192   3e-58   Saccoglossus kowalevskii
gb|EPZ33898.1|  Ribosomal protein L13e domain-containing protein        192   5e-58   Rozella allomycis CSF55
gb|KFD48816.1|  hypothetical protein M513_10300                         190   2e-57   Trichuris suis
gb|KCW72783.1|  hypothetical protein EUGRSUZ_E01232                     187   6e-57   Eucalyptus grandis [rose gum]
ref|XP_002604928.1|  hypothetical protein BRAFLDRAFT_279721             189   7e-57   Branchiostoma floridae
emb|CDW52162.1|  60S ribosomal protein L13                              189   1e-56   Trichuris trichiura
ref|XP_003382527.1|  PREDICTED: 60S ribosomal protein L13-like          188   1e-56   Amphimedon queenslandica
gb|AAX48845.1|  L13                                                     188   2e-56   Suberites domuncula
ref|XP_011440919.1|  PREDICTED: 60S ribosomal protein L13-like          187   3e-56   Crassostrea gigas
ref|XP_005705644.1|  60S ribosomal protein L13e                         186   9e-56   Galdieria sulphuraria
emb|CAD28610.1|  60S ribosomal protein L13                              184   8e-55   Polytomella sp. Pringsheim 198.80
gb|ABZ04227.1|  ribosomal protein rpl13                                 183   1e-54   Lineus viridis
emb|CCI40738.1|  unnamed protein product                                184   1e-54   Albugo candida
gb|KFH63588.1|  50S ribosomal protein L13e                              183   1e-54   Mortierella verticillata NRRL 6337
gb|AIU94834.1|  60S ribosomal protein                                   183   2e-54   Phragmatopoma lapidosa
emb|CBN08623.1|  small nucleolar RNA, C/D box 68                        183   2e-54   Microcosmus squamiger
ref|NP_937786.1|  60S ribosomal protein L13                             183   2e-54   Danio rerio [leopard danio]
gb|EFX84971.1|  hypothetical protein DAPPUDRAFT_34614                   182   2e-54   Daphnia pulex
ref|XP_006677706.1|  hypothetical protein BATDEDRAFT_6028               182   4e-54   Batrachochytrium dendrobatidis JAM81
ref|XP_005843532.1|  hypothetical protein CHLNCDRAFT_33026              181   7e-54   Chlorella variabilis
gb|KFH62789.1|  50S ribosomal protein L13e                              181   7e-54   Mortierella verticillata NRRL 6337
emb|CEG63488.1|  Putative 60S ribosomal protein L13                     181   9e-54   Rhizopus microsporus
emb|CEG74076.1|  Putative 60S ribosomal protein L13                     181   9e-54   Rhizopus microsporus
gb|KFM61038.1|  60S ribosomal protein L13                               181   9e-54   Stegodyphus mimosarum
dbj|BAJ99030.1|  predicted protein                                      181   2e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008872563.1|  hypothetical protein H310_08544                    180   3e-53   Aphanomyces invadans
gb|AFM90798.1|  60S ribosomal protein L13                               180   3e-53   Callorhinchus milii [Australian ghost shark]
gb|ABM55560.1|  putative ribosomal protein L13                          180   4e-53   Maconellicoccus hirsutus [pink hibiscus mealybug]
gb|AFM87368.1|  RPL13 protein isoform 1                                 179   6e-53   Callorhinchus milii [Australian ghost shark]
gb|AFM90524.1|  RPL13 protein isoform 1                                 179   7e-53   Callorhinchus milii [Australian ghost shark]
gb|AFM87461.1|  RPL13 protein isoform 1                                 179   7e-53   Callorhinchus milii [Australian ghost shark]
emb|CCA14227.1|  60S ribosomal protein L13 putative                     179   8e-53   Albugo laibachii Nc14
gb|AFM89144.1|  RPL13 protein isoform 1                                 179   9e-53   Callorhinchus milii [Australian ghost shark]
emb|CCD27757.1|  ribosomal protein l13                                  178   9e-53   Apionsoma misakianum
gb|AFM90648.1|  60S ribosomal protein L13                               179   9e-53   Callorhinchus milii [Australian ghost shark]
gb|AFM89025.1|  RPL13 protein isoform 1                                 179   1e-52   Callorhinchus milii [Australian ghost shark]
gb|AFM88842.1|  RPL13 protein isoform 1                                 179   1e-52   Callorhinchus milii [Australian ghost shark]
ref|NP_001279295.1|  ribosomal protein L13                              179   1e-52   Callorhinchus milii [Australian ghost shark]
gb|AFM88774.1|  RPL13 protein isoform 1                                 178   1e-52   Callorhinchus milii [Australian ghost shark]
ref|XP_002502525.1|  predicted protein                                  179   1e-52   Micromonas commoda
gb|AFM85620.1|  RPL13 protein isoform 1                                 178   1e-52   Callorhinchus milii [Australian ghost shark]
ref|XP_010716479.1|  PREDICTED: 60S ribosomal protein L13               178   1e-52   Meleagris gallopavo [common turkey]
gb|EIE79206.1|  50S ribosomal protein L13e                              178   2e-52   Rhizopus delemar RA 99-880
ref|XP_009839630.1|  hypothetical protein H257_13700                    178   2e-52   Aphanomyces astaci
gb|ABM55445.1|  ribosomal protein L13                                   178   2e-52   Xenopsylla cheopis
ref|NP_990330.1|  60S ribosomal protein L13                             178   2e-52   Gallus gallus [bantam]
gb|EIE83814.1|  hypothetical protein RO3G_08519                         177   3e-52   Rhizopus delemar RA 99-880
ref|XP_008286406.1|  PREDICTED: 60S ribosomal protein L13               177   3e-52   Stegastes partitus
gb|AFM87311.1|  RPL13 protein isoform 1                                 177   3e-52   Callorhinchus milii [Australian ghost shark]
ref|XP_009013211.1|  hypothetical protein HELRODRAFT_105042             177   3e-52   Helobdella robusta
gb|AFM85555.1|  RPL13 protein isoform 1                                 177   3e-52   Callorhinchus milii [Australian ghost shark]
gb|EPB81665.1|  50S ribosomal protein L13e                              177   3e-52   Mucor circinelloides f. circinelloides 1006PhL
emb|CAF99615.1|  unnamed protein product                                177   4e-52   Tetraodon nigroviridis
gb|AEB31272.1|  60S ribosomal protein                                   177   4e-52   Epinephelus bruneus
ref|XP_002195773.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     177   4e-52   Taeniopygia guttata
gb|AFM86534.1|  RPL13 protein isoform 1                                 177   4e-52   Callorhinchus milii [Australian ghost shark]
ref|XP_005052310.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    177   5e-52   Ficedula albicollis
gb|AFM90194.1|  RPL13 protein isoform 1                                 176   6e-52   Callorhinchus milii [Australian ghost shark]
emb|CCD27771.1|  ribosomal protein l13                                  176   6e-52   Sipunculus nudus
ref|XP_005714141.1|  60S ribosomal protein L13                          176   6e-52   Chondrus crispus [carageen]
ref|XP_004543183.1|  PREDICTED: 60S ribosomal protein L13-like is...    176   7e-52   Maylandia zebra
gb|EPB87974.1|  50S ribosomal protein L13e                              176   8e-52   Mucor circinelloides f. circinelloides 1006PhL
gb|AAX62455.1|  ribosomal protein L13                                   176   9e-52   Lysiphlebus testaceipes
emb|CBY23126.1|  unnamed protein product                                176   9e-52   Oikopleura dioica
ref|XP_009169027.1|  hypothetical protein T265_05694                    176   1e-51   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_005741646.1|  PREDICTED: 60S ribosomal protein L13-like          176   1e-51   Pundamilia nyererei
gb|AII97595.1|  BLTX199                                                 176   1e-51   Nephila pilipes
ref|XP_001969383.1|  GG10074                                            176   1e-51   Drosophila erecta
dbj|GAA49202.1|  large subunit ribosomal protein L13e                   176   1e-51   Clonorchis sinensis [oriental liver fluke]
emb|CEP20112.1|  hypothetical protein                                   176   1e-51   Parasitella parasitica
ref|NP_001284610.1|  60S ribosomal protein L13-like                     176   1e-51   Diaphorina citri
ref|XP_008469641.1|  PREDICTED: 60S ribosomal protein L13-like          176   1e-51   Diaphorina citri
ref|NP_523530.1|  ribosomal protein L13, isoform A                      176   1e-51   Drosophila melanogaster
gb|EIE85002.1|  50S ribosomal protein L13e                              176   2e-51   Rhizopus delemar RA 99-880
ref|XP_003442322.1|  PREDICTED: 60S ribosomal protein L13-like is...    176   2e-51   Oreochromis niloticus
ref|XP_008552884.1|  PREDICTED: 60S ribosomal protein L13-like          176   2e-51   Microplitis demolitor
gb|AFM90533.1|  RPL13 protein isoform 1                                 175   2e-51   Callorhinchus milii [Australian ghost shark]
emb|CCD27761.1|  ribosomal protein l13                                  175   2e-51   Aspidosiphon albus
ref|XP_005810478.1|  PREDICTED: 60S ribosomal protein L13-like          175   2e-51   Xiphophorus maculatus
gb|AFM88766.1|  RPL13 protein isoform 1                                 175   2e-51   Callorhinchus milii [Australian ghost shark]
ref|XP_005308237.1|  PREDICTED: 60S ribosomal protein L13               175   2e-51   Chrysemys picta bellii
ref|XP_010743079.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    175   2e-51   
gb|ADD38054.1|  60S ribosomal protein L13                               175   2e-51   Lepeophtheirus salmonis
gb|AFM88430.1|  RPL13 protein isoform 1                                 175   2e-51   Callorhinchus milii [Australian ghost shark]
ref|XP_008489456.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    175   3e-51   Calypte anna
ref|XP_009271349.1|  PREDICTED: 60S ribosomal protein L13               175   3e-51   Aptenodytes forsteri
ref|XP_003970021.1|  PREDICTED: 60S ribosomal protein L13-like is...    175   3e-51   
ref|XP_008403549.1|  PREDICTED: 60S ribosomal protein L13               175   3e-51   Poecilia reticulata
ref|XP_009675145.1|  PREDICTED: 60S ribosomal protein L13               174   3e-51   Struthio camelus australis
ref|XP_008335251.1|  PREDICTED: 60S ribosomal protein L13               174   3e-51   Cynoglossus semilaevis [half-smooth tongue sole]
gb|EIE87092.1|  hypothetical protein RO3G_11803                         174   3e-51   
gb|KFV82308.1|  60S ribosomal protein L13                               174   4e-51   
ref|XP_006139461.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    174   4e-51   
gb|AFM86501.1|  RPL13 protein isoform 1                                 174   4e-51   
ref|XP_003626151.1|  60S ribosomal protein L13                          172   4e-51   
ref|NP_001187042.1|  60S ribosomal protein L13                          174   5e-51   
ref|XP_005099800.1|  PREDICTED: 60S ribosomal protein L13-like          174   6e-51   
gb|AAR10069.1|  similar to Drosophila melanogaster RpL13                172   7e-51   
ref|NP_001156206.1|  ribosomal protein L13-like                         174   7e-51   
ref|XP_009066218.1|  hypothetical protein LOTGIDRAFT_197609             174   7e-51   
ref|XP_008187640.1|  PREDICTED: ribosomal protein L13-like isofor...    174   7e-51   
ref|XP_004067037.1|  PREDICTED: 60S ribosomal protein L13               174   8e-51   
gb|ACH70813.1|  ribosomal protein L13                                   174   9e-51   
gb|AGH70160.1|  60S ribosomal protein L13                               174   9e-51   
ref|XP_007670825.1|  PREDICTED: 60S ribosomal protein L13               173   9e-51   
ref|XP_003056914.1|  predicted protein                                  174   1e-50   
ref|XP_007059366.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    173   1e-50   
ref|XP_002952518.1|  ribosomal protein L13 component of cytosolic...    173   1e-50   
ref|XP_005360630.1|  PREDICTED: 60S ribosomal protein L13-like is...    173   1e-50   
ref|XP_010789836.1|  PREDICTED: 60S ribosomal protein L13               173   1e-50   
gb|ELU11053.1|  hypothetical protein CAPTEDRAFT_183211                  173   1e-50   
ref|XP_001356321.1|  GA18330                                            173   2e-50   
gb|AHH02400.1|  putative 60S ribosomal protein L13                      169   2e-50   
ref|XP_008774860.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    173   2e-50   
ref|XP_004339252.1|  ribosomal protein L13e, putative                   173   2e-50   
ref|XP_001692670.1|  ribosomal protein L13, component of cytosoli...    173   2e-50   
ref|XP_011301440.1|  PREDICTED: 60S ribosomal protein L13               173   2e-50   
gb|ACO12533.1|  60S ribosomal protein L13                               172   2e-50   
ref|NP_001086472.1|  ribosomal protein L13                              172   2e-50   
gb|ACN10300.1|  60S ribosomal protein L13                               172   2e-50   
gb|ABI26261.1|  ribosomal protein L13                                   172   2e-50   
ref|NP_001134763.1|  60S ribosomal protein L13                          172   2e-50   
ref|XP_006027900.1|  PREDICTED: 60S ribosomal protein L13               172   2e-50   
ref|XP_007531327.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    172   3e-50   
ref|XP_003400747.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     172   3e-50   
ref|NP_058018.2|  60S ribosomal protein L13                             172   3e-50   
dbj|BAF98660.1|  ribosomal protein L13                                  172   3e-50   
dbj|BAB27309.1|  unnamed protein product                                172   3e-50   
ref|NP_001230274.1|  ribosomal protein L13                              172   3e-50   
ref|XP_005345872.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    172   3e-50   
ref|XP_001140497.2|  PREDICTED: 60S ribosomal protein L13               172   3e-50   
ref|XP_006641265.1|  PREDICTED: 60S ribosomal protein L13-like is...    172   3e-50   
ref|XP_001366584.1|  PREDICTED: 60S ribosomal protein L13               172   3e-50   
ref|XP_003280664.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     172   4e-50   
ref|XP_008838743.1|  PREDICTED: 60S ribosomal protein L13               172   4e-50   
gb|AAH66320.1|  Ribosomal protein L13                                   172   4e-50   
ref|XP_006001099.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    172   4e-50   
gb|KFO77864.1|  60S ribosomal protein L13                               172   4e-50   
ref|XP_006902912.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    172   4e-50   
ref|XP_007937363.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    172   4e-50   
ref|XP_003418096.1|  PREDICTED: 60S ribosomal protein L13               172   5e-50   
ref|XP_004392184.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     172   5e-50   
ref|XP_002108220.1|  expressed hypothetical protein                     172   5e-50   
ref|XP_536749.1|  PREDICTED: 60S ribosomal protein L13 isoformX1        172   5e-50   
gb|EDL78512.1|  rCG62940                                                171   5e-50   
ref|XP_003800857.1|  PREDICTED: 60S ribosomal protein L13               172   5e-50   
ref|XP_005862549.1|  PREDICTED: 60S ribosomal protein L13               171   5e-50   
ref|XP_004377825.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     171   5e-50   
ref|XP_003758535.1|  PREDICTED: 60S ribosomal protein L13               171   5e-50   
gb|AAA69923.1|  60S ribosomal protein                                   171   6e-50   
ref|XP_004878310.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    171   6e-50   
gb|KFO95639.1|  60S ribosomal protein L13                               171   6e-50   
emb|CEF65706.1|  60S ribosomal protein L13                              171   6e-50   
ref|NP_150254.1|  60S ribosomal protein L13 isoform 1                   171   6e-50   
sp|O48513.1|RL13_CHLSW  RecName: Full=60S ribosomal protein L13; ...    171   7e-50   
ref|XP_004666135.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    171   7e-50   
gb|EYB89261.1|  hypothetical protein Y032_0234g3156                     171   7e-50   
gb|AAX29381.1|  ribosomal protein L13                                   171   7e-50   
emb|CBJ27745.1|  conserved unknown protein                              171   7e-50   
ref|XP_003708357.1|  PREDICTED: 60S ribosomal protein L13-like          171   8e-50   
ref|XP_005892455.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    171   8e-50   
gb|AAF97844.1|  breast basic conserved protein                          170   9e-50   
ref|XP_004878313.1|  PREDICTED: 60S ribosomal protein L13 isoform X4    170   9e-50   
ref|XP_001092801.1|  PREDICTED: 60S ribosomal protein L13-like is...    171   9e-50   
ref|XP_005608561.1|  PREDICTED: 60S ribosomal protein L13               171   9e-50   
gb|AAH85493.1|  Rpl13 protein                                           171   1e-49   
ref|XP_009801132.1|  PREDICTED: 60S ribosomal protein L13-1-like        167   1e-49   
emb|CCG83902.1|  protein of unknown function                            171   1e-49   
ref|XP_007234286.1|  PREDICTED: 60S ribosomal protein L13               171   1e-49   
emb|CDP02021.1|  unnamed protein product                                168   1e-49   
ref|XP_006751829.1|  PREDICTED: 60S ribosomal protein L13-like is...    171   1e-49   
sp|Q95043.1|RL13_SCHMA  RecName: Full=60S ribosomal protein L13; ...    170   1e-49   
ref|XP_007468509.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    171   1e-49   
ref|XP_004471974.1|  PREDICTED: 60S ribosomal protein L13-like          171   1e-49   
ref|XP_011191555.1|  PREDICTED: 60S ribosomal protein L13               171   1e-49   
ref|NP_001015543.1|  60S ribosomal protein L13                          171   1e-49   
ref|XP_624896.1|  PREDICTED: 60S ribosomal protein L13 isoform 1        171   1e-49   
gb|ABX75438.1|  60S ribosomal protein l13                               171   1e-49   
gb|EPQ05393.1|  60S ribosomal protein L13                               172   1e-49   
ref|XP_011201713.1|  PREDICTED: 60S ribosomal protein L13               171   1e-49   
ref|NP_112363.1|  60S ribosomal protein L13                             171   1e-49   
ref|XP_004280098.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     171   1e-49   
ref|XP_009538854.1|  hypothetical protein PHYSODRAFT_356191             170   1e-49   
gb|KII63010.1|  60S ribosomal protein L13                               170   1e-49   
ref|XP_008988818.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    170   2e-49   
ref|XP_003694362.1|  PREDICTED: 60S ribosomal protein L13-like is...    171   2e-49   
ref|XP_005956611.1|  PREDICTED: 60S ribosomal protein L13-like is...    170   2e-49   
ref|XP_008613112.1|  50S ribosomal protein L13e                         170   2e-49   
gb|KDO24006.1|  50S ribosomal protein L13e                              170   2e-49   
emb|CCD74666.1|  putative 60s ribosomal protein L13 (BBC1 protein...    170   2e-49   
ref|NP_989111.1|  60S ribosomal protein L13                             170   2e-49   
ref|XP_003694363.1|  PREDICTED: 60S ribosomal protein L13-like is...    171   2e-49   
ref|XP_004437070.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     170   2e-49   
ref|XP_007992611.1|  PREDICTED: 60S ribosomal protein L13               170   2e-49   
ref|XP_003227488.1|  PREDICTED: 60S ribosomal protein L13               170   2e-49   
ref|XP_002128780.1|  PREDICTED: 60S ribosomal protein L13-like          170   2e-49   
tpg|DAA20190.1|  TPA: ribosomal protein L13-like                        170   2e-49   
ref|XP_010902173.1|  PREDICTED: 60S ribosomal protein L13               170   2e-49   
ref|XP_001607329.1|  PREDICTED: 60S ribosomal protein L13               170   2e-49   
ref|XP_005188755.1|  PREDICTED: 60S ribosomal protein L13               170   2e-49   
ref|XP_010625865.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    171   2e-49   
emb|CDS05093.1|  Putative 60S ribosomal protein L13                     170   2e-49   
emb|CDS10828.1|  Putative 60S ribosomal protein L13                     170   3e-49   
ref|XP_005537717.1|  60S ribosomal protein L13                          170   3e-49   
emb|CAA45963.1|  BBC1                                                   169   3e-49   
gb|AEB54639.1|  ribosomal protein L13                                   169   3e-49   
ref|XP_009561513.1|  PREDICTED: 60S ribosomal protein L13               171   3e-49   
ref|XP_002002807.1|  GI17580                                            170   3e-49   
gb|ACQ58287.1|  60S ribosomal protein L13                               169   4e-49   
gb|ETE69154.1|  60S ribosomal protein L13                               169   4e-49   
emb|CCD27769.1|  ribosomal protein l13                                  169   4e-49   
ref|XP_001963023.1|  GF15733                                            169   4e-49   
gb|AEA39508.1|  ribosomal protein L13                                   169   4e-49   
ref|XP_002905546.1|  60S ribosomal protein L13, putative                169   4e-49   
ref|XP_004629406.1|  PREDICTED: 60S ribosomal protein L13-like is...    169   5e-49   
gb|AAH41531.1|  Similar to ribosomal protein L13                        169   6e-49   
ref|XP_010968289.1|  PREDICTED: 60S ribosomal protein L13               169   6e-49   
gb|KGB37304.1|  60S ribosomal protein L13                               169   6e-49   
ref|XP_005073262.1|  PREDICTED: 60S ribosomal protein L13               169   6e-49   
ref|XP_007433001.1|  PREDICTED: 60S ribosomal protein L13               169   7e-49   
emb|CDH52057.1|  rpl13 protein isoform 1                                169   7e-49   
gb|KHN86867.1|  60S ribosomal protein L13                               169   8e-49   
ref|XP_004645046.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    168   8e-49   
emb|CAX77642.1|  putative ribosomal protein L13                         168   9e-49   
emb|CAX71654.1|  putative ribosomal protein L13                         168   9e-49   
ref|XP_011161316.1|  PREDICTED: 60S ribosomal protein L13               169   9e-49   
emb|CAX71653.1|  putative ribosomal protein L13                         168   1e-48   
ref|NP_001233732.1|  60S ribosomal protein L13                          168   1e-48   
emb|CAX77649.1|  putative ribosomal protein L13                         168   1e-48   
ref|XP_009493922.1|  50S ribosomal protein L13e, variant                168   1e-48   
ref|XP_002065688.1|  GK15580                                            168   1e-48   
ref|XP_002057754.1|  GJ17923                                            168   1e-48   
ref|XP_011337341.1|  PREDICTED: 60S ribosomal protein L13               168   1e-48   
ref|XP_003626152.1|  60S ribosomal protein L13                          166   1e-48   
emb|CEJ00025.1|  Putative 60S ribosomal protein L13                     167   1e-48   
gb|EGV94062.1|  60S ribosomal protein L13                               167   2e-48   
ref|XP_003144033.1|  60S ribosomal protein L13                          168   2e-48   
ref|XP_010996322.1|  PREDICTED: 60S ribosomal protein L13               169   2e-48   
ref|XP_001418121.1|  Ribosomal protein L13, component of cytosoli...    168   2e-48   
ref|XP_005343024.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    167   2e-48   
gb|KIH58992.1|  ribosomal protein L13e                                  167   2e-48   
emb|CEF98175.1|  Ribosomal protein L13e                                 168   2e-48   
ref|XP_008895254.1|  hypothetical protein PPTG_04728                    167   2e-48   
gb|ABR23469.1|  60S ribosomal protein L13                               167   2e-48   
gb|ACK44340.1|  ribosomal protein L13                                   167   2e-48   
emb|CDH57872.1|  rpl13 protein isoform 1                                168   2e-48   
ref|XP_006879341.1|  PREDICTED: 60S ribosomal protein L13-like is...    167   2e-48   
gb|AAI02866.1|  RPL13 protein                                           170   3e-48   
emb|CDH57871.1|  rpl13 protein isoform 1                                168   3e-48   
ref|XP_002723646.2|  PREDICTED: 60S ribosomal protein L13               168   3e-48   
ref|XP_011061614.1|  PREDICTED: 60S ribosomal protein L13               167   3e-48   
gb|ERG83884.1|  60s ribosomal protein l13                               167   3e-48   
ref|XP_004347856.1|  ribosomal protein L13                              167   4e-48   
gb|EFO20037.2|  50S ribosomal protein L13e                              168   4e-48   
gb|AEL28872.1|  ribosomal protein L13                                   167   4e-48   
ref|XP_004534535.1|  PREDICTED: 60S ribosomal protein L13-like          167   5e-48   
gb|AAO53449.2|  breast basic conserved protein                          166   5e-48   
gb|ADT80692.1|  ribosomal protein L13                                   167   5e-48   
ref|NP_001238240.1|  uncharacterized protein LOC100499935               164   7e-48   
emb|CDJ91841.1|  Ribosomal protein L13e domain containing protein       166   8e-48   
ref|XP_002428060.1|  60S ribosomal protein L13, putative                166   8e-48   
emb|CDH52687.1|  60s ribosomal protein l13                              167   8e-48   
ref|XP_629876.1|  S60 ribosomal protein L13                             166   8e-48   
gb|EHJ77643.1|  ribosomal protein L13                                   166   9e-48   
gb|AEE62125.1|  unknown                                                 166   9e-48   
emb|CDW83808.1|  60s ribosomal protein l13                              166   1e-47   
emb|CDH52688.1|  rpl13 protein isoform 1                                167   1e-47   
gb|KIZ01101.1|  60S ribosomal protein L13-2                             164   1e-47   
emb|CAR63548.1|  putative Ribosomal Protein                             166   1e-47   
ref|XP_010401937.1|  PREDICTED: 60S ribosomal protein L13               165   1e-47   
gb|ACY95361.1|  ribosomal protein L13                                   166   2e-47   
ref|XP_004012492.1|  PREDICTED: 60S ribosomal protein L13-like is...    165   2e-47   
gb|AAL93210.1|AF487458_1  BBC1-like protein                             163   2e-47   
gb|AAN73374.1|  ribosomal protein L13                                   164   2e-47   
ref|XP_002772329.1|  60S ribosomal protein L13, putative                165   2e-47   
ref|XP_001901016.1|  60S ribosomal protein L13                          165   2e-47   
emb|CAJ17270.1|  ribosomal protein L13e                                 165   2e-47   
ref|XP_008959127.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    165   2e-47   
ref|XP_011264774.1|  PREDICTED: 60S ribosomal protein L13               165   2e-47   
gb|AAV91770.1|  ribosomal protein L13                                   165   2e-47   
gb|ESA03652.1|  hypothetical protein GLOINDRAFT_240136                  165   2e-47   
gb|ETN63436.1|  Ribosomal protein L13                                   165   2e-47   
emb|CDH52686.1|  60s ribosomal protein l13                              166   2e-47   
sp|Q962U1.1|RL13_SPOFR  RecName: Full=60S ribosomal protein L13         165   2e-47   
gb|EJY78606.1|  60S ribosomal protein L13                               165   2e-47   
gb|ADG29169.1|  60S ribosomal protein L13                               164   3e-47   
gb|ETN70099.1|  ribosomal protein L13e                                  164   3e-47   
ref|XP_001988257.1|  GH11063                                            164   4e-47   
dbj|BAM17673.1|  ribosomal protein L13                                  164   4e-47   
gb|ACD65120.1|  putative 60S ribosomal protein RPL13                    161   5e-47   
ref|XP_009811475.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    164   5e-47   
ref|XP_006897765.1|  PREDICTED: 60S ribosomal protein L13-like is...    164   7e-47   
gb|KIY64210.1|  ribosomal protein L13e                                  163   8e-47   
gb|KFV54384.1|  60S ribosomal protein L13                               163   9e-47   
ref|XP_006055879.1|  PREDICTED: 60S ribosomal protein L13-like is...    163   1e-46   
ref|NP_001037153.1|  ribosomal protein L13                              163   1e-46   
dbj|BAD18973.2|  60S ribosomal protein L13                              163   1e-46   
gb|EPX71322.1|  60S ribosomal protein L13                               162   2e-46   
dbj|BAB71993.1|  BBC1-like protein                                      160   2e-46   
emb|CDH58842.1|  60s ribosomal protein l13                              164   2e-46   
gb|EFN83142.1|  60S ribosomal protein L13                               160   2e-46   
ref|XP_002172858.1|  60S ribosomal protein L13                          162   2e-46   
gb|ADC97461.1|  putative 60S ribosomal protein L13e                     162   3e-46   
gb|AFK38490.1|  unknown                                                 159   3e-46   
ref|XP_011141542.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    162   3e-46   
emb|CEP16016.1|  hypothetical protein                                   164   3e-46   
ref|NP_001021017.1|  Protein RPL-13, isoform a                          162   4e-46   
ref|XP_004705772.1|  PREDICTED: 60S ribosomal protein L13-like is...    162   4e-46   
ref|XP_009493923.1|  50S ribosomal protein L13e                         166   5e-46   
ref|XP_004710007.1|  PREDICTED: 60S ribosomal protein L13-like is...    161   6e-46   
ref|XP_002786129.1|  60S ribosomal protein L13, putative                161   6e-46   



>ref|XP_004146887.1| PREDICTED: 60S ribosomal protein L13-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004146888.1| PREDICTED: 60S ribosomal protein L13-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004164245.1| PREDICTED: 60S ribosomal protein L13-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004164246.1| PREDICTED: 60S ribosomal protein L13-2-like isoform 2 [Cucumis 
sativus]
 gb|KGN53190.1| hypothetical protein Csa_4G025200 [Cucumis sativus]
Length=206

 Score =   281 bits (719),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRNARQEKAVKNFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRRRN SLE LQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLESLQANVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            K+VVFPRRARKFKAGDSTPEELA ATQV GPYLPI REKASV
Sbjct  121  KVVVFPRRARKFKAGDSTPEELANATQVQGPYLPIGREKASV  162



>ref|XP_008453835.1| PREDICTED: 60S ribosomal protein L13-3 [Cucumis melo]
Length=206

 Score =   280 bits (716),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRNARQEKAVKNFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            K+VVFPRRARKFKAGDSTPEELA ATQV GPYLPI REKASV
Sbjct  121  KVVVFPRRARKFKAGDSTPEELANATQVQGPYLPIGREKASV  162



>ref|XP_011084605.1| PREDICTED: 60S ribosomal protein L13-1 [Sesamum indicum]
Length=207

 Score =   280 bits (716),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVVPNGHFRKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRRRN SLEG Q NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLEGFQTNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRR RKFKAGDSTPEELATATQV+GPYLPI+REK +V
Sbjct  121  AKLVVFPRRVRKFKAGDSTPEELATATQVSGPYLPIVREKPTV  163



>ref|XP_010054042.1| PREDICTED: 60S ribosomal protein L13-2 [Eucalyptus grandis]
 gb|KCW78426.1| hypothetical protein EUGRSUZ_D02588 [Eucalyptus grandis]
Length=206

 Score =   278 bits (711),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNVVPSGHFRKHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVVPSGHFRKHWQNYVKTWFNQPARKSRRRQARQQKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAG+GFSLEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFSLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRRARKFKAGDST EELA+ATQV G Y+PI+REK +V
Sbjct  121  KLVVFPRRARKFKAGDSTAEELASATQVQGSYMPIVREKPAV  162



>ref|XP_011075827.1| PREDICTED: 60S ribosomal protein L13-1-like [Sesamum indicum]
Length=207

 Score =   277 bits (709),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFRKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRRRN SLEG Q NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLEGFQTNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRR RKFKAGDST EELATATQV+GPYLPI+REK +V
Sbjct  121  AKLVVFPRRVRKFKAGDSTAEELATATQVSGPYLPIVREKPTV  163



>gb|KDP38855.1| hypothetical protein JCGZ_05012 [Jatropha curcas]
Length=206

 Score =   277 bits (709),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRRARKFKAGDS PEELATATQV G YLPI RE+ S+
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGEYLPIARERPSI  162



>gb|KDP21801.1| hypothetical protein JCGZ_00588 [Jatropha curcas]
Length=206

 Score =   277 bits (708),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRVARQQKAVKIFPRPTAGPLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ N+QRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNIQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRRARKFKAGDS PEELATATQV G Y+PI+REK SV
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGQYMPIVREKPSV  162



>ref|XP_010243468.1| PREDICTED: 60S ribosomal protein L13-1 [Nelumbo nucifera]
Length=207

 Score =   276 bits (705),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDS+ EELATATQV G Y+PI REK S+
Sbjct  121  AKLVVFPRRARKFKAGDSSAEELATATQVQGAYMPIEREKPSI  163



>ref|XP_010269352.1| PREDICTED: 60S ribosomal protein L13-1-like [Nelumbo nucifera]
Length=207

 Score =   275 bits (704),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDS+ EELATATQV GPY+ I REK S+
Sbjct  121  AKLVVFPRRARKFKAGDSSAEELATATQVQGPYMCIEREKPSI  163



>ref|XP_007158142.1| hypothetical protein PHAVU_002G127900g [Phaseolus vulgaris]
 gb|ESW30136.1| hypothetical protein PHAVU_002G127900g [Phaseolus vulgaris]
Length=207

 Score =   275 bits (703),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRRRN SLE +Q+NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLESMQSNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI REKA V
Sbjct  121  AKLVVFPRRARKVKAGDSTPEELANATQVQGSYLPIAREKAPV  163



>gb|AGV54370.1| 60S ribosomal protein L13-2-like protein [Phaseolus vulgaris]
Length=207

 Score =   275 bits (702),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRRRN SLE +Q+NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLESMQSNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI REKA V
Sbjct  121  AKLVVFPRRARKVKAGDSTPEELANATQVQGSYLPIAREKAPV  163



>ref|XP_009795347.1| PREDICTED: 60S ribosomal protein L13-1 [Nicotiana sylvestris]
Length=206

 Score =   274 bits (701),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGTLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR+GRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRRARK KAGDS PEELATATQV+G Y+PI REK SV
Sbjct  121  KLVVFPRRARKVKAGDSAPEELATATQVHGAYMPIAREKPSV  162



>gb|AFK39980.1| unknown [Lotus japonicus]
Length=207

 Score =   274 bits (700),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG+LRP+VHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGSLRPMVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAG+GFSLEELKAAGI +KLAPTIGISVDHRRRN SLEGLQANV RLKTYK
Sbjct  61   QTLKYNMKVRAGKGFSLEELKAAGIPRKLAPTIGISVDHRRRNRSLEGLQANVHRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+RE+ SV
Sbjct  121  AKLVVFPRRARKVKAGDSTPEELANATQVQGTYLPIVRERPSV  163



>gb|KHG24237.1| 60S ribosomal L13-2 [Gossypium arboreum]
Length=207

 Score =   273 bits (699),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR +RQKKAV+IFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRISRQKKAVRIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDST EELATATQV GPY+ I REK SV
Sbjct  121  AKLVVFPRRARKFKAGDSTAEELATATQVQGPYMRISREKPSV  163



>gb|KHG21579.1| 60S ribosomal L13-2 [Gossypium arboreum]
Length=207

 Score =   273 bits (699),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDST EELATATQV GPY+PI REK SV
Sbjct  121  AKLVVFPRRARKSKAGDSTAEELATATQVQGPYMPISREKPSV  163



>ref|XP_006451725.1| hypothetical protein CICLE_v10009507mg [Citrus clementina]
 gb|ESR64965.1| hypothetical protein CICLE_v10009507mg [Citrus clementina]
Length=206

 Score =   273 bits (698),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKNRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMK+RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRRARKFKAGDS PEELATATQV GPY+PI  EK +V
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGPYMPITLEKPTV  162



>ref|XP_009619310.1| PREDICTED: 60S ribosomal protein L13-1 [Nicotiana tomentosiformis]
Length=206

 Score =   273 bits (698),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGTLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR+GRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRRAR+ KAGDS PEELATATQV+G Y+PI REK SV
Sbjct  121  KLVVFPRRARQVKAGDSAPEELATATQVHGAYMPIAREKPSV  162



>gb|KJB22724.1| hypothetical protein B456_004G062900 [Gossypium raimondii]
 gb|KJB22725.1| hypothetical protein B456_004G062900 [Gossypium raimondii]
Length=207

 Score =   273 bits (698),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDST EELATATQ+ GPY+PI REK SV
Sbjct  121  AKLVVFPRRARKSKAGDSTAEELATATQMQGPYMPIYREKPSV  163



>gb|KJB08613.1| hypothetical protein B456_001G093800 [Gossypium raimondii]
 gb|KJB08614.1| hypothetical protein B456_001G093800 [Gossypium raimondii]
 gb|KJB08615.1| hypothetical protein B456_001G093800 [Gossypium raimondii]
Length=207

 Score =   273 bits (697),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDS  EELATATQV GPY+PI REK SV
Sbjct  121  AKLVVFPRRARKFKAGDSPAEELATATQVQGPYMPISREKPSV  163



>ref|XP_011023520.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011023521.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011013522.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011013523.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
Length=207

 Score =   273 bits (697),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDS PEELATATQV G  +PI+ EK SV
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGQIMPIVLEKPSV  163



>ref|XP_006485662.1| PREDICTED: 60S ribosomal protein L13-1-like [Citrus sinensis]
 gb|KDO48329.1| hypothetical protein CISIN_1g028624mg [Citrus sinensis]
Length=206

 Score =   273 bits (697),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKNRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMK+RAGRGF+LEELKAAGI KKLAPTIG+SVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRRARKFKAGDS PEELATATQV GPY+PI  EK +V
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGPYMPITLEKPTV  162



>ref|XP_007049063.1| 60S ribosomal protein L13 [Theobroma cacao]
 gb|EOX93220.1| 60S ribosomal protein L13 [Theobroma cacao]
Length=207

 Score =   272 bits (696),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTSGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDST EELATATQV GPY+PI  EK SV
Sbjct  121  AKLVVFPRRARKFKAGDSTAEELATATQVQGPYMPISLEKPSV  163



>gb|KJB42885.1| hypothetical protein B456_007G172400 [Gossypium raimondii]
 gb|KJB42886.1| hypothetical protein B456_007G172400 [Gossypium raimondii]
Length=207

 Score =   272 bits (696),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTSGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDST EELATATQV G Y+PI REK SV
Sbjct  121  AKLVVFPRRARKFKAGDSTAEELATATQVQGSYMPISREKPSV  163



>gb|KHG03134.1| 60S ribosomal L13-2 [Gossypium arboreum]
Length=207

 Score =   272 bits (696),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTSGTLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFP+RARKFKAGDST EELATATQV G Y+PI REK SV
Sbjct  121  AKLVVFPKRARKFKAGDSTAEELATATQVQGSYMPISREKPSV  163



>ref|XP_006478303.1| PREDICTED: 60S ribosomal protein L13-1-like [Citrus sinensis]
Length=206

 Score =   272 bits (695),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKNRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMK+RAGRGF+LEELKAAGI KKLAPTIG+SVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRRARKFKAGDS PEELATATQV GPY+PI  EK +V
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTV  162



>ref|XP_002529265.1| 60S ribosomal protein L13, putative [Ricinus communis]
 gb|EEF33097.1| 60S ribosomal protein L13, putative [Ricinus communis]
Length=207

 Score =   272 bits (695),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDS PEELATATQV G Y+PI+REK SV
Sbjct  121  AKLVVFPRRARKSKAGDSAPEELATATQVQGKYMPIVREKPSV  163



>ref|XP_011028035.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011028036.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
Length=207

 Score =   272 bits (695),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEG+QAN++RL TYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGIQANIRRLNTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDS PEELATATQV G +LPI+REKASV
Sbjct  121  AKLVVFPRRARKLKAGDSAPEELATATQVQGQFLPIVREKASV  163



>ref|XP_011018407.1| PREDICTED: 60S ribosomal protein L13-1 [Populus euphratica]
Length=207

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDS PEELATATQV G ++PI+REK SV
Sbjct  121  AKLVVFPRRARKSKAGDSAPEELATATQVQGHFMPIVREKPSV  163



>ref|XP_006368290.1| 60S ribosomal protein L13 [Populus trichocarpa]
 gb|ERP64859.1| 60S ribosomal protein L13 [Populus trichocarpa]
Length=207

 Score =   272 bits (695),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDS PEELATATQV G ++PI+REK SV
Sbjct  121  AKLVVFPRRARKSKAGDSAPEELATATQVQGHFMPIVREKPSV  163



>ref|XP_006441816.1| hypothetical protein CICLE_v10022283mg [Citrus clementina]
 gb|ESR55056.1| hypothetical protein CICLE_v10022283mg [Citrus clementina]
Length=206

 Score =   271 bits (694),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKSRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMK+RAGRGF+LEELKAAGI KKLAPTIG+SVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRRARKFKAGDS PEELATATQV GPY+PI  E+ +V
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPERPTV  162



>gb|AAQ96375.1| 60S ribosomal protein L13 [Solanum palustre]
Length=200

 Score =   271 bits (693),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRA+K KAGDS+ EELATATQV GPYLPI RE+ +V
Sbjct  121  KLVIFPRRAKKVKAGDSSAEELATATQVQGPYLPITREQPAV  162



>emb|CDP17844.1| unnamed protein product [Coffea canephora]
 emb|CDP08129.1| unnamed protein product [Coffea canephora]
 emb|CDP04953.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   271 bits (693),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVPSGHFRKHWQNYVKTWFNQPARK RRR ARQKKA KIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPSGHFRKHWQNYVKTWFNQPARKTRRRNARQKKAAKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGF+LEELKAAGI KKL PTIG+SVDHRR+N SLEG QANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKAAGIPKKLGPTIGVSVDHRRKNRSLEGFQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDS PEELATATQV G YLPI+ EK  V
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGAYLPIVCEKPCV  163



>ref|XP_002319032.1| hypothetical protein POPTR_0013s02860g [Populus trichocarpa]
 ref|XP_006375784.1| 60S ribosomal protein L13 [Populus trichocarpa]
 gb|EEE94955.1| hypothetical protein POPTR_0013s02860g [Populus trichocarpa]
 gb|ERP53581.1| 60S ribosomal protein L13 [Populus trichocarpa]
Length=207

 Score =   271 bits (693),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDS PEELATATQV G  +PI+ EK  V
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGQIMPIVLEKPCV  163



>ref|XP_002304378.1| 60S ribosomal protein L13 [Populus trichocarpa]
 gb|ABK93509.1| unknown [Populus trichocarpa]
 gb|EEE79357.1| 60S ribosomal protein L13 [Populus trichocarpa]
Length=207

 Score =   271 bits (693),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEG+QAN++RL TYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGIQANIRRLNTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDS PEELATATQV G ++PI+REKASV
Sbjct  121  AKLVVFPRRARKLKAGDSAPEELATATQVQGQFMPIVREKASV  163



>ref|XP_008467320.1| PREDICTED: 60S ribosomal protein L13-3-like [Cucumis melo]
Length=206

 Score =   271 bits (693),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRNARQEKAVKAFPRPTAGPLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGFSLEELKAAGI KK APTIGI+VDHRRRN SLE LQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLESLQANVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            K+VVFPRRARKFKAGDSTPEELATATQV G Y+PI  EK SV
Sbjct  121  KVVVFPRRARKFKAGDSTPEELATATQVQGSYMPIGLEKPSV  162



>ref|XP_004143667.1| PREDICTED: 60S ribosomal protein L13-1-like [Cucumis sativus]
 ref|XP_004158113.1| PREDICTED: 60S ribosomal protein L13-1-like [Cucumis sativus]
 gb|KGN50340.1| hypothetical protein Csa_5G168780 [Cucumis sativus]
Length=206

 Score =   271 bits (692),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRNARQEKAVKAFPRPTAGPLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGFSLEELKAAGI KK APTIGI+VDHRRRN SLE LQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLESLQANVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            K+VVFPRRARKFKAGDSTPEELATATQV G Y+PI  EK SV
Sbjct  121  KVVVFPRRARKFKAGDSTPEELATATQVQGSYMPIGLEKPSV  162



>ref|XP_008238048.1| PREDICTED: 60S ribosomal protein L13-1 [Prunus mume]
Length=207

 Score =   271 bits (692),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRKARQEKAVKIFPRPTSGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVR+GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRSGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDS+PEELA ATQ+ GPY+PI+REK +V
Sbjct  121  AKLVVFPRRARKLKAGDSSPEELANATQIQGPYMPIVREKPTV  163



>ref|XP_004245965.1| PREDICTED: 60S ribosomal protein L13-1-like [Solanum lycopersicum]
Length=206

 Score =   271 bits (692),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRA+K KAGDS+ EELATATQV GPYLPI RE+ +V
Sbjct  121  KLVIFPRRAKKVKAGDSSAEELATATQVQGPYLPITREQPAV  162



>ref|XP_010056172.1| PREDICTED: 60S ribosomal protein L13-1-like [Eucalyptus grandis]
 ref|XP_010056173.1| PREDICTED: 60S ribosomal protein L13-1-like [Eucalyptus grandis]
 gb|KCW72772.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
 gb|KCW72773.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
 gb|KCW72774.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
 gb|KCW72775.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
Length=207

 Score =   271 bits (692),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVPSGHFRKHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVVPSGHFRKHWQNYVKTWFNQPARKARRRLARQKKAVRIFPRPTAGPLRPVVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT+KYNMKVRAG+GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTY+
Sbjct  61   QTVKYNMKVRAGKGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANMQRLKTYR  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPR ARKFKAGDSTPEELA ATQV G YLPI+REK +V
Sbjct  121  AKLVVFPRHARKFKAGDSTPEELANATQVQGTYLPIVREKPAV  163



>ref|XP_010269338.1| PREDICTED: 60S ribosomal protein L13-1-like [Nelumbo nucifera]
Length=207

 Score =   270 bits (691),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA KFKAGDS+ EELATATQV G Y+PI REK SV
Sbjct  121  AKLVVFPRRACKFKAGDSSAEELATATQVQGLYMPIEREKPSV  163



>ref|XP_002519996.1| 60S ribosomal protein L13, putative [Ricinus communis]
 gb|EEF42320.1| 60S ribosomal protein L13, putative [Ricinus communis]
Length=207

 Score =   270 bits (691),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDS  EELATATQV G Y+PI REK SV
Sbjct  121  AKLVVFPRRARKFKAGDSAAEELATATQVQGQYMPIAREKPSV  163



>ref|XP_003522855.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X1 [Glycine 
max]
 ref|XP_006578380.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X2 [Glycine 
max]
 gb|KHN06098.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   270 bits (691),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA+K KAGDSTPEELA ATQV G +LPI+REK +V
Sbjct  121  AKLVVFPRRAQKVKAGDSTPEELANATQVQGSFLPIVREKPTV  163



>ref|XP_003547825.1| PREDICTED: 60S ribosomal protein L13-1-like [Glycine max]
 gb|KHM99443.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   270 bits (691),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG+LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGSLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA K KAGDS+ EELA ATQV GP+LPI+REK +V
Sbjct  121  AKLVVFPRRAHKVKAGDSSLEELANATQVQGPFLPIVREKPTV  163



>ref|XP_003626150.1| 60S ribosomal protein L13 [Medicago truncatula]
 gb|AES82368.1| 60S ribosomal L13-like protein [Medicago truncatula]
 gb|AFK42534.1| unknown [Medicago truncatula]
Length=207

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAG+GFSLEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTQKYNMKLRAGKGFSLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+REK SV
Sbjct  121  AKLVVFPRRARKVKAGDSTPEELANATQVQGSYLPIVREKPSV  163



>gb|AFK47578.1| unknown [Medicago truncatula]
Length=207

 Score =   270 bits (690),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTAKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+REK +V
Sbjct  121  AKLVVFPRRARKTKAGDSTPEELANATQVQGSYLPIVREKPTV  163



>ref|XP_010906706.1| PREDICTED: 60S ribosomal protein L13-1-like [Elaeis guineensis]
Length=207

 Score =   270 bits (689),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVRTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRRARKFKAGDS PEELATATQV GPY+PI+ EK SV
Sbjct  121  AKLVIFPRRARKFKAGDSAPEELATATQVQGPYMPIVCEKPSV  163



>gb|ACJ83949.1| unknown [Medicago truncatula]
 gb|AFK42168.1| unknown [Medicago truncatula]
 gb|KEH40126.1| 60S ribosomal L13-like protein [Medicago truncatula]
Length=207

 Score =   270 bits (689),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTAKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+REK +V
Sbjct  121  AKLVVFPRRARKTKAGDSTPEELANATQVQGSYLPIVREKPTV  163



>ref|XP_009382822.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   269 bits (688),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK R+GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRSGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRR RKFKAGDS+PEELATATQV GPYLPI+RE+ SV
Sbjct  121  AKLVIFPRRTRKFKAGDSSPEELATATQVQGPYLPIVREQPSV  163



>ref|XP_010940804.1| PREDICTED: 60S ribosomal protein L13-1 [Elaeis guineensis]
 ref|XP_010940805.1| PREDICTED: 60S ribosomal protein L13-1 [Elaeis guineensis]
Length=207

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVRTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRRARKFKAGDS PEELATATQV GPY+P++REK +V
Sbjct  121  AKLVIFPRRARKFKAGDSAPEELATATQVQGPYMPVVREKPTV  163



>gb|AFK36916.1| unknown [Medicago truncatula]
Length=207

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTAKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+REK +V
Sbjct  121  AKLVVFPRRARKTKAGDSTPEELANATQVQGSYLPIVREKPTV  163



>ref|XP_007209605.1| hypothetical protein PRUPE_ppa011506mg [Prunus persica]
 gb|EMJ10804.1| hypothetical protein PRUPE_ppa011506mg [Prunus persica]
Length=207

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRKARQEKAVKIFPRPTSGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVR+GRGF+LEELK AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRSGRGFTLEELKTAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDS+PEELA ATQ+ GPY+PI+REK +V
Sbjct  121  AKLVVFPRRARKLKAGDSSPEELANATQIQGPYMPIVREKPTV  163



>emb|CAN84167.1| hypothetical protein VITISV_018882 [Vitis vinifera]
Length=207

 Score =   269 bits (687),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRR RKFKAGDS+ EELATATQV G Y+PI+REK +V
Sbjct  121  AKLVVFPRRTRKFKAGDSSVEELATATQVQGLYMPIVREKPTV  163



>ref|XP_002874151.1| 60S ribosomal protein L13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50410.1| 60S ribosomal protein L13 [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   269 bits (687),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAG+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRR+RK KAGDSTPEELA ATQV G Y+PI  EKA++
Sbjct  121  KLVVFPRRSRKVKAGDSTPEELANATQVQGDYMPIASEKAAM  162



>ref|XP_008775606.1| PREDICTED: 60S ribosomal protein L13-1 [Phoenix dactylifera]
 ref|XP_008775608.1| PREDICTED: 60S ribosomal protein L13-1 [Phoenix dactylifera]
Length=207

 Score =   269 bits (687),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+V  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK R GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRVGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRRARKFKAGDS PEELATATQV GPY+PI+REK +V
Sbjct  121  AKLVIFPRRARKFKAGDSAPEELATATQVQGPYMPIVREKPTV  163



>gb|KHG20106.1| 60S ribosomal L13-1 [Gossypium arboreum]
Length=207

 Score =   269 bits (687),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPVVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPR ARKFKAGDST EELATATQV G Y+PI REK SV
Sbjct  121  AKLVVFPRCARKFKAGDSTAEELATATQVQGSYMPISREKPSV  163



>emb|CAN80613.1| hypothetical protein VITISV_025451 [Vitis vinifera]
Length=207

 Score =   269 bits (687),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRP+VHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTVGPLRPLVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDS PEEL TATQV G Y+P+++EK  V
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELGTATQVQGQYMPVVQEKPXV  163



>ref|XP_010426404.1| PREDICTED: 60S ribosomal protein L13-1-like [Camelina sativa]
Length=206

 Score =   268 bits (686),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDSTPEELA ATQV G Y+PI+REK ++
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIVREKPTM  162



>ref|NP_001276322.1| 60S ribosomal protein L13-1-like [Glycine max]
 gb|ACU14467.1| unknown [Glycine max]
Length=231

 Score =   270 bits (689),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG+LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGSLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA K KAGDS+ EELA ATQV GP+LPI+REK +V
Sbjct  121  AKLVVFPRRAHKVKAGDSSLEELANATQVQGPFLPIVREKPTV  163



>ref|XP_007156319.1| hypothetical protein PHAVU_003G276400g [Phaseolus vulgaris]
 ref|XP_007156320.1| hypothetical protein PHAVU_003G276500g [Phaseolus vulgaris]
 gb|ESW28313.1| hypothetical protein PHAVU_003G276400g [Phaseolus vulgaris]
 gb|ESW28314.1| hypothetical protein PHAVU_003G276500g [Phaseolus vulgaris]
Length=206

 Score =   268 bits (686),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMK+RAGRGFSLEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKIRAGRGFSLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQGNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPR+ARK K GDS+ EELA+ATQV GP+LPI+REK +V
Sbjct  121  KLVVFPRQARKVKTGDSSAEELASATQVQGPFLPIVREKPTV  162



>ref|XP_010503548.1| PREDICTED: 60S ribosomal protein L13-1 [Camelina sativa]
 ref|XP_010515238.1| PREDICTED: 60S ribosomal protein L13-1 [Camelina sativa]
Length=206

 Score =   268 bits (686),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDSTPEELA ATQV G Y+PI+REK ++
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIVREKPTM  162



>ref|XP_002274000.1| PREDICTED: 60S ribosomal protein L13-1 [Vitis vinifera]
 emb|CBI29087.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   268 bits (686),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRP+VHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTVGPLRPLVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDS PEEL TATQV G Y+P+++EK  V
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELGTATQVQGQYMPVVQEKPVV  163



>gb|AFK45847.1| unknown [Medicago truncatula]
 gb|AES95552.2| 60S ribosomal L13-like protein [Medicago truncatula]
Length=207

 Score =   268 bits (686),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTQKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISIDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+ EK SV
Sbjct  121  AKLVVFPRRARKVKAGDSTPEELANATQVQGSYLPIVSEKPSV  163



>ref|NP_001275203.1| 60S ribosomal protein L13 [Solanum tuberosum]
 ref|XP_006364452.1| PREDICTED: 60S ribosomal protein L13-1-like [Solanum tuberosum]
 gb|ABA46764.1| unknown [Solanum tuberosum]
 gb|AFW90558.1| 60S ribosomal protein L13 [Solanum tuberosum]
Length=206

 Score =   268 bits (685),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRA+K KAGDS+ EELATATQV G YLPI RE+ +V
Sbjct  121  KLVIFPRRAKKVKAGDSSAEELATATQVQGSYLPITREQPAV  162



>gb|KHN27522.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   268 bits (685),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVR+GRGFSLEELKAAGI KKL PTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRSGRGFSLEELKAAGIPKKLGPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA K KAGDSTPEELA ATQV G +LPI+REK +V
Sbjct  121  AKLVVFPRRAHKVKAGDSTPEELANATQVQGSFLPIVREKPTV  163



>ref|XP_010278804.1| PREDICTED: 60S ribosomal protein L13-2-like [Nelumbo nucifera]
Length=207

 Score =   268 bits (685),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            + KHNNVVP+ HFRKHWQNYVKTWFNQPARK RRR  RQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MAKHNNVVPNSHFRKHWQNYVKTWFNQPARKTRRRIDRQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKL+VFPRRA +FKAGDS  EELATATQV GPY+PI REK S+
Sbjct  121  AKLIVFPRRACEFKAGDSGAEELATATQVQGPYMPIEREKPSI  163



>ref|XP_003534321.1| PREDICTED: 60S ribosomal protein L13-1 isoformX1 [Glycine max]
 ref|XP_006587640.1| PREDICTED: 60S ribosomal protein L13-1 isoform X2 [Glycine max]
 gb|KHN11825.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   268 bits (685),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVR GRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRGGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA K KAGDSTPEELA ATQV G +LPI+REK +V
Sbjct  121  AKLVVFPRRAHKVKAGDSTPEELANATQVQGAFLPIVREKPTV  163



>emb|CDP19062.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   268 bits (685),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVPS HFRKHWQNYVKTWFNQPARK RRR ARQKKAV IFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPSSHFRKHWQNYVKTWFNQPARKTRRRNARQKKAVAIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI  KLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPTKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRRA+K K+GDS+PEELATATQV G Y+PI REK +V
Sbjct  121  AKLVIFPRRAKKIKSGDSSPEELATATQVQGSYMPITREKPTV  163



>ref|XP_009149775.1| PREDICTED: 60S ribosomal protein L13-1-like [Brassica rapa]
 emb|CDY08101.1| BnaA06g16250D [Brassica napus]
Length=206

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK  524
            KLV+FPRRARK KAGDSTPEELA ATQV G Y+PI+REK
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIVREK  159



>ref|XP_009150164.1| PREDICTED: 60S ribosomal protein L13-2 [Brassica rapa]
 emb|CDY37902.1| BnaA06g19150D [Brassica napus]
Length=206

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK + 
Sbjct  121  KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKQAT  162



>gb|ACU23653.1| unknown [Glycine max]
Length=207

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK  RR ARQKKAVKIFPRPTAG+LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTGRRLARQKKAVKIFPRPTAGSLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVV PRRA K KAGDS+ EELA ATQV GP+LPI+REK +V
Sbjct  121  AKLVVLPRRAHKVKAGDSSLEELANATQVQGPFLPIVREKPTV  163



>ref|XP_004499145.1| PREDICTED: 60S ribosomal protein L13-1-like [Cicer arietinum]
Length=207

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPLVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGI++DHRRRN SLEGLQANVQRLKTYK
Sbjct  61   QTAKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGIAIDHRRRNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLP++REK +V
Sbjct  121  AKLVVFPRRARKTKAGDSTPEELANATQVQGSYLPVVREKPTV  163



>emb|CDY66119.1| BnaC01g42370D [Brassica napus]
Length=206

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK ++
Sbjct  121  KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKPTM  162



>ref|XP_010421197.1| PREDICTED: 60S ribosomal protein L13-3 [Camelina sativa]
Length=206

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQ KAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQTKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAG+GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRR+RK KAGDSTPEELA ATQV G Y+PI+ +KA++
Sbjct  121  KLVVFPRRSRKVKAGDSTPEELANATQVQGDYMPIVSQKAAM  162



>ref|XP_008234598.1| PREDICTED: 60S ribosomal protein L13-3-like [Prunus mume]
 ref|XP_008234599.1| PREDICTED: 60S ribosomal protein L13-3-like [Prunus mume]
Length=207

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAGRGF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKIRAGRGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA KFKAGDS PEELA ATQ+ G YLPI REK SV
Sbjct  121  AKLVVFPRRAGKFKAGDSAPEELANATQLQGSYLPIAREKPSV  163



>ref|XP_007218412.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 ref|XP_007218413.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 ref|XP_007218414.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 gb|EMJ19611.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 gb|EMJ19612.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 gb|EMJ19613.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
Length=207

 Score =   267 bits (683),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAGRGF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKIRAGRGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA KFKAGDS PEELA ATQ+ G YLPI REK SV
Sbjct  121  AKLVVFPRRAGKFKAGDSAPEELANATQLQGSYLPIAREKPSV  163



>ref|XP_002277094.1| PREDICTED: 60S ribosomal protein L13-1 [Vitis vinifera]
 emb|CBI33499.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   267 bits (683),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELK AGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKVAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRR RKFKAGDS+ EELATATQV G Y+PI+REK +V
Sbjct  121  AKLVVFPRRTRKFKAGDSSVEELATATQVQGLYMPIVREKPTV  163



>ref|XP_009595065.1| PREDICTED: 60S ribosomal protein L13-2 [Nicotiana tomentosiformis]
Length=206

 Score =   267 bits (683),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRA+K KAGDS+ EELATATQV G Y+PI RE+ +V
Sbjct  121  KLVIFPRRAKKVKAGDSSAEELATATQVQGSYMPITREQPAV  162



>sp|P41129.1|RL132_BRANA RecName: Full=60S ribosomal protein L13-2; AltName: Full=Cold-induced 
protein C24B [Brassica napus]
 emb|CAA80343.1| cold induced protein (BnC24B) [Brassica napus]
 emb|CDX86997.1| BnaC03g52670D [Brassica napus]
Length=206

 Score =   267 bits (683),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISLDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK ++
Sbjct  121  KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKQAM  162



>ref|XP_011048445.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011048446.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
Length=207

 Score =   267 bits (683),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNHSLEGLQANIQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA KFKAGDS PEELATATQV G  +PI  EK SV
Sbjct  121  AKLVVFPRRAHKFKAGDSAPEELATATQVQGHIMPIACEKPSV  163



>ref|XP_008776365.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
 ref|XP_008776366.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
Length=207

 Score =   267 bits (683),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+V  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIRKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRRARKFKAGDS PEELATATQV GPY+PI+ EK +V
Sbjct  121  AKLVIFPRRARKFKAGDSAPEELATATQVQGPYMPIVHEKPTV  163



>ref|XP_002322840.2| hypothetical protein POPTR_0016s08310g [Populus trichocarpa]
 gb|EEF04601.2| hypothetical protein POPTR_0016s08310g [Populus trichocarpa]
Length=207

 Score =   267 bits (682),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNHSLEGLQANIQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPR ARKFKAGDS PEELATATQV G  +PI  EK SV
Sbjct  121  AKLVVFPRHARKFKAGDSAPEELATATQVQGHIMPIACEKPSV  163



>ref|NP_001288976.1| 60S ribosomal protein L13-2 [Brassica rapa]
 gb|ABL97945.1| cold induced protein [Brassica rapa]
Length=206

 Score =   267 bits (682),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK + 
Sbjct  121  KLVIFPRRARKVKAGDSTAEELAYATQVQGDYMPIVREKQAT  162



>ref|XP_009773597.1| PREDICTED: 60S ribosomal protein L13-2-like [Nicotiana sylvestris]
Length=206

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRA+K KAGDS+ EELA ATQV G Y+PI RE+ +V
Sbjct  121  KLVIFPRRAKKVKAGDSSAEELAIATQVQGSYMPITREQPAV  162



>ref|XP_008785029.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
Length=207

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK R GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTYK
Sbjct  61   QTLKYNMKPRVGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANIQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRRARKFKAGDS PEELATATQV GPY+PI+ EK SV
Sbjct  121  AKLVIFPRRARKFKAGDSAPEELATATQVQGPYMPIVHEKPSV  163



>emb|CDY05893.1| BnaC08g20700D [Brassica napus]
Length=206

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMK+R G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK  524
            KLV+FPRRARK KAGDSTPEELA ATQV G Y+PI+REK
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIVREK  159



>gb|ACJ83987.1| unknown [Medicago truncatula]
Length=207

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKT K
Sbjct  61   QTAKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTCK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+REK +V
Sbjct  121  AKLVVFPRRARKTKAGDSTPEELANATQVQGSYLPIVREKPTV  163



>ref|XP_006598706.1| PREDICTED: uncharacterized protein LOC100499935 isoform X1 [Glycine 
max]
Length=207

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVR+GRGFSLEELKA GI KKL PTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRSGRGFSLEELKAVGIPKKLGPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA K KAGDSTPEELA ATQV G +LPI+REK +V
Sbjct  121  AKLVVFPRRAHKVKAGDSTPEELANATQVQGSFLPIVREKPTV  163



>ref|XP_002877641.1| ATBBC1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53900.1| ATBBC1 [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   266 bits (681),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK 
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKT  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDSTPEELA ATQV G YLPI+REK ++
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYLPIVREKPTM  162



>ref|XP_009386549.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   266 bits (680),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRRARK KAGDS PEELATATQV GPY+PI R+K +V
Sbjct  121  AKLVIFPRRARKVKAGDSAPEELATATQVQGPYMPIARQKPTV  163



>ref|XP_003612594.1| 60S ribosomal protein L13 [Medicago truncatula]
Length=240

 Score =   267 bits (683),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  34   MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  93

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQANVQRLKTYK
Sbjct  94   QTQKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISIDHRRKNRSLEGLQANVQRLKTYK  153

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+ EK SV
Sbjct  154  AKLVVFPRRARKVKAGDSTPEELANATQVQGSYLPIVSEKPSV  196



>gb|AFK44824.1| unknown [Lotus japonicus]
Length=207

 Score =   266 bits (679),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFP+PTAG LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPKPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGFSLEELKAAG+ +KLAPTIGISVDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGVPRKLAPTIGISVDHRRRNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDS+PEE A ATQV G YLPI++E+  V
Sbjct  121  AKLVVFPRRARKVKAGDSSPEERANATQVQGQYLPIVKERPPV  163



>ref|XP_009392764.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   266 bits (679),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK R+GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRSGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRRARK KAGDS PEELATATQV G Y+PI+REK S+
Sbjct  121  AKLVIFPRRARKLKAGDSAPEELATATQVQGQYMPIVREKPSI  163



>ref|XP_010493519.1| PREDICTED: 60S ribosomal protein L13-3-like [Camelina sativa]
Length=206

 Score =   265 bits (678),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQ KAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQTKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAG+GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRL TYKA
Sbjct  61   TLKYNMKVRAGKGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLNTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRR+RK KAGDSTPEELA ATQV G Y+PI+ +KA++
Sbjct  121  KLVVFPRRSRKVKAGDSTPEELANATQVQGDYMPIVSQKAAM  162



>ref|XP_006288673.1| hypothetical protein CARUB_v10001981mg [Capsella rubella]
 gb|EOA21571.1| hypothetical protein CARUB_v10001981mg [Capsella rubella]
Length=206

 Score =   265 bits (678),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VH Q
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHAQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAG+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRR+R+ KAGDSTPEELA ATQV G Y+PI+ +KA++
Sbjct  121  KLVVFPRRSRQVKAGDSTPEELANATQVQGDYMPIVSQKAAM  162



>ref|XP_009348808.1| PREDICTED: 60S ribosomal protein L13-1-like [Pyrus x bretschneideri]
Length=207

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGF+LEELK+AGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGISKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA++FKAGDS  EE+A ATQ++GPYLPI REK +V
Sbjct  121  AKLVVFPRRAKQFKAGDSPAEEIANATQLHGPYLPIAREKPTV  163



>dbj|BAM64854.1| RPL13 protein [Beta vulgaris]
Length=207

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            +++HNNVVP+GHF+KHWQNYVKTWFNQPARK +RR ARQKKAVKIFPRPTAG LRP+VH 
Sbjct  1    MVRHNNVVPNGHFKKHWQNYVKTWFNQPARKTKRRVARQKKAVKIFPRPTAGPLRPVVHA  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG+GFSLEEL+AAGITKKLAPTIGI+VDHRRRN SLE LQ N QRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFSLEELEAAGITKKLAPTIGIAVDHRRRNRSLESLQTNTQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK  524
            AKLVVFPRRARKFKAGDS PEELATATQV G ++PI+RE+
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGDFMPIVRER  160



>ref|XP_002456870.1| hypothetical protein SORBIDRAFT_03g044290 [Sorghum bicolor]
 gb|EES01990.1| hypothetical protein SORBIDRAFT_03g044290 [Sorghum bicolor]
Length=208

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSV  164



>ref|XP_006291856.1| hypothetical protein CARUB_v10018032mg [Capsella rubella]
 gb|EOA24754.1| hypothetical protein CARUB_v10018032mg [Capsella rubella]
Length=206

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G +RP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPIRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDSTPEELA ATQV G Y+PI+RE+ ++
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIVREQPTM  162



>sp|P41128.1|RL131_BRANA RecName: Full=60S ribosomal protein L13-1; AltName: Full=Cold-induced 
protein C24A [Brassica napus]
 emb|CAA80341.1| cold induced protein (BnC24A) [Brassica napus]
 emb|CDX83063.1| BnaA01g20630D [Brassica napus]
Length=206

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK  524
            KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK
Sbjct  121  KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREK  159



>ref|XP_009395324.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395325.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395326.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395327.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+V  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRRARK KAGDS PEELATATQV G Y+PI+REK +V
Sbjct  121  AKLVIFPRRARKIKAGDSAPEELATATQVQGQYMPIVREKPTV  163



>ref|XP_010918091.1| PREDICTED: 60S ribosomal protein L13-1-like [Elaeis guineensis]
Length=207

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVRTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPR ARKFKAGDS PEELATA+QV GPY+PI+ EK SV
Sbjct  121  AKLVIFPRHARKFKAGDSAPEELATASQVQGPYMPIVHEKPSV  163



>ref|XP_010454674.1| PREDICTED: 60S ribosomal protein L13-3-like [Camelina sativa]
Length=206

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQ KAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQTKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAG+GF+ EELK+AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFTREELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRR+RK KAGDSTPEELA ATQV G Y+PI+ +KA++
Sbjct  121  KLVVFPRRSRKVKAGDSTPEELANATQVQGDYMPIVSQKAAM  162



>gb|AFK40501.1| unknown [Medicago truncatula]
Length=207

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQK+AVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKRAVKIFPRPTVGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTQKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISIDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKL VFPRRARK KAGDSTPEELA ATQV G YLPI+ EK SV
Sbjct  121  AKLAVFPRRARKVKAGDSTPEELANATQVQGSYLPIVSEKPSV  163



>ref|XP_009151668.1| PREDICTED: 60S ribosomal protein L13-1 [Brassica rapa]
Length=206

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK  524
            KLV+FPRRARK K GDST EELA ATQV G Y+PI+REK
Sbjct  121  KLVIFPRRARKVKPGDSTAEELANATQVQGDYMPIVREK  159



>ref|NP_190470.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 ref|NP_850672.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 ref|NP_001030831.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 sp|P41127.1|RL131_ARATH RecName: Full=60S ribosomal protein L13-1; AltName: Full=Protein 
BBC1 homolog [Arabidopsis thaliana]
 gb|AAL16152.1|AF428384_1 AT3g49010/T2J13_150 [Arabidopsis thaliana]
 emb|CAA53005.1| BBC1 protein [Arabidopsis thaliana]
 emb|CAB62009.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
 gb|AAK92791.1| putative 60S ribosomal protein L13, BBC1 protein [Arabidopsis 
thaliana]
 gb|AAL38313.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
 gb|AAL85112.1| putative 60S ribosomal protein L13, BBC1 protein [Arabidopsis 
thaliana]
 gb|AAM10157.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
 dbj|BAH19771.1| AT3G49010 [Arabidopsis thaliana]
 gb|AEE78482.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 gb|AEE78483.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 gb|AEE78484.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
Length=206

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK 
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKT  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDSTPEELA ATQV G YLPI+REK ++
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYLPIVREKPTM  162



>ref|XP_010671181.1| PREDICTED: 60S ribosomal protein L13-1 [Beta vulgaris subsp. 
vulgaris]
Length=207

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            +++HNNVVP+GHF+KHWQNYVKTWFNQPARK +RR ARQKKAVKIFPRPTAG LRP+VH 
Sbjct  1    MVRHNNVVPNGHFKKHWQNYVKTWFNQPARKTKRRVARQKKAVKIFPRPTAGPLRPVVHA  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG+GFSLEEL+AAGITKKLAPTIGI+VDHRRRN SLE LQ N QRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFSLEELEAAGITKKLAPTIGIAVDHRRRNRSLESLQTNTQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILRE  521
            AKLVVFPRRARKFKAGDS PEELATATQV G ++PI+RE
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGDFMPIVRE  159



>dbj|BAM64815.1| RPL13 [Beta vulgaris]
Length=207

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            +++HNNVVP+GHF+KHWQNYVKTWFNQPARK +R+ ARQKKAVKIFPRPTAG LRP+VH 
Sbjct  1    MVRHNNVVPNGHFKKHWQNYVKTWFNQPARKTKRKVARQKKAVKIFPRPTAGPLRPVVHA  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG+GFSLEEL+AAGITKKLAPTIGI+VDHRRRN SLE LQ N QRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFSLEELEAAGITKKLAPTIGIAVDHRRRNRSLESLQTNTQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILRE  521
            AKLVVFPRRARKFKAGDS PEELATATQV G ++PI+RE
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGDFMPIVRE  159



>gb|AAM61490.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
Length=206

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK 
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKT  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDSTPEELA ATQV G YLPI+REK ++
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYLPIVREKPTM  162



>ref|XP_006847908.1| hypothetical protein AMTR_s00029p00111280 [Amborella trichopoda]
 gb|ERN09489.1| hypothetical protein AMTR_s00029p00111280 [Amborella trichopoda]
Length=207

 Score =   264 bits (675),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK
Sbjct  61   QTLKYNMKLRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRR +KFK GDS+ EELATATQVNG ++PI  EK +V
Sbjct  121  AKLVVFPRRPKKFKGGDSSAEELATATQVNGEFMPITHEKPTV  163



>ref|XP_006404190.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
 gb|ESQ45643.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
Length=206

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGL +NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLNSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDS PEELA ATQV G Y+PI+REK + 
Sbjct  121  KLVIFPRRARKVKAGDSAPEELANATQVQGDYMPIVREKPTT  162



>ref|XP_006655721.1| PREDICTED: 60S ribosomal protein L13-1-like [Oryza brachyantha]
Length=208

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSV  164



>ref|XP_009335696.1| PREDICTED: 60S ribosomal protein L13-1-like [Pyrus x bretschneideri]
Length=207

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA++FKAGDS  EELA ATQ++ PYLPI REK +V
Sbjct  121  AKLVVFPRRAKQFKAGDSPAEELANATQLHAPYLPIAREKPTV  163



>ref|XP_008369022.1| PREDICTED: 60S ribosomal protein L13-1-like [Malus domestica]
Length=207

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA++FKAGDS  EELA ATQ++ PYLPI REK +V
Sbjct  121  AKLVVFPRRAKQFKAGDSPAEELANATQLHAPYLPIAREKPTV  163



>ref|XP_010102662.1| 60S ribosomal protein L13-2 [Morus notabilis]
 gb|EXB93844.1| 60S ribosomal protein L13-2 [Morus notabilis]
Length=207

 Score =   264 bits (674),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKV AGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN QRLKTYK
Sbjct  61   QTLKYNMKVGAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANAQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRR  KFKAGDSTPEELA+ATQV G  LPI+REK +V
Sbjct  121  AKLVVFPRRPHKFKAGDSTPEELASATQVQGELLPIVREKPTV  163



>ref|XP_010677493.1| PREDICTED: 60S ribosomal protein L13-1-like [Beta vulgaris subsp. 
vulgaris]
Length=207

 Score =   264 bits (674),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            +++HNNV+P+GHF+KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VH 
Sbjct  1    MVRHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAG+GFSLEEL AAGI KKLAPTIGI+VDHRRRNSSLEGLQ NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGKGFSLEELAAAGIPKKLAPTIGIAVDHRRRNSSLEGLQTNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPR ARKFKAGDSTPEELA ATQV G +LPI  EKA V
Sbjct  121  AKLVVFPRHARKFKAGDSTPEELANATQVQGEFLPIKSEKAPV  163



>ref|XP_006394649.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 ref|XP_006394650.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 ref|XP_006394651.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 gb|ESQ31935.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 gb|ESQ31936.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 gb|ESQ31937.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
Length=206

 Score =   264 bits (674),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNN +P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNEIPNSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMK+RAG+GF+LEELKAA I KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRAGKGFTLEELKAACIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKA  527
            KLVVFPRR+RK KAGDSTPEELA ATQV G Y+PI REKA
Sbjct  121  KLVVFPRRSRKVKAGDSTPEELANATQVQGDYMPIAREKA  160



>ref|XP_004512380.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004512381.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X2 [Cicer 
arietinum]
Length=207

 Score =   264 bits (674),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMKVR G+GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTAKYNMKVRDGKGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA K KAGDSTPEELA ATQV G YLP +REK SV
Sbjct  121  AKLVVFPRRAHKVKAGDSTPEELANATQVTGSYLPTVREKPSV  163



>ref|XP_004969592.1| PREDICTED: 60S ribosomal protein L13-1-like [Setaria italica]
Length=208

 Score =   264 bits (674),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSV  164



>gb|EPS71909.1| hypothetical protein M569_02849 [Genlisea aurea]
Length=207

 Score =   263 bits (673),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+ HFRKHWQ+YVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VH 
Sbjct  1    MVKHNNVVPNSHFRKHWQDYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMKVRAG+GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTRKYNMKVRAGKGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARKFKAGDST EELA+ATQV+GP LPI+ EK +V
Sbjct  121  AKLVVFPRRARKFKAGDSTAEELASATQVSGPVLPIVGEKPNV  163



>ref|XP_004969597.1| PREDICTED: 60S ribosomal protein L13-1-like [Setaria italica]
Length=208

 Score =   264 bits (674),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSV  164



>gb|EYU19728.1| hypothetical protein MIMGU_mgv1a013902mg [Erythranthe guttata]
Length=207

 Score =   263 bits (673),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PSGHFRKHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRP AG LRP VHG
Sbjct  1    MVKHNNVIPSGHFRKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPPAGPLRPTVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+R+G+GFSLEELKAAGI KKLAPT+GISVDHRRRN SLEG Q NVQRLKTYK
Sbjct  61   QTLKYNMKLRSGKGFSLEELKAAGIPKKLAPTVGISVDHRRRNRSLEGFQTNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRR  KFKAGDSTPEELATATQV+GP LPI+ EK SV
Sbjct  121  AKLVVFPRRNGKFKAGDSTPEELATATQVSGPILPIVHEKPSV  163



>gb|AES82369.2| 60S ribosomal L13-like protein [Medicago truncatula]
Length=205

 Score =   263 bits (672),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 150/163 (92%), Gaps = 2/163 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAG+GFSLEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTQKYNMKLRAGKGFSLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRAR  KAGDSTPEELA ATQV G YLPI+REK SV
Sbjct  121  AKLVVFPRRAR--KAGDSTPEELANATQVQGSYLPIVREKPSV  161



>gb|ACJ86119.1| unknown [Medicago truncatula]
Length=207

 Score =   263 bits (672),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKH QNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHSQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAG+GFSLEELK AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTAKYNMKLRAGKGFSLEELKTAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKL+VFPRRARK KAGDSTPEELA ATQV G YLPI+REK +V
Sbjct  121  AKLIVFPRRARKTKAGDSTPEELANATQVQGSYLPIVREKPTV  163



>emb|CAC27142.1| 60S ribosomal protein L13E [Picea abies]
Length=207

 Score =   263 bits (672),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTQKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPR ARK KAGDS+PEELATATQV G Y+ I +EK S+
Sbjct  121  AKLVVFPRTARKLKAGDSSPEELATATQVQGKYMTITQEKPSL  163



>ref|XP_009792303.1| PREDICTED: 60S ribosomal protein L13-1-like [Nicotiana sylvestris]
Length=206

 Score =   263 bits (672),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRR ARQKKA  IFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRIARQKKAATIFPRPTAGPLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR+GRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPR A+K KAGDS+PEELATATQV G Y+PI RE+ ++
Sbjct  121  KLVIFPRHAKKVKAGDSSPEELATATQVQGTYMPITREQPTI  162



>ref|XP_010519493.1| PREDICTED: 60S ribosomal protein L13-1 [Tarenaya hassleriana]
 ref|XP_010519494.1| PREDICTED: 60S ribosomal protein L13-1 [Tarenaya hassleriana]
 ref|XP_010519495.1| PREDICTED: 60S ribosomal protein L13-1 [Tarenaya hassleriana]
Length=206

 Score =   263 bits (672),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLK YKA
Sbjct  61   TLKYNMKVRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKMYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK  524
            KLV+FPRRARK KAGDS PEELA ATQV G ++PI+REK
Sbjct  121  KLVIFPRRARKVKAGDSAPEELANATQVQGEHMPIVREK  159



>gb|KJB10376.1| hypothetical protein B456_001G197800 [Gossypium raimondii]
Length=207

 Score =   263 bits (672),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG +RP+VHG
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPIRPVVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAG GF+LEELKAAGI+KKLAPTI I+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGNGFTLEELKAAGISKKLAPTIAIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPR ARKFKAGDST +ELATATQV G Y+PI REK SV
Sbjct  121  AKLVVFPRCARKFKAGDSTAKELATATQVQGSYMPISREKPSV  163



>gb|ABK25466.1| unknown [Picea sitchensis]
Length=207

 Score =   263 bits (672),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTQKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPR ARK KAGDS+PEELATATQV G Y+ I +EK S+
Sbjct  121  AKLVVFPRTARKLKAGDSSPEELATATQVQGKYMTITQEKPSL  163



>ref|XP_006659160.1| PREDICTED: 60S ribosomal protein L13-1-like [Oryza brachyantha]
Length=208

 Score =   263 bits (672),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPIARGEKRSV  164



>ref|XP_008386691.1| PREDICTED: 60S ribosomal protein L13-1 [Malus domestica]
Length=207

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA++FK GDS  EELA ATQ++GPYLPI REK +V
Sbjct  121  AKLVVFPRRAKQFKXGDSPAEELANATQLHGPYLPIAREKPTV  163



>ref|XP_010233707.1| PREDICTED: 60S ribosomal protein L13-1-like [Brachypodium distachyon]
Length=208

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEG+Q+NVQRLKTYK
Sbjct  61   QTLKYNMKARAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGMQSNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK S+
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGEYMPITRGEKRSI  164



>ref|NP_001152730.1| LOC100286371 [Zea mays]
 gb|ACG49179.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|ACR37981.1| unknown [Zea mays]
 gb|AFW77302.1| 60S ribosomal protein L13 isoform 1 [Zea mays]
 gb|AFW77303.1| 60S ribosomal protein L13 isoform 2 [Zea mays]
Length=208

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK  AGDSTPEELATATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKANAGDSTPEELATATQVQGDYMPITRGEKRSV  164



>ref|XP_009335726.1| PREDICTED: 60S ribosomal protein L13-3-like [Pyrus x bretschneideri]
Length=207

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRR ++FKAGDS  EELA ATQ++ PYLPI REK +V
Sbjct  121  AKLVVFPRRTKQFKAGDSPAEELANATQLHAPYLPIAREKPTV  163



>ref|NP_197778.1| 60S ribosomal protein L13-3 [Arabidopsis thaliana]
 sp|Q9FF90.1|RL133_ARATH RecName: Full=60S ribosomal protein L13-3 [Arabidopsis thaliana]
 gb|AAK55698.1|AF378895_1 AT5g23900/MRO11_6 [Arabidopsis thaliana]
 dbj|BAB10063.1| 60S ribosomal protein L13 [Arabidopsis thaliana]
 gb|AAK96460.1| AT5g23900/MRO11_6 [Arabidopsis thaliana]
 gb|AED93230.1| 60S ribosomal protein L13-3 [Arabidopsis thaliana]
Length=206

 Score =   262 bits (670),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAG+GF+LEELK AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFTLEELKVAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRR+R+ KAGDSTPEELA ATQV G Y+PI   KA++
Sbjct  121  KLVVFPRRSRQVKAGDSTPEELANATQVQGDYMPIASVKAAM  162



>ref|XP_009351877.1| PREDICTED: 60S ribosomal protein L13-1 [Pyrus x bretschneideri]
 ref|XP_009351878.1| PREDICTED: 60S ribosomal protein L13-1 [Pyrus x bretschneideri]
Length=207

 Score =   262 bits (670),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA+  KAGDS+ EELA ATQ+  PYLPI REK +V
Sbjct  121  AKLVVFPRRAKHIKAGDSSAEELANATQLQAPYLPIAREKPTV  163



>ref|XP_006342488.1| PREDICTED: 60S ribosomal protein L13-1-like [Solanum tuberosum]
Length=206

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQKKA  IFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQKKAATIFPRPTAGSLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPR A+K KAGDS+ EELA ATQV GPYLPI+R++ +V
Sbjct  121  KLVIFPRHAKKVKAGDSSAEELANATQVQGPYLPIVRDQPAV  162



>ref|XP_009624483.1| PREDICTED: 60S ribosomal protein L13-1-like [Nicotiana tomentosiformis]
 ref|XP_009624484.1| PREDICTED: 60S ribosomal protein L13-1-like [Nicotiana tomentosiformis]
Length=206

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRR ARQKKA  IFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRIARQKKAATIFPRPTAGPLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR+GRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPR A+K KAGDS+PEELATATQV G Y+PI RE+ ++
Sbjct  121  KLVIFPRHAKKVKAGDSSPEELATATQVQGTYMPITREQPAI  162



>gb|EYU45361.1| hypothetical protein MIMGU_mgv1a013891mg [Erythranthe guttata]
Length=207

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PSGHFRKHWQNYVK WFNQPARK RRRAARQKKAVKIFPRPT G LRP+VH 
Sbjct  1    MVKHNNVIPSGHFRKHWQNYVKCWFNQPARKTRRRAARQKKAVKIFPRPTDGRLRPVVHC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVR+G+GFSLEELKAAGI KKLAPT+GISVDHRRRN SLEG Q NVQRLKTYK
Sbjct  61   QTLKYNMKVRSGKGFSLEELKAAGIPKKLAPTVGISVDHRRRNRSLEGFQTNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            A+LVVFPRR  KFKAGDSTPE+LATATQV+GP LPI+ EK SV
Sbjct  121  AQLVVFPRRNNKFKAGDSTPEQLATATQVSGPILPIVHEKPSV  163



>ref|XP_004253080.1| PREDICTED: 60S ribosomal protein L13-1 [Solanum lycopersicum]
 ref|XP_010314813.1| PREDICTED: 60S ribosomal protein L13-1 [Solanum lycopersicum]
Length=206

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQKKA  IFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQKKAATIFPRPTAGSLRPIVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPR A+K KAGDS+ EELA ATQV GPYLPI+R++ ++
Sbjct  121  KLVIFPRHAKKVKAGDSSAEELANATQVQGPYLPIVRDQPAI  162



>ref|XP_008376874.1| PREDICTED: 60S ribosomal protein L13-3 [Malus domestica]
Length=207

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA+  KAGDS  EE+A ATQ+ GPYLPI REK +V
Sbjct  121  AKLVVFPRRAKHIKAGDSPAEEIANATQLQGPYLPIAREKPTV  163



>ref|XP_008381780.1| PREDICTED: 60S ribosomal protein L13-3-like [Malus domestica]
 ref|XP_008381788.1| PREDICTED: 60S ribosomal protein L13-3-like [Malus domestica]
Length=207

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA+  KAGDS+ EELA ATQ++ PYLPI REK +V
Sbjct  121  AKLVVFPRRAKHTKAGDSSAEELANATQLHAPYLPIAREKPTV  163



>ref|XP_003573442.1| PREDICTED: 60S ribosomal protein L13-1-like [Brachypodium distachyon]
Length=208

 Score =   261 bits (668),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEG+Q+NVQRLKTYK
Sbjct  61   QTLKYNMKARAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGMQSNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELATATQV G ++PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDFMPIARGEKRSV  164



>ref|XP_002440279.1| hypothetical protein SORBIDRAFT_09g028960 [Sorghum bicolor]
 gb|EES18709.1| hypothetical protein SORBIDRAFT_09g028960 [Sorghum bicolor]
Length=208

 Score =   261 bits (667),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDST EELATATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTAEELATATQVQGDYMPITRGEKRSV  164



>ref|NP_001056613.1| Os06g0115500 [Oryza sativa Japonica Group]
 dbj|BAA92738.1| putative 60S ribosomal protein L13E [Oryza sativa Japonica Group]
 dbj|BAC22205.1| putative 60S ribosomal protein L13E [Oryza sativa Japonica Group]
 dbj|BAF18527.1| Os06g0115500 [Oryza sativa Japonica Group]
 gb|EAY99411.1| hypothetical protein OsI_21382 [Oryza sativa Indica Group]
 gb|EAZ35612.1| hypothetical protein OsJ_19902 [Oryza sativa Japonica Group]
 gb|ABR25544.1| 60S ribosomal protein l13-2 [Oryza sativa Indica Group]
 dbj|BAG92251.1| unnamed protein product [Oryza sativa Japonica Group]
Length=208

 Score =   261 bits (667),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKFAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSV  164



>ref|XP_009361223.1| PREDICTED: 60S ribosomal protein L13-3-like [Pyrus x bretschneideri]
Length=207

 Score =   261 bits (667),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRA+  KAGDS  EE+A ATQ++GPYLPI REK +V
Sbjct  121  AKLVVFPRRAKLIKAGDSPAEEIANATQLHGPYLPIAREKPTV  163



>ref|NP_001148638.1| 60S ribosomal protein L13-2 [Zea mays]
 ref|XP_008654954.1| PREDICTED: 60S ribosomal protein L13-2 isoform X1 [Zea mays]
 gb|ACG32335.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|ACG35809.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|ACG48210.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|AFW84112.1| 60S ribosomal protein L13 [Zea mays]
Length=208

 Score =   261 bits (666),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRA K KAGDSTPEELATATQV G Y+P  R EK SV
Sbjct  121  AKLVIFPRRAHKVKAGDSTPEELATATQVQGDYMPFTRGEKRSV  164



>ref|XP_004982044.1| PREDICTED: 60S ribosomal protein L13-2-like isoform X1 [Setaria 
italica]
 ref|XP_004982045.1| PREDICTED: 60S ribosomal protein L13-2-like isoform X2 [Setaria 
italica]
Length=207

 Score =   261 bits (666),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  Q
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            + KYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   SRKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            KLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK S+
Sbjct  121  KLVIFPRRARKVKAGDSTPEELATATQVQGEYMPITRGEKRSI  163



>ref|XP_002439380.1| hypothetical protein SORBIDRAFT_09g005460 [Sorghum bicolor]
 gb|EES17810.1| hypothetical protein SORBIDRAFT_09g005460 [Sorghum bicolor]
Length=208

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDST EELAT TQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTVEELATVTQVQGDYMPITRGEKRSV  164



>ref|XP_008800008.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
Length=207

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+V  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KK APTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKPRAGRGFTLEELKAAGIPKKFAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPR A K+KAGDS PEELATATQV GPYLPI+ EK SV
Sbjct  121  AKLVIFPRHAHKYKAGDSAPEELATATQVQGPYLPIVCEKPSV  163



>ref|XP_010550553.1| PREDICTED: 60S ribosomal protein L13-1-like [Tarenaya hassleriana]
Length=206

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+V GQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQEKAVKIFPRPTAGPLRPVVRGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ N+QRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNIQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARKFKAGDS PEELA  TQV G ++ I REK +V
Sbjct  121  KLVIFPRRARKFKAGDSAPEELANTTQVQGDHMRIGREKVAV  162



>ref|XP_010545924.1| PREDICTED: 60S ribosomal protein L13-1-like [Tarenaya hassleriana]
Length=206

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQEKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRARK KAGDS  EELA ATQV G ++ I REK +V
Sbjct  121  KLVIFPRRARKVKAGDSAAEELANATQVQGDHMLIAREKPAV  162



>ref|NP_001155192.1| 60S ribosomal protein L13 isoform 1 [Zea mays]
 gb|ACF86560.2| unknown [Zea mays]
 tpg|DAA56068.1| TPA: 60S ribosomal protein L13 isoform 1 [Zea mays]
 tpg|DAA56069.1| TPA: 60S ribosomal protein L13 isoform 2 [Zea mays]
 tpg|DAA56070.1| TPA: 60S ribosomal protein L13 isoform 3 [Zea mays]
Length=208

 Score =   259 bits (661),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI K+LAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKRLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDST EEL TATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTLEELTTATQVQGDYMPITRGEKRSV  164



>ref|NP_001078260.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 gb|AEE78485.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
Length=204

 Score =   258 bits (659),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 148/162 (91%), Gaps = 2/162 (1%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK 
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKT  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRAR  KAGDSTPEELA ATQV G YLPI+REK ++
Sbjct  121  KLVIFPRRAR--KAGDSTPEELANATQVQGDYLPIVREKPTM  160



>ref|NP_001050537.1| Os03g0576700 [Oryza sativa Japonica Group]
 pdb|3J61|L Chain L, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 emb|CAC81268.1| putative cold-induced protein [Oryza sativa Indica Group]
 gb|AAP85547.1| ribosomal protein large subunit 13 [Oryza sativa Japonica Group]
 gb|AAR10856.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 gb|ABF97254.1| 60S ribosomal protein L13-2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12451.1| Os03g0576700 [Oryza sativa Japonica Group]
 gb|EAY90745.1| hypothetical protein OsI_12345 [Oryza sativa Indica Group]
 gb|EAZ27573.1| hypothetical protein OsJ_11521 [Oryza sativa Japonica Group]
 dbj|BAG91910.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96551.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97015.1| unnamed protein product [Oryza sativa Japonica Group]
Length=208

 Score =   258 bits (659),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKYAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDST EELATATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTAEELATATQVQGDYMPIARGEKRSV  164



>ref|XP_006404189.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
 gb|ESQ45642.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
Length=204

 Score =   258 bits (659),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 147/162 (91%), Gaps = 2/162 (1%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGL +NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLNSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FPRRAR  KAGDS PEELA ATQV G Y+PI+REK + 
Sbjct  121  KLVIFPRRAR--KAGDSAPEELANATQVQGDYMPIVREKPTT  160



>gb|EMT28307.1| 60S ribosomal protein L13-1 [Aegilops tauschii]
Length=208

 Score =   258 bits (659),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK RAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYK
Sbjct  61   QTRKYNMKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSV  164



>gb|ABR18061.1| unknown [Picea sitchensis]
Length=207

 Score =   258 bits (659),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTSGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAGRGFSLEELKAAGI KK APTIGI+VDHRRRN SLEGLQ NVQRLKTYK
Sbjct  61   QTQKYNMKIRAGRGFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPR A K KAGDS+ EELATATQV G Y+PI +EK SV
Sbjct  121  AKLVVFPRSAGKLKAGDSSQEELATATQVQGTYMPISQEKPSV  163



>gb|ABK24025.1| unknown [Picea sitchensis]
 gb|ABK27069.1| unknown [Picea sitchensis]
Length=209

 Score =   258 bits (659),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 150/165 (91%), Gaps = 2/165 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTSGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK+RAGRGFSLEELKAAGI KK APTIGI+VDHRRRN SLEGLQ NVQRLKTYK
Sbjct  61   QTQKYNMKIRAGRGFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYK  120

Query  405  AKLVVFPR--RARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPR  RARK KAGDS+ EELATATQ+ G Y+PI +EK SV
Sbjct  121  AKLVVFPRSARARKLKAGDSSKEELATATQIQGTYMPISQEKPSV  165



>ref|XP_004509537.1| PREDICTED: 60S ribosomal protein L13-1-like [Cicer arietinum]
Length=207

 Score =   257 bits (657),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFP+PTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPKPTAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT+KYNMK+R+G+GFSLEELKAA I KKLAPTIGI+VDHRRRN SLE LQ NVQRLKTYK
Sbjct  61   QTVKYNMKLRSGKGFSLEELKAANIPKKLAPTIGIAVDHRRRNRSLESLQTNVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGDS+PEE A ATQV G YLPI+ EK SV
Sbjct  121  AKLVVFPRRARKVKAGDSSPEERANATQVQGSYLPIVTEKPSV  163



>emb|CDY16871.1| BnaA09g05110D [Brassica napus]
Length=206

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNN +P  HFRKHWQN VKTWFNQPARK RRR ARQ+KAVKIFPRPT+G+LRP+VHGQ
Sbjct  1    MKHNNEIPGSHFRKHWQNSVKTWFNQPARKTRRRVARQEKAVKIFPRPTSGSLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T+KYNMKVRAG+GF+LEELKAAGI KKLA TIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TIKYNMKVRAGKGFTLEELKAAGIAKKLASTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRR+R  KAGDST EELA ATQ+ G Y+PI REK ++
Sbjct  121  KLVVFPRRSRVVKAGDSTSEELANATQMQGEYMPIAREKVAM  162



>ref|XP_009141778.1| PREDICTED: 60S ribosomal protein L13-3 [Brassica rapa]
 ref|XP_009141788.1| PREDICTED: 60S ribosomal protein L13-3 [Brassica rapa]
Length=206

 Score =   256 bits (654),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNN +P  HFRKHWQN VKTWFNQPARK RRR ARQ+KAVKIFPRPT+G+LRP+VHGQ
Sbjct  1    MKHNNEIPGSHFRKHWQNSVKTWFNQPARKTRRRVARQEKAVKIFPRPTSGSLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T+KYNMKVRAG+GF+LEELKAAGI KK+A TIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TIKYNMKVRAGKGFTLEELKAAGIAKKMASTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRR+R  KAGDST EELA ATQ+ G Y+PI REK ++
Sbjct  121  KLVVFPRRSRVVKAGDSTSEELANATQMQGEYMPIAREKVAM  162



>dbj|BAJ99213.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=208

 Score =   256 bits (653),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK RAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYK
Sbjct  61   QTRKYNMKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELA ATQV G Y+PI R EK SV
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIARGEKRSV  164



>gb|EMT10064.1| 60S ribosomal protein L13-1 [Aegilops tauschii]
Length=225

 Score =   256 bits (654),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  18   MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  77

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK RAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYK
Sbjct  78   QTRKYNMKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYK  137

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELA ATQV G Y+PI R EK SV
Sbjct  138  AKLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIARGEKRSV  181



>emb|CDX87152.1| BnaC09g04670D [Brassica napus]
Length=206

 Score =   254 bits (650),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNN +P  HFRKHWQN VKTWFNQPARK RRR ARQ+KAVKIFPRP +G+LRP+VHGQ
Sbjct  1    MKHNNEIPGSHFRKHWQNSVKTWFNQPARKTRRRVARQEKAVKIFPRPASGSLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T+KYNMKVRAG+GF+LEELKAAGI KKLA TIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TIKYNMKVRAGKGFTLEELKAAGIAKKLASTIGISVDHRRKNHSLEGLQSNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLVVFPRR+R  KAGDSTPEELA ATQV G Y+PI  EK ++
Sbjct  121  KLVVFPRRSRVVKAGDSTPEELANATQVQGDYMPIAGEKVAM  162



>gb|AFW84113.1| hypothetical protein ZEAMMB73_641905 [Zea mays]
Length=206

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 148/164 (90%), Gaps = 3/164 (2%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRA   KAGDSTPEELATATQV G Y+P  R EK SV
Sbjct  121  AKLVIFPRRA--HKAGDSTPEELATATQVQGDYMPFTRGEKRSV  162



>gb|EMS50076.1| 60S ribosomal protein L13-1 [Triticum urartu]
Length=267

 Score =   254 bits (650),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  60   MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  119

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT KYNMK RAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYK
Sbjct  120  QTRKYNMKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYK  179

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            AKLV+FPRRARK KAGDSTPEELA ATQV G Y+PI R EK SV
Sbjct  180  AKLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIARGEKRSV  223



>ref|XP_009396207.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYVKTWF+QPARK RRR ARQKKAVKIFPRPT+G L PIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFSQPARKTRRRIARQKKAVKIFPRPTSGPLCPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRR  KFKAGDS PEEL  ATQV G Y+PI+ EK SV
Sbjct  121  AKLVIFPRRVCKFKAGDSAPEELTAATQVTGQYMPIVHEKPSV  163



>gb|AIZ68174.1| 60S ribosomal protein L13-1-like protein [Ornithogalum saundersiae]
Length=207

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQ+YV+TWF+QPARK RRR ARQKKAVK FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVVPNGHFKKHWQDYVRTWFDQPARKTRRRIARQKKAVKEFPRPTAGPLRPVVHC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAGRGFSLEELKAAGI KK APTIGI++DHRR+N SLEGLQANVQRLKTY 
Sbjct  61   QTLKYNMKLRAGRGFSLEELKAAGIPKKWAPTIGIAIDHRRKNRSLEGLQANVQRLKTYM  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV+FPRRA KFKAGDS PEELA ATQV+G Y+PI +EK SV
Sbjct  121  AKLVIFPRRAGKFKAGDSPPEELANATQVHGEYMPIQQEKPSV  163



>ref|XP_006850159.1| hypothetical protein AMTR_s00022p00239970 [Amborella trichopoda]
 gb|ERN11740.1| hypothetical protein AMTR_s00022p00239970 [Amborella trichopoda]
Length=207

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHF+KHWQNYV+TWFNQPARK RRR AR KKAVKIFPRP AG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVRTWFNQPARKVRRRIARTKKAVKIFPRPVAGPLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            A LVVFPRR  KFK GDS PEEL  A+QV   Y+ I REK  V
Sbjct  121  ANLVVFPRRPSKFKVGDSGPEELVNASQVLDKYMAITREKPGV  163



>gb|EMS59514.1| 60S ribosomal protein L13-1 [Triticum urartu]
Length=215

 Score =   248 bits (634),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 149/171 (87%), Gaps = 8/171 (5%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  225  QTLKYNMKVRAGRGFSLEELK-------AAGITKKLAPTIGISVDHRRRNSSLEGLQANV  383
            QT KYNMK RAGRGF+LEELK       +AGI KKLAPTIGISVDHRR+N SLEG+Q+N+
Sbjct  61   QTRKYNMKARAGRGFTLEELKLLSCVFLSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNI  120

Query  384  QRLKTYKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASV  533
            QRLKTYKAKLV+FPR ARK KAGDSTPEELATATQV G YLPI R EK SV
Sbjct  121  QRLKTYKAKLVIFPRCARKVKAGDSTPEELATATQVQGDYLPITRGEKRSV  171



>ref|XP_010539934.1| PREDICTED: 60S ribosomal protein L13-1-like [Tarenaya hassleriana]
Length=206

 Score =   243 bits (619),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+KHWQ+YVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQHYVKTWFNQPARKTRRRIARQEKAVKIFPRPTAGPLRPVVHGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TLKYNMKVRAGRGF+LEEL AAG+ KKLAPTIGI VDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFTLEELMAAGVPKKLAPTIGIVVDHRRKNRSLEGLQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KLV+FP   RK  AGDS  EELA  +Q+   Y+PI+REK ++
Sbjct  121  KLVIFPHCTRKVNAGDSAAEELANTSQMQEVYMPIVREKPAL  162



>ref|XP_007040896.1| 60S ribosomal protein L13 [Theobroma cacao]
 gb|EOY25397.1| 60S ribosomal protein L13 [Theobroma cacao]
Length=197

 Score =   240 bits (613),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 141/163 (87%), Gaps = 10/163 (6%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRP+AG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFRKHWQNYVKTWFNQPARKARRRLARQKKAVKIFPRPSAGHLRPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYNMK+RAGRGFSLEELKAAGI+KKLAPTI  +VDHRR+N SLE LQANVQRLKT K
Sbjct  61   QTLKYNMKLRAGRGFSLEELKAAGISKKLAPTIDTAVDHRRKNRSLESLQANVQRLKTCK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLV          AGDSTPEELATATQV GPY+PI  +K SV
Sbjct  121  AKLV----------AGDSTPEELATATQVQGPYIPIAGDKPSV  153



>ref|NP_190465.1| putative 60S ribosomal protein L13-2 [Arabidopsis thaliana]
 sp|Q9SMT4.1|RL132_ARATH RecName: Full=Putative 60S ribosomal protein L13-2 [Arabidopsis 
thaliana]
 emb|CAB62014.1| 60S ribosomal protein L13 (BBC1)-like [Arabidopsis thaliana]
 gb|AEE78477.1| putative 60S ribosomal protein L13-2 [Arabidopsis thaliana]
Length=206

 Score =   231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF+K W+NYVKT FNQPA K RRR ARQ KAVKIFPRPTAG +RP+VH Q
Sbjct  1    MKHNNVIPNGHFKKKWENYVKTSFNQPAMKTRRRIARQNKAVKIFPRPTAGPIRPVVHAQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            TL YNMKVRAG+GF+LEELKAAGI KKLAPTIGISVDH R+N SLEG Q NVQRLKTYKA
Sbjct  61   TLTYNMKVRAGKGFTLEELKAAGIPKKLAPTIGISVDHHRKNRSLEGFQTNVQRLKTYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILRE  521
            KLV+FPR AR  K GDS  +ELA ATQV   ++PI+RE
Sbjct  121  KLVIFPRCARTVKVGDSAQQELANATQVQVDHMPIVRE  158



>ref|XP_001770513.1| predicted protein [Physcomitrella patens]
 gb|EDQ64682.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   231 bits (588),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+K WQNYV+TWFNQPARK+RRR ARQKKAV +FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVIPNGHFKKDWQNYVRTWFNQPARKKRRRTARQKKAVAVFPRPTAGPLRPVVHS  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYN K+R+GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N  LE LQ NV RL TY+
Sbjct  61   QTLKYNSKIRSGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNTYR  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRR++K KAGDS+ EEL++ TQV GP LPI++ + +V
Sbjct  121  AKLVVFPRRSKKTKAGDSSAEELSSFTQVIGPVLPIVKPRPTV  163



>ref|XP_001756184.1| predicted protein [Physcomitrella patens]
 gb|EDQ79050.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   228 bits (582),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+K WQNYV+TWFNQPARK+RRR ARQKKA  +FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVIPNGHFKKDWQNYVRTWFNQPARKKRRRTARQKKAAAVFPRPTAGPLRPVVHS  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTL+YN K+RAGRGF+L+ELKAAGI KKLAPTIGI+VDHRR+N  LE LQ NV RL TY+
Sbjct  61   QTLRYNAKIRAGRGFTLDELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNTYR  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFPRRARK KAGD+T EEL++ATQV    LPI++ + +V
Sbjct  121  AKLVVFPRRARKSKAGDATAEELSSATQVTRSVLPIVKPRPTV  163



>gb|ABF97255.1| 60S ribosomal protein L13-2, putative, expressed [Oryza sativa 
Japonica Group]
Length=196

 Score =   227 bits (579),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  87   KHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  266
            KH  NYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QTLKYNMK RAGRG
Sbjct  3    KHNNNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTLKYNMKSRAGRG  62

Query  267  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  446
            F+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK K
Sbjct  63   FTLEELKAAGIPKKYAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKVK  122

Query  447  AGDSTPEELATATQVNGPYLPILR-EKASV  533
            AGDST EELATATQV G Y+PI R EK SV
Sbjct  123  AGDSTAEELATATQVQGDYMPIARGEKRSV  152



>ref|XP_001785308.1| predicted protein [Physcomitrella patens]
 gb|EDQ49876.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   228 bits (580),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+K WQNYV+TWFNQPARK+RRR ARQ+KAV +FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVIPNGHFKKDWQNYVRTWFNQPARKKRRRTARQRKAVAVFPRPTAGPLRPVVHS  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTL+YN K+RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N  LE LQ NV RL  Y+
Sbjct  61   QTLRYNAKIRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNMYR  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKAS  530
            AKLVVFPRR++K KAGD++ EEL++ TQV G  LPI++ + S
Sbjct  121  AKLVVFPRRSKKTKAGDASAEELSSVTQVTGDVLPIVKSRPS  162



>ref|XP_001762920.1| predicted protein [Physcomitrella patens]
 gb|EDQ72125.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+K WQNYV+TWFNQPARK+RRR ARQKKAV +FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVIPNGHFKKDWQNYVRTWFNQPARKKRRRTARQKKAVAVFPRPTAGPLRPVVHS  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYN K+R+GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N  LE LQ N+ RL TY+
Sbjct  61   QTLKYNSKIRSGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENINRLNTYR  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR  518
            AKLVVFPRR++K KAGD+T EEL++ TQ+  P LPI++
Sbjct  121  AKLVVFPRRSKKTKAGDATAEELSSVTQLTRPVLPIVK  158



>ref|XP_001761309.1| predicted protein [Physcomitrella patens]
 gb|EDQ74031.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   226 bits (576),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+GHF+K WQNYV+TWFNQPARK+RRR ARQKK+V +FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVIPNGHFKKDWQNYVRTWFNQPARKKRRRTARQKKSVAVFPRPTAGPLRPVVHS  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QTLKYN K+RAGRGF+LEELKAAG+ KKLAPTIGI+VDHRR+N  LE LQ NV RL TY+
Sbjct  61   QTLKYNAKIRAGRGFTLEELKAAGVPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNTYR  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKAS  530
            AKLVVFPR ++K KAGD++ EEL++ TQ  G +LPI++ + S
Sbjct  121  AKLVVFPRLSKKTKAGDASAEELSSVTQATGEFLPIVKPRPS  162



>sp|P49627.1|RL13_TOBAC RecName: Full=60S ribosomal protein L13; AltName: Full=Clone 
6.2.1 protein [Nicotiana tabacum]
 gb|AAA72054.1| unnamed protein product [Nicotiana tabacum]
Length=202

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +3

Query  72   SGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLKYNMKV  251
            +GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKI PRPTAG LRPIVHGQTLKYNMKV
Sbjct  5    NGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKISPRPTAGTLRPIVHGQTLKYNMKV  64

Query  252  RAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRR  431
            R+GRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRL+  + +LVVFPRR
Sbjct  65   RSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLEDLQGQLVVFPRR  124

Query  432  ARKFKAGDSTPEELATATQVNGPYLPILREK  524
            A + +     P    TATQV+G Y+PI REK
Sbjct  125  ASRSRLVILPPRNCLTATQVHGAYMPIEREK  155



>ref|XP_011395748.1| 60S ribosomal protein L13-2 [Auxenochlorella protothecoides]
 gb|KFM22882.1| 60S ribosomal protein L13-2 [Auxenochlorella protothecoides]
Length=208

 Score =   208 bits (529),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            +++HNNVVP+ HFRK WQ  V+TWFNQPARK RRR AR +KA  +FPRPTAG LRPIVH 
Sbjct  1    MVRHNNVVPNQHFRKKWQTNVRTWFNQPARKLRRRQARAEKAKTVFPRPTAGPLRPIVHS  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT+KYN K R GRGF+LEELK AGI+ KLAPT+GI+VDHRRRN SLEGLQ NV RLK YK
Sbjct  61   QTVKYNRKKRTGRGFTLEELKEAGISAKLAPTVGIAVDHRRRNRSLEGLQENVARLKAYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK  524
            A LV+FPRRA K +AG+++ EELA   Q+ GP LP+   K
Sbjct  121  ANLVLFPRRAGKPRAGEASAEELAAVAQLTGPVLPLTHTK  160



>ref|XP_002962809.1| hypothetical protein SELMODRAFT_266648 [Selaginella moellendorffii]
 gb|EFJ36272.1| hypothetical protein SELMODRAFT_266648 [Selaginella moellendorffii]
Length=208

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++K NNV+P+ HF+K W+  V+TWFNQPARK RRR AR  KA KIFPRP +G LRP+VH 
Sbjct  1    MVKGNNVIPNQHFKKDWEKLVRTWFNQPARKVRRRKARSIKAAKIFPRPPSGPLRPVVHC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
             T+KYN KV+ GRGFSLEELK AGI+KKLA TIGI++DHRR+N SLE LQ NVQRL TYK
Sbjct  61   PTVKYNSKVKYGRGFSLEELKEAGISKKLARTIGIALDHRRKNRSLESLQTNVQRLNTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
             KL+VFPR+A+K K GDS PE L+TATQ  GP LPI+ +K  V
Sbjct  121  TKLIVFPRKAKKTKMGDSQPEVLSTATQFQGPVLPIVPKKPEV  163



>ref|XP_001633643.1| predicted protein [Nematostella vectensis]
 gb|EDO41580.1| predicted protein [Nematostella vectensis]
Length=211

 Score =   205 bits (521),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K NN++P+GHF K WQ YVKTWF+QP RK+RRR ARQ KA KI PRP AG+LRPIV   T
Sbjct  4    KRNNIIPNGHFHKDWQRYVKTWFDQPGRKKRRRVARQTKAAKIAPRPVAGSLRPIVRCPT  63

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
             KYN KVRAGRGF+L+ELKAAGI +K+APTIGI+VDHRR+N S E LQANVQRLK YK+K
Sbjct  64   FKYNTKVRAGRGFTLDELKAAGIPRKVAPTIGIAVDHRRKNRSAESLQANVQRLKEYKSK  123

Query  411  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            L+VFPR+A K K GDS   +LA A Q+ GP +PI +E   +
Sbjct  124  LIVFPRKANKPKQGDSEAADLANAVQLQGPVMPIPQESVPI  164



>ref|XP_002962473.1| hypothetical protein SELMODRAFT_165483 [Selaginella moellendorffii]
 gb|EFJ35936.1| hypothetical protein SELMODRAFT_165483 [Selaginella moellendorffii]
Length=208

 Score =   204 bits (519),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 129/163 (79%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++K NNV+P+ HF+K W+  V+TWFNQPARK RRR AR  KA KIFPRP +G LRP+VH 
Sbjct  1    MVKGNNVIPNQHFKKDWEKLVRTWFNQPARKVRRRKARSIKAAKIFPRPPSGPLRPVVHC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
             T+KYN KV+ GRGFSLEELK AGI+K LA TIGI++DHRR+N SLE LQ NVQRL TYK
Sbjct  61   PTVKYNSKVKYGRGFSLEELKEAGISKNLARTIGIALDHRRKNRSLESLQTNVQRLNTYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
             KL+VFPR+A+K K GDS PE L+TATQ  GP LPI+ +K  V
Sbjct  121  TKLIVFPRKAKKTKMGDSQPEVLSTATQFQGPVLPIVPKKPEV  163



>gb|KDD76767.1| ribosomal protein L13e [Helicosporidium sp. ATCC 50920]
Length=212

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            +++HNNVVP+ HF+K WQ  V+TWFNQPARK RR+ AR  KA   FPRPTAG LRP+VH 
Sbjct  1    MVRHNNVVPNQHFKKKWQFNVRTWFNQPARKLRRKNARVAKARSTFPRPTAGPLRPVVHC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
             T+KYN +VRAG+GFSL ELK AGI  KLAPTIGI+VDHRRRN SLEGLQANVQRLK YK
Sbjct  61   PTVKYNRRVRAGKGFSLAELKEAGIAAKLAPTIGIAVDHRRRNKSLEGLQANVQRLKAYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            A+LV+FPR+A+  KAGD++ EE+A ATQ  G  +PI
Sbjct  121  AQLVLFPRKAKSPKAGDASAEEVAAATQHKGYVMPI  156



>ref|XP_005646484.1| ribosomal protein L13e [Coccomyxa subellipsoidea C-169]
 gb|EIE21940.1| ribosomal protein L13e [Coccomyxa subellipsoidea C-169]
Length=217

 Score =   201 bits (511),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQ-------NYVKTWFNQParkqrrraarqkkaVKIFPRPTAGA  203
            ++KHNNV+P+ HF+KHW        +YV+TWFNQPARK RR  AR +KA K+FPRP AG 
Sbjct  1    MVKHNNVIPNQHFKKHWHGGKNGKGSYVRTWFNQPARKHRRATARIEKAKKVFPRPAAGP  60

Query  204  LRPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANV  383
            LRPIVHGQT+KYN+K R GRGF+LEELK AGI  KLAPTIGI+VDHRR N SLE LQ N 
Sbjct  61   LRPIVHGQTIKYNLKKRLGRGFTLEELKEAGIAVKLAPTIGIAVDHRRHNRSLESLQENA  120

Query  384  QRLKTYKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPIL  515
             RLK YKAKLV+FP R+   K+GDST EEL  A Q  GP LP++
Sbjct  121  ARLKAYKAKLVIFPTRSNMPKSGDSTAEELKVAQQHKGPLLPLV  164



>ref|XP_002154424.1| PREDICTED: 60S ribosomal protein L13-like [Hydra vulgaris]
Length=210

 Score =   197 bits (500),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF KHWQNYV+TWFNQP RK+RRR ARQKKA+ I PRP AG+LRP+V   
Sbjct  1    MKHNNVLPNGHFHKHWQNYVRTWFNQPGRKKRRRTARQKKALAIAPRPVAGSLRPVVRCP  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T KY+ KVR+GRGF+LEELK A I  + A T+GI+VDHRR+N S E LQANVQRL+ Y++
Sbjct  61   TFKYHTKVRSGRGFTLEELKTAQIKLRFAKTVGIAVDHRRKNKSTESLQANVQRLQEYQS  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            KL++FPR+  K KAGDS    L  ATQ+ GP LPI
Sbjct  121  KLIIFPRKQNKPKAGDSEASVLTVATQLKGPVLPI  155



>emb|CCQ18590.1| 60S ribosomal protein L13 [Sycon ciliatum]
Length=208

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            NN++P+ HF K W   VK WF+QP RK RRR AR+KKA+++ PRP AG+LRP+V  QT K
Sbjct  3    NNIIPNAHFHKDWDKRVKCWFDQPGRKSRRRQAREKKALRVAPRPVAGSLRPVVRCQTFK  62

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            YN KVRAGRGF+LEELKAAGI++K+APTIGI+VDHRRRN S E LQANVQRLK Y++KL+
Sbjct  63   YNTKVRAGRGFTLEELKAAGISRKVAPTIGITVDHRRRNRSSESLQANVQRLKEYRSKLI  122

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            VFPR+  K K GDS   EL  A+Q+ GP LPI
Sbjct  123  VFPRKLSKPKRGDSDAAELKVASQLAGPILPI  154



>gb|AAT08722.1| cold-induced protein [Hyacinthus orientalis]
Length=185

 Score =   194 bits (494),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  171  VKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRR  350
            VKIFPRPTAG LRP+VH QTLKYNMK RAGRGFSLEELK AGI KK APT+GI+VDHRRR
Sbjct  33   VKIFPRPTAGPLRPVVHCQTLKYNMKTRAGRGFSLEELKMAGIPKKWAPTVGIAVDHRRR  92

Query  351  NSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKAS  530
            N SLEGLQANVQRLK YKAKLV+FPRR  KFK+GDS+ EELA+ TQV G Y+P+++EK  
Sbjct  93   NRSLEGLQANVQRLKEYKAKLVIFPRRPGKFKSGDSSAEELASITQVQGEYMPLVKEKPV  152

Query  531  V  533
            V
Sbjct  153  V  153



>ref|XP_002739297.1| PREDICTED: 60S ribosomal protein L13-like [Saccoglossus kowalevskii]
Length=212

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N+V+P+GHF K W+ +VKTWFNQP RK RRR  R KKA KI PRP  G +RP+V   T K
Sbjct  6    NSVIPNGHFHKDWERWVKTWFNQPMRKVRRRKNRIKKARKIAPRPVGGPVRPMVRCPTAK  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            YN K R+GRGFSLEELKAAGI KK APTIGI+VDHRRRN S E LQANVQRLK Y+ KL+
Sbjct  66   YNTKTRSGRGFSLEELKAAGIYKKFAPTIGIAVDHRRRNKSAESLQANVQRLKEYRTKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPILR  518
            +FP++A K   GDST EEL  A Q++GP +PI R
Sbjct  126  LFPKKASKPSKGDSTEEELKMAKQLSGPVMPITR  159



>gb|EPZ33898.1| Ribosomal protein L13e domain-containing protein [Rozella allomycis 
CSF55]
Length=212

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNV+P+ HFRKHWQ  VKTWF+QP +K+ RR AR KKA  I PRP  G LRP V G
Sbjct  1    MVKHNNVLPNQHFRKHWQTRVKTWFDQPGKKKSRRLARMKKAELIAPRPVDGLLRPAVRG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT++YNMK+RAGRGFSLEELKAAG+ KK A  +GISVDHRR+N S+E LQ N++RLK YK
Sbjct  61   QTVRYNMKLRAGRGFSLEELKAAGVRKKEARVLGISVDHRRKNRSVESLQLNIERLKAYK  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILRE  521
            +KL+VFPR+A+  K  +S+ EE+  ATQ+    +PI+ +
Sbjct  121  SKLIVFPRKAKNIKKSESSLEEVKQATQLKTELMPIVND  159



>gb|KFD48816.1| hypothetical protein M513_10300 [Trichuris suis]
 gb|KFD69376.1| hypothetical protein M514_10300 [Trichuris suis]
 gb|KHJ41182.1| ribosomal protein L13e [Trichuris suis]
Length=210

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K N ++P+ HF KHWQ YVKTWFNQP R +RRR  R  KA +I PRP  G LRP+V   T
Sbjct  4    KRNGMIPNAHFHKHWQRYVKTWFNQPMRHRRRRLRRVIKARRIAPRPARGPLRPVVRCPT  63

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
            ++YN K+R GRGFSL+ELKAAGI+KK+APTIGISVDHRRRN SLE +Q NVQRLK Y++K
Sbjct  64   IRYNQKLRLGRGFSLQELKAAGISKKMAPTIGISVDHRRRNKSLESMQQNVQRLKEYRSK  123

Query  411  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR  518
            L++FPR+  K + GDST EE   A Q  G  +PI R
Sbjct  124  LILFPRQMDKPRKGDSTAEECKLAEQFKGILMPIKR  159



>gb|KCW72783.1| hypothetical protein EUGRSUZ_E01232 [Eucalyptus grandis]
Length=154

 Score =   187 bits (476),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 120/163 (74%), Gaps = 31/163 (19%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            ++KHNNVVP+GHFRKHWQNY+KT FNQPARK RRR A+QKKAVKIFPRPTA         
Sbjct  1    MVKHNNVVPNGHFRKHWQNYIKTCFNQPARKARRRLAQQKKAVKIFPRPTA---------  51

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
                                  AGI KKL PTIGI+VDHRR+N SLEGL ANVQRLKTY+
Sbjct  52   ----------------------AGIPKKLPPTIGIAVDHRRKNQSLEGLHANVQRLKTYR  89

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            AKLVVFP+ ARKFKAG+STPEELA ATQV G YLPI+REK +V
Sbjct  90   AKLVVFPKCARKFKAGNSTPEELANATQVQGTYLPIVREKPAV  132



>ref|XP_002604928.1| hypothetical protein BRAFLDRAFT_279721 [Branchiostoma floridae]
 gb|EEN60938.1| hypothetical protein BRAFLDRAFT_279721 [Branchiostoma floridae]
Length=212

 Score =   189 bits (480),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            KHNNV+P+GHF K WQN V+TWFNQPARK RRR +R +KA ++ PRP  GALRPIV   T
Sbjct  4    KHNNVIPNGHFHKDWQNRVRTWFNQPARKIRRRKSRVEKARRVAPRPAGGALRPIVRCST  63

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
             KY+ KVRAGRGF+LEE+KAAG+ KK A TIGISVD RRRN S E LQANVQRLK YK+K
Sbjct  64   FKYHTKVRAGRGFTLEEIKAAGLNKKYARTIGISVDPRRRNKSTESLQANVQRLKEYKSK  123

Query  411  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            L++FP++    + GDS  EEL  ATQ+ G  +P+
Sbjct  124  LILFPKKLSAPRKGDSGAEELKMATQLQGAVMPV  157



>emb|CDW52162.1| 60S ribosomal protein L13 [Trichuris trichiura]
Length=210

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 118/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K N ++P+ HF KHWQ YVKTWFNQP R +RRR  R  KA +I PRP  G LRP+V   T
Sbjct  4    KRNGMIPNAHFHKHWQRYVKTWFNQPMRHRRRRIRRVIKARRIAPRPARGPLRPVVRCPT  63

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
            ++YN K+R GRGFSL+ELKAAGI+KK+APTIGISVDHRRRN SLE +Q NVQRLK Y++K
Sbjct  64   IRYNQKLRLGRGFSLQELKAAGISKKMAPTIGISVDHRRRNKSLESMQQNVQRLKEYRSK  123

Query  411  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR  518
            L++FPR+  K + GDST EE   A Q+ G  +PI R
Sbjct  124  LILFPRKMDKPRKGDSTAEECKLAEQLKGVLMPIKR  159



>ref|XP_003382527.1| PREDICTED: 60S ribosomal protein L13-like [Amphimedon queenslandica]
Length=215

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N+V+P+ HF+KHWQ YVKTWF+QPARK++RR  R KKA K+ PRP  G LRPIVH  T K
Sbjct  6    NHVIPNAHFKKHWQRYVKTWFDQPARKKKRRMNRLKKAAKLAPRPAKGPLRPIVHCPTRK  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            YNMKVRAG+GFS EEL+AAGI  ++APTIGISVDHRR N S E LQ NVQRLK YK +L+
Sbjct  66   YNMKVRAGKGFSFEELRAAGIPPRVAPTIGISVDHRRHNKSYESLQTNVQRLKEYKTRLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            +FPR+ +K +  DS  E    A Q+ GP LPI
Sbjct  126  LFPRKGKKPRKEDSDLEACKLAKQLKGPVLPI  157



>gb|AAX48845.1| L13 [Suberites domuncula]
Length=211

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 117/157 (75%), Gaps = 0/157 (0%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K N VVP+ HF+KHW+ YVKTWFNQP +K+RRR  R +KA  + PRP  G LRP+V  QT
Sbjct  4    KRNGVVPNAHFKKHWERYVKTWFNQPGQKKRRRTKRLQKAAAVAPRPANGPLRPVVRCQT  63

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
             KYN KVR+GRGF+ EELKAAG++KK A  IGI+VDHRRRN SLE LQ N QRLK YK+K
Sbjct  64   FKYNTKVRSGRGFTFEELKAAGVSKKQALKIGIAVDHRRRNRSLESLQTNTQRLKEYKSK  123

Query  411  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILRE  521
            L++FPR+  K + GDS  +    ATQ++G  LPI R+
Sbjct  124  LILFPRKMSKPRPGDSDADACKMATQLSGTILPIRRQ  160



>ref|XP_011440919.1| PREDICTED: 60S ribosomal protein L13-like [Crassostrea gigas]
 gb|EKC32302.1| 60S ribosomal protein L13 [Crassostrea gigas]
Length=212

 Score =   187 bits (476),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K NNV+P+GHF K WQ YV+ WFNQPARKQRR   R KKA +I PRP AG+LRPIV   T
Sbjct  4    KRNNVIPNGHFHKDWQRYVRNWFNQPARKQRRHDNRVKKARRIAPRPVAGSLRPIVRCPT  63

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
             KYN K+RAG+GF+L+ELKAAGI KKLA TIGI+VD+RR+N SLE  Q N QRLK YK+K
Sbjct  64   FKYNTKIRAGKGFTLDELKAAGINKKLALTIGIAVDYRRKNKSLESQQQNTQRLKEYKSK  123

Query  411  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            L++FP++  K K GD+T EE+  ATQ+ G  +PI
Sbjct  124  LILFPKKQSKPKKGDATEEEIKMATQLTGLVMPI  157



>ref|XP_005705644.1| 60S ribosomal protein L13e [Galdieria sulphuraria]
 gb|EME29124.1| 60S ribosomal protein L13e [Galdieria sulphuraria]
Length=209

 Score =   186 bits (473),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            +++HNNVVP+GHF K WQ  VKTWFNQP RK+RRR ARQKKA ++ PRP  G LRPIVH 
Sbjct  1    MVRHNNVVPNGHFHKDWQRRVKTWFNQPMRKKRRRLARQKKAARLAPRPAKGPLRPIVHC  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
             T+KYNM VR GRGF+LEELK A I  + A TIGISVD RR+N S+E LQ NVQRLK Y 
Sbjct  61   PTVKYNMNVRLGRGFTLEELKEAKINPQFARTIGISVDRRRKNRSVESLQTNVQRLKEYL  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            ++L++FPRR  K K+GDS P ELA A QV G  LPI
Sbjct  121  SRLILFPRRHGKPKSGDSDPSELAMAKQVFGDVLPI  156



>emb|CAD28610.1| 60S ribosomal protein L13 [Polytomella sp. Pringsheim 198.80]
Length=207

 Score =   184 bits (466),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 128/163 (79%), Gaps = 0/163 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            +++HNNVVP+ HF+K WQ YVKTWFNQ ARK RRR+AR +KA K+FPRP AG+L+PIVHG
Sbjct  1    MVRHNNVVPNNHFKKKWQFYVKTWFNQAARKLRRRSARAEKAKKVFPRPVAGSLKPIVHG  60

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
            QT+KYN K+R GRGF+L ELK AGI  K APTIGISVD+RRRN S+EGLQ N  RLK Y+
Sbjct  61   QTVKYNSKLRLGRGFTLAELKEAGIPAKFAPTIGISVDYRRRNKSVEGLQENANRLKAYR  120

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            + LV+FPR  +K KA +++ EE A+A Q  G  LPI R K +V
Sbjct  121  SNLVIFPRNVKKPKAFEASAEEKASAAQFAGEILPIARCKPTV  163



>gb|ABZ04227.1| ribosomal protein rpl13 [Lineus viridis]
Length=207

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K NN+VP+GHF K WQ YV+TWFNQP RK+RR   RQKKA  I PRP  G LRP+V   T
Sbjct  4    KRNNMVPNGHFHKEWQKYVRTWFNQPMRKKRRHDNRQKKARAIMPRPVGGPLRPVVRCPT  63

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
             +YN +VR GRGFSL+ELKAAGI+KK A TIGI+ D RRRN S+E LQ NVQRLK YK+K
Sbjct  64   FRYNTRVRTGRGFSLDELKAAGISKKYARTIGIAFDFRRRNMSVESLQQNVQRLKEYKSK  123

Query  411  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            L++FP++  K K GD++ EEL  ATQ++G  +P+
Sbjct  124  LILFPKKLSKPKKGDASAEELKMATQLSGEVMPV  157



>emb|CCI40738.1| unnamed protein product [Albugo candida]
Length=216

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF K WQN +KTWF+Q A+K+ RR  R+ K     PRP AG LRP VH  
Sbjct  12   MKHNNVIPNGHFHKDWQNRIKTWFDQAAKKKSRRLRRKAKVAAYAPRPAAGLLRPAVHCP  71

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T+KY  KVRAG+GF+LEELKAAGI++K A TIGI+VD+RR N S+E LQANV RLKTYKA
Sbjct  72   TIKYASKVRAGKGFTLEELKAAGISRKQALTIGIAVDYRRTNKSVESLQANVNRLKTYKA  131

Query  408  KLVVFPRRA-RKFKAGDSTPEELATATQVNGPYLPILR  518
            KL++FPR+   K K GDS+ EE   A Q  GP LPI R
Sbjct  132  KLIIFPRKGLNKPKHGDSSMEETRKAVQHMGPILPITR  169



>gb|KFH63588.1| 50S ribosomal protein L13e [Mortierella verticillata NRRL 6337]
Length=209

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNN +P  HFRK WQ+ VKTW +Q  RK+ RR AR +KA +I PRP  G +RP V   
Sbjct  1    MKHNNQLPGEHFRKDWQSRVKTWLDQAGRKKSRRIARVQKAARIAPRPVDGLIRPAVRCP  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T+KYN K+RAGRGF+LEELKAAGI +K A +IG+SVDHRRRN S E LQ NVQRLK YK+
Sbjct  61   TVKYNTKLRAGRGFTLEELKAAGIRRKEALSIGVSVDHRRRNKSEESLQLNVQRLKAYKS  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            KL+VFPR+A K KAGD+   EL+ ATQ+ G   P+
Sbjct  121  KLIVFPRKAGKAKAGDAEATELSAATQLTGALFPV  155



>gb|AIU94834.1| 60S ribosomal protein [Phragmatopoma lapidosa]
 gb|AIU94836.1| 60S ribosomal protein [Phragmatopoma lapidosa]
Length=212

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 118/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K NNV+P+GHF K WQ YV+TWFNQPARKQRRR  R KKA  I PRP  G LRP+V   T
Sbjct  4    KRNNVLPNGHFHKDWQRYVRTWFNQPARKQRRRTTRIKKARSIAPRPVGGNLRPVVRCPT  63

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
             KYN K R GRGF+LEELKAA I K++A TIGI+VDHRRRN S+E LQ NVQRLK YK+K
Sbjct  64   AKYNTKSRLGRGFTLEELKAAEINKRVAATIGITVDHRRRNKSVESLQLNVQRLKEYKSK  123

Query  411  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR  518
            L++FP++A   K GD++ EE+  ATQ+ G  +P+ R
Sbjct  124  LILFPKKAGAPKKGDASEEEIKMATQLQGTVMPVSR  159



>emb|CBN08623.1| small nucleolar RNA, C/D box 68 [Microcosmus squamiger]
Length=214

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 121/165 (73%), Gaps = 4/165 (2%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
             +KHNN++ + HF K WQ  VKTWFNQPARKQRR   R +KA K+ PRP  G LRPIV  
Sbjct  2    AIKHNNIICNNHFHKKWQTRVKTWFNQPARKQRRYNRRAEKAKKVAPRPVKGPLRPIVRC  61

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
             T+KYNMK R GRGFSLEELKAAGI ++ A TIGI+VD RRRNSS E LQ NVQRLK Y+
Sbjct  62   PTVKYNMKRRFGRGFSLEELKAAGINRRFAQTIGIAVDRRRRNSSYESLQENVQRLKEYR  121

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLP----ILREKA  527
            ++L++FP++  + K GDST EE+  A+Q  G  LP    ++REKA
Sbjct  122  SRLILFPKKPSQPKKGDSTAEEIKMASQHTGAVLPLKRKVVREKA  166



>ref|NP_937786.1| 60S ribosomal protein L13 [Danio rerio]
 ref|XP_005166723.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Danio rerio]
 sp|Q90Z10.3|RL13_DANRE RecName: Full=60S ribosomal protein L13 [Danio rerio]
 gb|AAK63073.1|AF385081_1 60S ribosomal protein L13 [Danio rerio]
 gb|AAS66969.1| ribosomal protein L13 [Danio rerio]
 gb|AAH75977.1| Ribosomal protein L13 [Danio rerio]
Length=211

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 123/163 (75%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ KA +I PRP +G LRP+V   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVSGPLRPVVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGF+LEELKAAGI KK+A TIGISVD RRRN S E LQANVQRLK Y+ KL+
Sbjct  66   YHTKVRAGRGFTLEELKAAGINKKVARTIGISVDSRRRNRSTESLQANVQRLKEYRTKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FPR+A K K GDST EEL  ATQ+ GP +PI     +EKA V
Sbjct  126  IFPRKAAKPKKGDSTEEELKMATQLTGPVMPIKKVHKKEKARV  168



>gb|EFX84971.1| hypothetical protein DAPPUDRAFT_34614 [Daphnia pulex]
Length=203

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K NN++P+GHF K WQ YVKTWFNQPARKQRR A R  KA ++FPRPT  +L+PIV   T
Sbjct  4    KRNNMIPNGHFHKQWQRYVKTWFNQPARKQRRHAHRVAKARRVFPRPTT-SLKPIVRCPT  62

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
             +YN +VRAG+GFSLEEL+AA I K+ APTIGI+VDHRRRN S+E LQ N  RLK YK+K
Sbjct  63   FRYNTRVRAGKGFSLEELRAAKIPKRFAPTIGIAVDHRRRNKSVESLQLNATRLKVYKSK  122

Query  411  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR  518
            L++FPR A+K +  D+TPEE+  A Q+    +PI R
Sbjct  123  LILFPRNAKKPQKTDATPEEIKLAQQLTTEVMPITR  158



>ref|XP_006677706.1| hypothetical protein BATDEDRAFT_6028, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF81595.1| hypothetical protein BATDEDRAFT_6028, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=203

 Score =   182 bits (461),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            M+HNN +P+ HFRK W+ +V+TWF+QP +K  RR  R KKA KI PRP  G LRP V   
Sbjct  1    MRHNNQLPNQHFRKDWKIHVRTWFDQPGKKLSRRVKRVKKAAKIAPRPIDGLLRPAVRCP  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T++YN K+RAGRGFSLEELK AGI++  A T+GISVDHRRRN S+E LQ NVQRLK Y++
Sbjct  61   TVRYNTKLRAGRGFSLEELKEAGISRHFARTVGISVDHRRRNRSVESLQGNVQRLKEYQS  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            KL+VFP++A K K GDS    +ATATQ+ G  +PI
Sbjct  121  KLIVFPKKANKPKNGDSEAAVVATATQLKGALMPI  155



>ref|XP_005843532.1| hypothetical protein CHLNCDRAFT_33026 [Chlorella variabilis]
 gb|EFN51430.1| hypothetical protein CHLNCDRAFT_33026 [Chlorella variabilis]
Length=207

 Score =   181 bits (460),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 120/162 (74%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            M +N +     +RK WQ+ V TWFNQPARK+RRRAAR +KA ++ PRP AG LRP+V GQ
Sbjct  1    MPNNQISSIRKYRKKWQDKVVTWFNQPARKERRRAARAEKATRVAPRPVAGLLRPVVSGQ  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T+KYN K RAGRGF+LEELK AGI  KLAPTIGI+VDHRR N SLE LQ N  RLK YKA
Sbjct  61   TVKYNTKKRAGRGFTLEELKEAGIPAKLAPTIGIAVDHRRTNRSLESLQENANRLKAYKA  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
             LVVFPRRA K KAGD++  EL TA Q+ G  LP +   A+V
Sbjct  121  NLVVFPRRAGKPKAGDASAAELGTAQQLKGALLPFVPTAAAV  162



>gb|KFH62789.1| 50S ribosomal protein L13e [Mortierella verticillata NRRL 6337]
Length=209

 Score =   181 bits (460),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNN +P  HFRK WQ+ VKTW +Q  RK+ RR AR +KA +I PRP  G +RP V   
Sbjct  1    MKHNNQLPGEHFRKDWQSRVKTWLDQAGRKKSRRIARVQKAARIAPRPVDGLIRPAVRCP  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T+KYN K+RAGRGF+LEELK AGI +K A +IG+SVDHRRRN S E LQ NVQRLK YK+
Sbjct  61   TVKYNTKLRAGRGFTLEELKGAGIRRKEALSIGVSVDHRRRNKSEESLQLNVQRLKAYKS  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            KL+VFPR+A K KAGD+   EL+ ATQ+ G   P+
Sbjct  121  KLIVFPRKAGKAKAGDAEATELSAATQLTGALFPV  155



>emb|CEG63488.1| Putative 60S ribosomal protein L13 [Rhizopus microsporus]
Length=211

 Score =   181 bits (460),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 116/156 (74%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            V+KHNN +P+ HFRK W   VKTWF+Q  RK+ RR AR +KA +I PRP  G LRP V  
Sbjct  2    VLKHNNQLPNQHFRKQWDRRVKTWFDQAGRKKSRRIARVQKAGRIAPRPIDGLLRPAVRC  61

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
             T++YNMK+RAGRGF+LEELK AGI +K A +IGI+VDHRRRN S E L+ NVQRLK YK
Sbjct  62   PTVRYNMKLRAGRGFTLEELKEAGIRRKEARSIGIAVDHRRRNRSNESLELNVQRLKAYK  121

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            AKL+VFPR+A K K GDS   E+A+A Q  GP  P+
Sbjct  122  AKLIVFPRKAGKPKKGDSEAAEVASAVQFRGPLFPV  157



>emb|CEG74076.1| Putative 60S ribosomal protein L13 [Rhizopus microsporus]
 emb|CEG70848.1| Putative 60S ribosomal protein L13 [Rhizopus microsporus]
 emb|CEI92149.1| Putative 60S ribosomal protein L13 [Rhizopus microsporus]
 emb|CEI90012.1| Putative 60S ribosomal protein L13 [Rhizopus microsporus]
Length=211

 Score =   181 bits (460),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 116/156 (74%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            V+KHNN +P+ HFRK W   VKTWF+Q  RK+ RR AR +KA +I PRP  G LRP V  
Sbjct  2    VLKHNNQLPNQHFRKQWDRRVKTWFDQAGRKKSRRIARVQKAGRIAPRPIDGLLRPAVRC  61

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
             T++YNMK+RAGRGF+LEELK AGI +K A +IGI+VDHRRRN S E L+ NVQRLK YK
Sbjct  62   PTVRYNMKLRAGRGFTLEELKEAGIRRKEARSIGIAVDHRRRNRSNESLELNVQRLKAYK  121

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            AKL+VFPR+A K K GDS   E+A+A Q  GP  P+
Sbjct  122  AKLIVFPRKAGKPKKGDSEAAEVASAVQFRGPLFPV  157



>gb|KFM61038.1| 60S ribosomal protein L13, partial [Stegodyphus mimosarum]
Length=198

 Score =   181 bits (458),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 121/165 (73%), Gaps = 4/165 (2%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K NN++P+GHF K WQ YVKTWFNQP RK+RR A R KKA  I PRP AG +RPIV   T
Sbjct  4    KRNNMIPNGHFHKDWQRYVKTWFNQPMRKKRRHAQRVKKARLIAPRPAAGPVRPIVRCPT  63

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
             +Y+ K R GRGFSLEELKAAGI KK A TIGI+VD RRRN ++E LQ NVQRLK YK+K
Sbjct  64   FRYHTKERLGRGFSLEELKAAGIHKKEARTIGIAVDFRRRNKNVESLQQNVQRLKVYKSK  123

Query  411  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            L++FPR+  K K GD+T EE+  ATQ+ G  +P+     REKA V
Sbjct  124  LILFPRKLSKPKKGDATAEEIKMATQLQGVVMPVKKHFRREKARV  168



>dbj|BAJ99030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=221

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 118/158 (75%), Gaps = 4/158 (3%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MK NN +P  HFRK WQ YV+TWF+QPA K  RR AR  KA K+ PRP    LRP+V  Q
Sbjct  1    MKGNNALPDNHFRKDWQRYVRTWFDQPASKVARRKARVAKAAKVHPRPLNN-LRPVVRCQ  59

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T+KYN K+RAGRGF+L+EL+AAGI +K APTIGISVDHRR+N S E  QANV RLKTY++
Sbjct  60   TVKYNRKIRAGRGFTLDELQAAGIPRKFAPTIGISVDHRRKNRSEEAFQANVSRLKTYRS  119

Query  408  KLVVFPRR--ARKFKAGDSTPEELATATQV-NGPYLPI  512
            KLV+FPR+  +++ K GDST EE   ATQV +   LPI
Sbjct  120  KLVIFPRKPTSQRAKKGDSTAEERKAATQVLSKQVLPI  157



>ref|XP_008872563.1| hypothetical protein H310_08544 [Aphanomyces invadans]
 gb|ETV99135.1| hypothetical protein H310_08544 [Aphanomyces invadans]
Length=206

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 122/158 (77%), Gaps = 1/158 (1%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF K WQN +KTWF+Q ++K+ RR  R+ KA  I PRP AG LRP VH  
Sbjct  1    MKHNNVIPNGHFHKDWQNRIKTWFDQASKKKSRRLTRKAKAAAIAPRPAAGLLRPAVHCP  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T+KY  KVRAGRGF+L+ELK AGI++K A TIG+SVD+RR N S+E LQANVQRLKTYK+
Sbjct  61   TIKYGSKVRAGRGFTLDELKEAGISRKQALTIGVSVDYRRTNKSVESLQANVQRLKTYKS  120

Query  408  KLVVFPR-RARKFKAGDSTPEELATATQVNGPYLPILR  518
            KLV+FPR RA K KAGDS  EE   ATQ+ G  LPI R
Sbjct  121  KLVLFPRKRASKPKAGDSKVEETKNATQLIGAVLPIAR  158



>gb|AFM90798.1| 60S ribosomal protein L13 [Callorhinchus milii]
Length=211

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRREARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>gb|ABM55560.1| putative ribosomal protein L13 [Maconellicoccus hirsutus]
Length=224

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 121/155 (78%), Gaps = 1/155 (1%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K NN++P+GHF K WQ Y+KTWFNQPARK RR  AR +KA  + PRP AG LRPIVH  T
Sbjct  4    KGNNMIPNGHFHKDWQKYIKTWFNQPARKFRRHKARVQKAKSVAPRPAAGPLRPIVHCPT  63

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
            ++Y+ KVR GRGF+LEE+KAAG++K+ A +IGI+VDHRRRN S+E LQ NVQRLK YK+K
Sbjct  64   VRYHTKVRPGRGFTLEEIKAAGLSKQFARSIGIAVDHRRRNKSVESLQVNVQRLKEYKSK  123

Query  411  LVVFPRRA-RKFKAGDSTPEELATATQVNGPYLPI  512
            L++FP+ A +K + G+++ EE   A+Q+ G  LPI
Sbjct  124  LILFPKHANKKLRKGEASEEERKVASQLKGEVLPI  158



>gb|AFM87368.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   179 bits (454),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            +  N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   
Sbjct  3    LSRNGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCP  62

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T++Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++
Sbjct  63   TIRYHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRS  122

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            KL++FP++A   K GD++PEE+  ATQ++GP +PI
Sbjct  123  KLIIFPKKASAPKKGDASPEEMKLATQLSGPVMPI  157



>gb|AFM90524.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   179 bits (454),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>gb|AFM87461.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   179 bits (454),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            +FP++A   K GD++PEE+  ATQ++GP +PI
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPI  157



>emb|CCA14227.1| 60S ribosomal protein L13 putative [Albugo laibachii Nc14]
Length=205

 Score =   179 bits (453),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF K WQN +KTWF+Q A+K+ RR  R+ K     PRP AG LRP VH  
Sbjct  1    MKHNNVIPNGHFHKDWQNRIKTWFDQAAKKKSRRLRRKAKVAAYAPRPAAGLLRPAVHCP  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T+KY  KVRAG+GF+LEELKAAGI++K A +IGI+VD RR N S+E LQANV RLKT+KA
Sbjct  61   TIKYASKVRAGKGFTLEELKAAGISRKQALSIGIAVDFRRTNKSVESLQANVNRLKTFKA  120

Query  408  KLVVFPRRA-RKFKAGDSTPEELATATQVNGPYLPILR  518
            KL++FPR+   K K GDS+ EE   A Q  G  LPI R
Sbjct  121  KLIIFPRKGLNKPKQGDSSAEETKKAVQHVGAILPITR  158



>gb|AFM89144.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   179 bits (453),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>emb|CCD27757.1| ribosomal protein l13, partial [Apionsoma misakianum]
Length=203

 Score =   178 bits (452),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 116/155 (75%), Gaps = 4/155 (3%)
 Frame = +3

Query  75   GHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLKYNMKVR  254
            GHFRK WQ  VKTWFNQPARK RRR ARQ KA+KI PRP  G LRPIV   T KY+ KVR
Sbjct  1    GHFRKDWQRMVKTWFNQPARKHRRRQARQAKALKIAPRPVGGLLRPIVRCPTFKYHTKVR  60

Query  255  AGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRA  434
             GRGF+L+ELKAAGI KK A TIGISVDHRR N S+E  QANVQRLK YK KL++FP++A
Sbjct  61   XGRGFTLDELKAAGIHKKQARTIGISVDHRRSNRSVESQQANVQRLKEYKTKLILFPKKA  120

Query  435  RKFKAGDSTPEELATATQVNGPYLPI----LREKA  527
             + K GD+T EE+  ATQ+ G  +PI     REKA
Sbjct  121  SQPKKGDATEEEMKMATQLKGTVMPIKXTYKREKA  155



>gb|AFM90648.1| 60S ribosomal protein L13 [Callorhinchus milii]
Length=211

 Score =   179 bits (453),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQQRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>gb|AFM89025.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>gb|AFM88842.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHAKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>ref|NP_001279295.1| ribosomal protein L13 [Callorhinchus milii]
 gb|AFK10534.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85509.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85568.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85759.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85945.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86154.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86270.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86328.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86550.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86703.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86779.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86835.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87213.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87279.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87297.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87356.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87371.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87377.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87462.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87482.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM88692.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89532.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89705.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89736.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89820.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89836.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89903.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89920.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90045.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90135.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90583.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90686.1| 60S ribosomal protein L13 [Callorhinchus milii]
 gb|AFM90856.1| 60S ribosomal protein L13 [Callorhinchus milii]
Length=211

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>gb|AFM88774.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>ref|XP_002502525.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63783.1| predicted protein [Micromonas sp. RCC299]
Length=220

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 116/161 (72%), Gaps = 5/161 (3%)
 Frame = +3

Query  54   HNNVVPSGHFRKHWQN-----YVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIV  218
            HNN +P+ HF+K WQ       V+TWFNQ  RK+ RR AR+KKA  IFPRPTAGALRP+V
Sbjct  4    HNNQLPNAHFKKDWQGNAGACRVRTWFNQAGRKKSRRIAREKKAKAIFPRPTAGALRPVV  63

Query  219  HGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKT  398
               T +YN K R GRGF+LEELKAAGI KKLAPTIGI+VDHRRRN S E L  N +RLK 
Sbjct  64   RPPTQRYNFKTRLGRGFTLEELKAAGIPKKLAPTIGIAVDHRRRNRSEESLALNSKRLKE  123

Query  399  YKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILRE  521
            YKA L++FPRR  K KAGDS   ELA A Q  G  +PI +E
Sbjct  124  YKASLILFPRRTAKPKAGDSDAGELAMAKQFKGALMPITKE  164



>gb|AFM85620.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86809.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90717.1| 60S ribosomal protein L13 [Callorhinchus milii]
Length=211

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>ref|XP_010716479.1| PREDICTED: 60S ribosomal protein L13 [Meleagris gallopavo]
Length=211

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 120/163 (74%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++   HF K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++
Sbjct  6    NGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELK AGI K+ A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHKKVRAGRGFSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASV  533
            +FPR+    K GDS+PEEL  ATQ++GP +PI     REKA V
Sbjct  126  LFPRKPSAPKKGDSSPEELKMATQLSGPVMPIRNVFKREKARV  168



>gb|EIE79206.1| 50S ribosomal protein L13e [Rhizopus delemar RA 99-880]
Length=211

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 115/156 (74%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            V+KHNN +P+ HFRK W   VKTWF+Q  RK+ RR AR +KA +I PRP  G LRP V  
Sbjct  2    VLKHNNQLPNQHFRKQWDRRVKTWFDQAGRKKSRRIARVQKAGRIAPRPIDGLLRPAVRC  61

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
             T++YNMK+R+GRGF+LEELK AGI +K A TIGI+VDHRRRN S E L+ NVQRLK YK
Sbjct  62   PTVRYNMKLRSGRGFTLEELKEAGIRRKEARTIGIAVDHRRRNRSNESLELNVQRLKAYK  121

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            AKL+VFPR+A   K GDS   E+A+A Q+ G   P+
Sbjct  122  AKLIVFPRKAASPKKGDSEAAEVASAVQLRGALFPV  157



>ref|XP_009839630.1| hypothetical protein H257_13700 [Aphanomyces astaci]
 gb|ETV70967.1| hypothetical protein H257_13700 [Aphanomyces astaci]
Length=206

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 122/158 (77%), Gaps = 1/158 (1%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+GHF K WQN +KTWF+Q ++K+ RR  R+ KA  I PRP AG LRP VH  
Sbjct  1    MKHNNVIPNGHFHKDWQNRIKTWFDQASKKKSRRLTRKAKAAAIAPRPAAGLLRPAVHCP  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T+KY  KVRAGRGF+L+ELK AGI++K A +IG+SVD+RR N S+E LQANVQRLKTYK+
Sbjct  61   TIKYGSKVRAGRGFTLDELKEAGISRKQALSIGVSVDYRRTNKSVESLQANVQRLKTYKS  120

Query  408  KLVVFPR-RARKFKAGDSTPEELATATQVNGPYLPILR  518
            KLV+FPR RA K KAGDS  +E   ATQ+ G  LPI R
Sbjct  121  KLVLFPRKRASKPKAGDSKVDETKNATQLVGAVLPIAR  158



>gb|ABM55445.1| ribosomal protein L13 [Xenopsylla cheopis]
Length=221

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 124/166 (75%), Gaps = 5/166 (3%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K NN++P+GHF K WQ +VKTWFNQPARK RRR  R KKA  IFPRP +GALRPIVH  T
Sbjct  3    KGNNMIPNGHFHKDWQRFVKTWFNQPARKIRRRQNRIKKARAIFPRPASGALRPIVHCPT  62

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
            ++Y+ KVRAGRGF+LEE+K AG++   A +IGI++D RRRN S+E LQ NVQRLK Y++K
Sbjct  63   VRYHTKVRAGRGFTLEEVKGAGLSAGFARSIGIALDRRRRNKSVESLQKNVQRLKEYRSK  122

Query  411  LVVFPR-RARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            L++FPR   +K + G++T +E   ATQ+ G  +PI    +R KA V
Sbjct  123  LILFPRHEKKKLRKGEATEDECKVATQLQGIVMPIKQTAVRTKARV  168



>ref|NP_990330.1| 60S ribosomal protein L13 [Gallus gallus]
 sp|P41125.2|RL13_CHICK RecName: Full=60S ribosomal protein L13; AltName: Full=Breast 
basic conserved protein 1 [Gallus gallus]
 dbj|BAA05377.1| unnamed protein product [Gallus gallus]
Length=211

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 120/163 (74%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++   HF K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++
Sbjct  6    NGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTVR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELK AGI K+ A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHKKVRAGRGFSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASV  533
            +FPR+    K GDS+PEEL  ATQ++GP +PI     REKA V
Sbjct  126  LFPRKPSAPKKGDSSPEELKMATQLSGPVMPIRNVFKREKARV  168



>gb|EIE83814.1| hypothetical protein RO3G_08519 [Rhizopus delemar RA 99-880]
Length=211

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 114/156 (73%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            V+KHNN +P+ HFRK W   VKTWF+Q  RK+ RR AR +KA +I PRP  G LRP V  
Sbjct  2    VLKHNNQLPNQHFRKQWDRRVKTWFDQAGRKKSRRIARVQKAARIAPRPIDGLLRPAVRC  61

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
             T++YNMK+R+GRGF+LEELK AGI +K A +IGI+VDHRRRN S E L+ NVQRLK YK
Sbjct  62   PTVRYNMKLRSGRGFTLEELKEAGIQRKEARSIGIAVDHRRRNRSNESLELNVQRLKAYK  121

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            AKL+VFPR+A   K GDS   E+A+A Q  G   P+
Sbjct  122  AKLIVFPRKAASPKKGDSEAAEVASAVQFRGALFPV  157



>ref|XP_008286406.1| PREDICTED: 60S ribosomal protein L13 [Stegastes partitus]
Length=211

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 122/163 (75%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTVR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGF+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHTKVRAGRGFTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FPR+A   K GDST EEL  ATQ++GP +PI     +EKA V
Sbjct  126  LFPRKASAPKKGDSTEEELKMATQLSGPVMPIKTVHKKEKARV  168



>gb|AFM87311.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 123/163 (75%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
             FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  TFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>ref|XP_009013211.1| hypothetical protein HELRODRAFT_105042 [Helobdella robusta]
 gb|ESO08687.1| hypothetical protein HELRODRAFT_105042 [Helobdella robusta]
Length=210

 Score =   177 bits (449),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 118/162 (73%), Gaps = 4/162 (2%)
 Frame = +3

Query  51   KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQT  230
            K NN++P+GHF K W+ +V+TWFNQPARK RR   R  KA KI PRP AG LRP+V   T
Sbjct  3    KGNNIIPNGHFHKDWKKHVRTWFNQPARKFRRWTKRNDKAKKIAPRPVAGLLRPVVRCPT  62

Query  231  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  410
             KYN ++RAGRGF++EELKAAG  KK A TIGI+VD RRRN S+EG Q NVQRLK YKA 
Sbjct  63   FKYNSRIRAGRGFTIEELKAAGFNKKYAKTIGIAVDFRRRNKSVEGFQVNVQRLKEYKAN  122

Query  411  LVVFPRRARKFKAGDSTPEELATATQVNGP-YLPILREKASV  533
            L++FP++  K + GD+T EE+  ATQ  G   LPI   KASV
Sbjct  123  LILFPKKLNKPQKGDATEEEMKLATQYKGKQVLPI---KASV  161



>gb|AFM85555.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   177 bits (449),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 123/163 (75%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ   +TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRARTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>gb|EPB81665.1| 50S ribosomal protein L13e [Mucor circinelloides f. circinelloides 
1006PhL]
 dbj|GAN09558.1| conserved hypothetical protein [Mucor ambiguus]
 dbj|GAN07767.1| conserved hypothetical protein [Mucor ambiguus]
Length=211

 Score =   177 bits (449),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 116/156 (74%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHG  224
            V+KHNN +P+ HFRK W   VKTWF+Q  RK+ RR AR +KA +I PRP  G LRP V  
Sbjct  2    VLKHNNQLPNQHFRKQWDLRVKTWFDQAGRKKSRRIARVQKAGRIAPRPIDGLLRPAVRC  61

Query  225  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  404
             T++YNMK+R+GRGF+LEELK AG+ +K A +IGI+VD RRRN S E L+ NVQRLK YK
Sbjct  62   PTVRYNMKLRSGRGFTLEELKEAGVRRKEARSIGIAVDFRRRNKSNESLELNVQRLKAYK  121

Query  405  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPI  512
            AKL+VFPR+A K K GDS   E+A+A Q+ GP  P+
Sbjct  122  AKLIVFPRKAGKAKKGDSEAAEVASAVQLRGPLFPV  157



>emb|CAF99615.1| unnamed protein product [Tetraodon nigroviridis]
Length=211

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 121/163 (74%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPAAGPLRPQVRCPTVR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGF+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHTKVRAGRGFTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FPR+A   K GDS+ EEL  ATQ+ GP +PI     REKA V
Sbjct  126  LFPRKASAPKKGDSSEEELKMATQLTGPVMPIKTVHKREKARV  168



>gb|AEB31272.1| 60S ribosomal protein, partial [Epinephelus bruneus]
Length=211

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 122/163 (75%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++
Sbjct  6    NGMLLNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGF+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHTKVRAGRGFTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FPR+A   K GDST EEL  ATQ++GP +PI     +EKA V
Sbjct  126  LFPRKASAPKKGDSTEEELKMATQLSGPVMPIKTVHKKEKARV  168



>ref|XP_002195773.1| PREDICTED: 60S ribosomal protein L13 isoform 1 [Taeniopygia guttata]
 ref|XP_004176272.1| PREDICTED: 60S ribosomal protein L13 [Taeniopygia guttata]
Length=211

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 116/163 (71%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++   HF K WQ  V TWFNQPARK RR  AR+ K  +I PRP AG +RPIV   T++
Sbjct  6    NGMILKPHFHKDWQRRVATWFNQPARKLRRGKARRNKTRRIAPRPVAGPIRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELK AGI KK A TIGISVD RRRN S E LQANVQRLK Y +KL+
Sbjct  66   YHKKVRAGRGFSLEELKLAGINKKFARTIGISVDPRRRNKSTESLQANVQRLKEYHSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FPR+    K GDS+PEEL  ATQ+ GP +PI     REKA V
Sbjct  126  LFPRKPAMPKKGDSSPEELKMATQLTGPVMPIKNVFKREKARV  168



>gb|AFM86534.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   177 bits (448),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 123/163 (75%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD+ PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDAFPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>ref|XP_005052310.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Ficedula albicollis]
 ref|XP_005531944.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Pseudopodoces 
humilis]
 ref|XP_009089034.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Serinus canaria]
Length=211

 Score =   177 bits (448),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 118/163 (72%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++   HF K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++
Sbjct  6    NGMILKPHFHKDWQRRVATWFNQPARKLRRRKARQAKARRIAPRPVAGPIRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELK AGI KK A TIGISVD RRRN S E LQANVQRLK Y +KL+
Sbjct  66   YHKKVRAGRGFSLEELKLAGINKKFARTIGISVDPRRRNKSTESLQANVQRLKEYHSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FPR+    K GDS+PEEL  ATQ+ GP +PI     REKA V
Sbjct  126  LFPRKPAMPKKGDSSPEELKMATQLTGPVMPIKNVFKREKARV  168



>gb|AFM90194.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   176 bits (447),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K W+  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWRKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV  533
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV  168



>emb|CCD27771.1| ribosomal protein l13, partial [Sipunculus nudus]
Length=203

 Score =   176 bits (447),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 120/155 (77%), Gaps = 4/155 (3%)
 Frame = +3

Query  75   GHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLKYNMKVR  254
            GHFRK WQ +VKTWFNQPARKQRRR ARQKKA+KI PRP  G LRP V   T KY+ K R
Sbjct  1    GHFRKDWQRWVKTWFNQPARKQRRRQARQKKALKIAPRPLGGLLRPKVRCPTFKYHTKQR  60

Query  255  AGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRA  434
            AGRGF+L+ELKAAGI KK A TIGISVDHRR N S+E LQANVQRLK YK KL++FP++A
Sbjct  61   AGRGFTLDELKAAGIHKKQARTIGISVDHRRTNRSVESLQANVQRLKVYKTKLILFPKKA  120

Query  435  RKFKAGDSTPEELATATQVNGPYLPI----LREKA  527
             + K GD++ EE+  ATQ+ GP +PI     REKA
Sbjct  121  SQPKKGDASEEEMKMATQLVGPVMPIKTTFRREKA  155



>ref|XP_005714141.1| 60S ribosomal protein L13 [Chondrus crispus]
 emb|CDF34322.1| 60S ribosomal protein L13 [Chondrus crispus]
Length=212

 Score =   176 bits (447),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 115/162 (71%), Gaps = 0/162 (0%)
 Frame = +3

Query  48   MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQ  227
            MKHNNV+P+ HFRK WQ  V+TWF QP RK+RRR+AR  K  K  PRP  G LRPIV   
Sbjct  1    MKHNNVIPNNHFRKEWQLRVRTWFEQPMRKRRRRSARVLKYAKSAPRPIDGLLRPIVRCP  60

Query  228  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  407
            T KYNM VR GRGFSLEELK AGI  + APTIGI+VD RR+N SL+ +Q NVQRLK +K 
Sbjct  61   TNKYNMHVRLGRGFSLEELKEAGIAVRYAPTIGIAVDPRRKNRSLDAMQDNVQRLKEFKT  120

Query  408  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASV  533
            KL+VFP+   K K G++  EELA A Q+ G  +PI +  A +
Sbjct  121  KLIVFPKNPAKPKEGEAKKEELAMAAQLEGKLMPIQKTTAEI  162



>ref|XP_004543183.1| PREDICTED: 60S ribosomal protein L13-like isoform X1 [Maylandia 
zebra]
 ref|XP_004543184.1| PREDICTED: 60S ribosomal protein L13-like isoform X2 [Maylandia 
zebra]
 ref|XP_004543185.1| PREDICTED: 60S ribosomal protein L13-like isoform X3 [Maylandia 
zebra]
Length=211

 Score =   176 bits (447),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 121/163 (74%), Gaps = 4/163 (2%)
 Frame = +3

Query  57   NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkaVKIFPRPTAGALRPIVHGQTLK  236
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTIR  65

Query  237  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  416
            Y+ KVR+GRGF+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHTKVRSGRGFTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLI  125

Query  417  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASV  533
            +FPR+A   K GDST EEL  ATQ+ GP +PI     +EKA V
Sbjct  126  LFPRKASAPKKGDSTEEELKMATQLTGPVMPIRTVHKKEKARV  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000