BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H13

Length=491
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009599355.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    179   9e-50   Nicotiana tomentosiformis
gb|AAB04043.1|  HMGR CoA reductase                                      171   1e-48   Solanum lycopersicum
ref|XP_009780786.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    174   5e-48   Nicotiana sylvestris
ref|XP_004232593.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    172   5e-47   
gb|AEX26934.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1       167   2e-45   Solanum chacoense
ref|NP_001275084.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...    167   3e-45   Solanum tuberosum [potatoes]
ref|NP_001275461.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...    166   4e-45   Solanum tuberosum [potatoes]
gb|AAQ12265.1|  hydroxy methyl glutaryl coenzyme A                      156   2e-44   Solanum melongena [aubergine]
ref|XP_006364832.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    163   6e-44   
sp|Q9XEL8.1|HMDH2_CAPAN  RecName: Full=3-hydroxy-3-methylglutaryl...    161   2e-43   Capsicum annuum
gb|ADN39417.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase         159   1e-42   Withania somnifera [ashwagandha]
dbj|BAJ51945.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase        157   1e-42   Nicotiana benthamiana
ref|NP_001289522.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase    159   2e-42   Nicotiana sylvestris
gb|AAL54879.1|AF004233_1  hydroxy-methyl-glutaryl-coenzyme A redu...    159   2e-42   Nicotiana tabacum [American tobacco]
gb|AAL54878.1|AF004232_1  hydroxy-methyl-glutaryl-coenzyme A redu...    158   4e-42   Nicotiana tabacum [American tobacco]
gb|AAO85554.1|  3-hydroxy-3-methylglutaryl-CoA reductase                155   3e-41   Nicotiana attenuata
gb|AAB69727.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         155   3e-41   Camptotheca acuminata
ref|XP_009601069.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    153   2e-40   Nicotiana tomentosiformis
emb|CDP01752.1|  unnamed protein product                                152   4e-40   Coffea canephora [robusta coffee]
gb|ADR51242.1|  3-hydroxy-3-methylglutaryl-CoA reductase                148   1e-38   Coffea arabica [arabica coffee]
dbj|BAB20771.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase        146   5e-38   Solanum tuberosum [potatoes]
ref|XP_006350440.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    146   5e-38   Solanum tuberosum [potatoes]
ref|NP_001275402.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...    143   7e-37   Solanum tuberosum [potatoes]
gb|AAB69726.1|  3-hydroxy-3-methylglutaryl coenzyme a reductase         142   1e-36   Camptotheca acuminata
ref|XP_004231636.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    142   2e-36   
sp|P48022.1|HMDH2_SOLLC  RecName: Full=3-hydroxy-3-methylglutaryl...    137   8e-35   Solanum lycopersicum
gb|AIY26014.1|  HMGR                                                    137   1e-34   Jasminum sambac [Arabian jasmine]
ref|NP_001274940.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...    136   1e-34   Solanum tuberosum [potatoes]
ref|XP_004234589.2|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    135   6e-34   Solanum lycopersicum
ref|XP_010270571.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    135   8e-34   Nelumbo nucifera [Indian lotus]
gb|AIX87980.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         134   1e-33   Panax ginseng [Asiatic ginseng]
gb|AHI58914.1|  3-hydroxy-3-methylgutary coenzyme A reductase           129   2e-33   Centella asiatica [Asiatic pennywort]
gb|AAV54051.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         132   5e-33   Eucommia ulmoides
ref|XP_010266284.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    132   5e-33   Nelumbo nucifera [Indian lotus]
gb|AAT52222.1|  hydroxymethylglutaryl-CoA reductase                     131   1e-32   Catharanthus roseus [chatas]
gb|AGL08682.1|  HMGR2                                                   131   2e-32   Panax ginseng [Asiatic ginseng]
ref|XP_002275827.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    131   2e-32   Vitis vinifera
ref|XP_009785805.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    130   3e-32   Nicotiana sylvestris
ref|XP_006342182.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    130   3e-32   Solanum tuberosum [potatoes]
ref|XP_009588198.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    130   3e-32   Nicotiana tomentosiformis
ref|XP_010317674.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    129   5e-32   Solanum lycopersicum
gb|AHY03303.1|  HMG-CoA reductase 2                                     129   6e-32   Camellia sinensis [black tea]
gb|ACV65036.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         129   6e-32   Panax quinquefolius
sp|Q03163.1|HMDH_CATRO  RecName: Full=3-hydroxy-3-methylglutaryl-...    129   1e-31   Catharanthus roseus [chatas]
gb|AFN89599.1|  3-hydro-3-methylglutary CoA reductase                   129   1e-31   Gentiana macrophylla
gb|ADP94147.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         128   2e-31   Withania somnifera [ashwagandha]
gb|AIK21780.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         128   3e-31   Panax notoginseng [san-qi]
ref|XP_002301898.1|  hydroxymethylglutaryl-CoA reductase family p...    127   5e-31   
ref|XP_004146762.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    126   1e-30   Cucumis sativus [cucumbers]
dbj|BAE92730.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase        126   1e-30   Gentiana lutea
gb|AAU08214.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         125   2e-30   Hevea brasiliensis [jebe]
sp|P29057.1|HMDH1_HEVBR  RecName: Full=3-hydroxy-3-methylglutaryl...    125   2e-30   Hevea brasiliensis [jebe]
dbj|BAF98282.1|  hydroxymethylglutaryl-CoA reductase                    125   2e-30   Hevea brasiliensis [jebe]
gb|ACE80213.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1       125   3e-30   Pyrus pyrifolia [sha li]
gb|ABK88909.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         124   4e-30   Atractylodes lancea
gb|KDP36739.1|  hypothetical protein JCGZ_08030                         123   1e-29   Jatropha curcas
ref|XP_011034792.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    123   1e-29   Populus euphratica
ref|XP_002510732.1|  hmg-CoA reductase, putative                        123   1e-29   Ricinus communis
gb|AHB64333.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         122   2e-29   Camellia sinensis [black tea]
ref|XP_006390187.1|  hypothetical protein EUTSA_v10018320mg             121   2e-29   
ref|XP_011458111.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    123   2e-29   Fragaria vesca subsp. vesca
ref|XP_008348952.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    122   3e-29   Malus domestica [apple tree]
ref|XP_002265638.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    121   5e-29   Vitis vinifera
gb|AEM42971.1|  HMG-CoA reductase                                       121   6e-29   Siraitia grosvenorii [arhat fruit]
gb|AFZ93642.1|  hydroxymethylglutaryl coenzyme A reductase              121   6e-29   Euphorbia lathyris
ref|XP_006390188.1|  hypothetical protein EUTSA_v10018320mg             121   6e-29   Eutrema salsugineum [saltwater cress]
gb|KGN46640.1|  hypothetical protein Csa_6G117710                       122   7e-29   Cucumis sativus [cucumbers]
gb|AHX36946.1|  3-hydroxy-3-methyl glutaryl coenzyme a reductase        120   1e-28   Betula platyphylla [Asian white birch]
ref|XP_006435453.1|  hypothetical protein CICLE_v10000761mg             118   2e-28   
ref|NP_001284380.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...    120   2e-28   Cucumis melo [Oriental melon]
ref|XP_011041288.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    119   2e-28   Populus euphratica
gb|KDO85245.1|  hypothetical protein CISIN_1g011423mg                   119   2e-28   Citrus sinensis [apfelsine]
ref|XP_006473861.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    119   2e-28   Citrus sinensis [apfelsine]
gb|KDO85246.1|  hypothetical protein CISIN_1g011423mg                   118   2e-28   Citrus sinensis [apfelsine]
gb|KJB14840.1|  hypothetical protein B456_002G146000                    119   3e-28   Gossypium raimondii
gb|AET72044.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1       119   3e-28   Dimocarpus longan [longan]
ref|XP_006435454.1|  hypothetical protein CICLE_v10000761mg             119   4e-28   Citrus clementina [clementine]
ref|XP_007018657.1|  Hydroxy methylglutaryl CoA reductase 1             118   6e-28   
ref|XP_010537243.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    119   7e-28   Tarenaya hassleriana [spider flower]
ref|XP_008448157.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    119   7e-28   Cucumis melo [Oriental melon]
ref|XP_004139979.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    118   7e-28   Cucumis sativus [cucumbers]
gb|AHI85949.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         118   8e-28   Pyrus communis
gb|AAK64657.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         118   9e-28   Malus domestica [apple tree]
ref|XP_008347553.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    118   1e-27   
ref|XP_004154522.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    118   1e-27   
gb|ABP04052.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         117   1e-27   Corylus avellana [European hazelnut]
ref|XP_010534322.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    117   1e-27   Tarenaya hassleriana [spider flower]
gb|ABK56831.1|  3-hydroxy-3-methylglutaryl-CoA reductase                117   2e-27   Euphorbia pekinensis
gb|AGW82424.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         116   3e-27   Corylus avellana [European hazelnut]
ref|XP_002306999.1|  hydroxymethylglutaryl-CoA reductase family p...    116   3e-27   
ref|XP_010690585.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    116   4e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|AIM19608.1|  3-hydroxy-3-methyl-glutaryl-CoA reductase               116   5e-27   
ref|XP_009358901.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    116   5e-27   Pyrus x bretschneideri [bai li]
ref|XP_003519474.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    115   5e-27   Glycine max [soybeans]
ref|XP_003545556.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    115   5e-27   Glycine max [soybeans]
gb|AET72045.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 2       115   6e-27   Dimocarpus longan [longan]
emb|CDP07253.1|  unnamed protein product                                115   6e-27   Coffea canephora [robusta coffee]
sp|O64967.1|HMDH2_GOSHI  RecName: Full=3-hydroxy-3-methylglutaryl...    116   7e-27   Gossypium hirsutum [American cotton]
ref|XP_010061229.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    115   7e-27   Eucalyptus grandis [rose gum]
gb|ABF56518.2|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1       115   9e-27   Litchi chinensis [litchi]
ref|XP_011092919.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    115   1e-26   Sesamum indicum [beniseed]
ref|XP_004287703.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    115   1e-26   Fragaria vesca subsp. vesca
ref|XP_008235831.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    115   1e-26   Prunus mume [ume]
gb|AAC37432.1|  HMG-CoA reductase                                       107   1e-26   Solanum tuberosum [potatoes]
ref|XP_010028873.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-...    115   1e-26   
ref|XP_010530977.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    114   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_002300544.1|  3-hydroxy-3-methylglutaryl coenzyme A reduct...    114   2e-26   Populus trichocarpa [western balsam poplar]
sp|P48021.1|HMDH_CAMAC  RecName: Full=3-hydroxy-3-methylglutaryl-...    114   2e-26   Camptotheca acuminata
gb|ABQ52378.1|  3-hydroxy-3-methylglutaryl-CoA reductase                114   2e-26   Malus domestica [apple tree]
gb|AAK95406.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         114   2e-26   Malus domestica [apple tree]
ref|XP_008357826.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    114   2e-26   
gb|AET72043.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 2       114   2e-26   Litchi chinensis [litchi]
gb|KCW55693.1|  hypothetical protein EUGRSUZ_I01544                     114   2e-26   Eucalyptus grandis [rose gum]
ref|XP_011038101.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    114   3e-26   Populus euphratica
gb|AAL03986.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         114   3e-26   Malus domestica [apple tree]
gb|KJB79754.1|  hypothetical protein B456_013G065200                    114   3e-26   Gossypium raimondii
ref|XP_006302045.1|  hypothetical protein CARUB_v10020027mg             112   4e-26   
gb|KJB12364.1|  hypothetical protein B456_002G014700                    113   4e-26   Gossypium raimondii
ref|XP_010090727.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...    113   5e-26   Morus notabilis
sp|O64966.1|HMDH1_GOSHI  RecName: Full=3-hydroxy-3-methylglutaryl...    113   5e-26   Gossypium hirsutum [American cotton]
ref|XP_009359638.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    113   5e-26   
ref|XP_003617066.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase    113   5e-26   Medicago truncatula
gb|ABC74565.1|  3-hydroxy-3-methylglutaryl-CoA reductase                113   5e-26   Picrorhiza kurrooa
gb|KHG00733.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1       113   6e-26   Gossypium arboreum [tree cotton]
ref|XP_007199742.1|  hypothetical protein PRUPE_ppa002715mg             113   8e-26   
gb|KJB12363.1|  hypothetical protein B456_002G014700                    112   8e-26   Gossypium raimondii
emb|CDX88285.1|  BnaC06g37290D                                          112   8e-26   
gb|AAC37431.1|  HMG-CoA reductase                                       105   8e-26   Solanum tuberosum [potatoes]
ref|XP_006302046.1|  hypothetical protein CARUB_v10020027mg             112   1e-25   Capsella rubella
gb|AAP14352.2|  3-hydroxy-3-methylglutaryl-coenzyme A reductase         112   1e-25   Andrographis paniculata
ref|XP_002887642.1|  3-hydroxy-3-methylglutaryl CoA reductase           112   1e-25   
ref|XP_002317026.1|  3-hydroxy-3-methylglutaryl coenzyme A reduct...    112   2e-25   Populus trichocarpa [western balsam poplar]
gb|AHZ59734.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         111   2e-25   Panax notoginseng [san-qi]
dbj|BAF98280.1|  hydroxymethylglutaryl-CoA reductase                    111   2e-25   Hevea brasiliensis [jebe]
ref|XP_011030717.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    111   4e-25   Populus euphratica
gb|ACD37361.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase         110   4e-25   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009369772.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    110   5e-25   Pyrus x bretschneideri [bai li]
gb|AFN89600.1|  3-hydro-3-methylglutary CoA reductase                   110   6e-25   Gentiana macrophylla
gb|AAC37433.1|  HMG-CoA reductase                                       102   8e-25   Solanum tuberosum [potatoes]
ref|XP_007141592.1|  hypothetical protein PHAVU_008G208900g             109   1e-24   Phaseolus vulgaris [French bean]
gb|AIX87979.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         109   1e-24   Panax ginseng [Asiatic ginseng]
ref|XP_010428711.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    109   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010428712.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    109   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010471802.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    109   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010416569.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    109   1e-24   Camelina sativa [gold-of-pleasure]
gb|AEZ55672.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 3       109   2e-24   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009369771.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    109   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_009106317.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    108   2e-24   Brassica rapa
gb|ADI80346.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         108   2e-24   Panax ginseng [Asiatic ginseng]
gb|AFM77981.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         108   2e-24   Eleutherococcus senticosus
gb|KFK42070.1|  hypothetical protein AALP_AA2G207200                    108   2e-24   Arabis alpina [alpine rockcress]
ref|XP_004491163.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    108   2e-24   Cicer arietinum [garbanzo]
gb|AAC37435.1|  HMG-CoA reductase                                       101   2e-24   Solanum tuberosum [potatoes]
gb|AGQ04159.1|  hydroxymethylglutaryl-CoA reductase                     108   2e-24   Lavandula angustifolia [lavender]
gb|AEU08408.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         108   2e-24   Clematis armandii
gb|ADX31913.1|  HMG CoA reductase                                       108   3e-24   Bacopa monnieri
gb|ADX31914.1|  HMG CoA reductase                                       108   3e-24   Bacopa monnieri
sp|P14891.1|HMDH1_ARATH  RecName: Full=3-hydroxy-3-methylglutaryl...    108   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204574.1|  hypothetical protein PRUPE_ppa003627mg             108   3e-24   Prunus persica
gb|EYU41201.1|  hypothetical protein MIMGU_mgv1a003775mg                108   3e-24   Erythranthe guttata [common monkey flower]
ref|NP_177775.2|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1     108   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AIG55301.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         108   4e-24   Camellia sinensis [black tea]
ref|XP_004169656.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    107   6e-24   
gb|ABX82838.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         107   7e-24   Cyclocarya paliurus [qing qian liu]
gb|ABV25900.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase         107   7e-24   Antirrhinum majus [garden snapdragon]
ref|XP_002313569.2|  hypothetical protein POPTR_0009s17090g             107   8e-24   
gb|AAY68034.1|  3-hydroxy-methylglutaryl coenzyme A reductase           107   9e-24   Tilia miqueliana
ref|XP_011000849.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    107   1e-23   Populus euphratica
gb|ACE80254.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 2       106   1e-23   Pyrus pyrifolia [sha li]
ref|XP_008451185.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    106   1e-23   Cucumis melo [Oriental melon]
ref|XP_004144569.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    106   1e-23   Cucumis sativus [cucumbers]
gb|AAC15476.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         105   2e-23   Tagetes erecta [big marigold]
ref|XP_006384871.1|  3-hydroxy-3-methylglutaryl coenzyme A reduct...    106   2e-23   
ref|XP_004290090.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    106   2e-23   Fragaria vesca subsp. vesca
ref|XP_002514400.1|  hmg-CoA reductase, putative                        106   2e-23   Ricinus communis
ref|XP_008242115.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    105   2e-23   Prunus mume [ume]
gb|KJB31954.1|  hypothetical protein B456_005G215800                    105   2e-23   Gossypium raimondii
gb|AAC15475.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         105   3e-23   Tagetes erecta [big marigold]
gb|KJB31953.1|  hypothetical protein B456_005G215700                    105   3e-23   Gossypium raimondii
ref|XP_010063168.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    105   3e-23   Eucalyptus grandis [rose gum]
ref|XP_008344180.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    105   3e-23   
ref|XP_011000847.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    105   3e-23   Populus euphratica
emb|CDY71344.1|  BnaAnng37030D                                          103   3e-23   Brassica napus [oilseed rape]
ref|XP_007204578.1|  hypothetical protein PRUPE_ppa003613mg             105   4e-23   Prunus persica
gb|KJB31952.1|  hypothetical protein B456_005G215600                    105   4e-23   Gossypium raimondii
sp|Q00583.1|HMDH3_HEVBR  RecName: Full=3-hydroxy-3-methylglutaryl...    105   4e-23   Hevea brasiliensis [jebe]
emb|CAA48611.1|  hydroxymethylglutaryl-CoA reductase (NADPH)            105   5e-23   Raphanus sativus
ref|XP_010094509.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...    104   5e-23   Morus notabilis
gb|EPS64817.1|  hypothetical protein M569_09963                         104   7e-23   Genlisea aurea
emb|CDY20406.1|  BnaC02g24100D                                          104   7e-23   Brassica napus [oilseed rape]
ref|XP_006409321.1|  hypothetical protein EUTSA_v10022614mg             104   9e-23   Eutrema salsugineum [saltwater cress]
gb|KJB31951.1|  hypothetical protein B456_005G215500                    104   9e-23   Gossypium raimondii
gb|EYU40486.1|  hypothetical protein MIMGU_mgv1a003590mg                104   1e-22   Erythranthe guttata [common monkey flower]
gb|KJB47156.1|  hypothetical protein B456_008G013000                    103   1e-22   Gossypium raimondii
ref|XP_007043108.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...    103   1e-22   Theobroma cacao [chocolate]
ref|XP_009128179.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    103   1e-22   Brassica rapa
gb|EYU36597.1|  hypothetical protein MIMGU_mgv1a003864mg                103   2e-22   Erythranthe guttata [common monkey flower]
gb|AEO12148.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase         103   2e-22   Camellia sinensis [black tea]
gb|AEZ55673.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 4       103   2e-22   Salvia miltiorrhiza [Chinese salvia]
gb|KJB47155.1|  hypothetical protein B456_008G013000                    102   3e-22   Gossypium raimondii
gb|AAD03789.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase         102   4e-22   Morus alba
gb|ADC44451.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1       102   4e-22   Salvia miltiorrhiza [Chinese salvia]
gb|KDO38001.1|  hypothetical protein CISIN_1g007956mg                   102   5e-22   Citrus sinensis [apfelsine]
ref|XP_006422382.1|  hypothetical protein CICLE_v10028082mg             102   5e-22   Citrus clementina [clementine]
ref|XP_006486561.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    102   5e-22   Citrus sinensis [apfelsine]
gb|ACT65734.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase         101   7e-22   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011074058.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...    101   9e-22   Sesamum indicum [beniseed]
gb|AGA83240.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase         101   9e-22   Aquilaria sinensis
ref|XP_008392877.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-...    100   1e-21   
gb|KJB77453.1|  hypothetical protein B456_012G138100                    100   3e-21   Gossypium raimondii
emb|CAA48610.1|  hydroxymethylglutaryl-CoA reductase (NADPH)          99.8    4e-21   Raphanus sativus
dbj|BAF98281.1|  hydroxymethylglutaryl-CoA reductase                  99.8    5e-21   Hevea brasiliensis [jebe]
ref|XP_002528521.1|  hmg-CoA reductase, putative                      98.6    9e-21   Ricinus communis
ref|XP_008357165.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  98.2    9e-21   
gb|AFU75319.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       98.6    1e-20   Aquilaria sinensis
ref|XP_004300101.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  98.2    1e-20   Fragaria vesca subsp. vesca
ref|XP_011458110.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  97.4    2e-20   Fragaria vesca subsp. vesca
emb|CBI37502.3|  unnamed protein product                              97.4    2e-20   Vitis vinifera
gb|ABV25901.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       97.1    4e-20   Antirrhinum majus [garden snapdragon]
gb|AGB06349.1|  HMG-CoA reductase                                     96.7    4e-20   Camellia sinensis [black tea]
gb|KDP24920.1|  hypothetical protein JCGZ_24298                       95.5    1e-19   Jatropha curcas
ref|XP_010029551.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  95.5    1e-19   Eucalyptus grandis [rose gum]
gb|KDP47034.1|  hypothetical protein JCGZ_10761                       95.1    2e-19   Jatropha curcas
ref|XP_007046440.1|  Hydroxy methylglutaryl CoA reductase 1 isofo...  95.1    2e-19   
ref|XP_007046441.1|  Hydroxy methylglutaryl CoA reductase 1 isofo...  95.1    2e-19   
gb|AAM19212.1|AF495909_1  3-hydroxy-3-methylglutaryl coenzyme A       88.6    2e-19   Malus domestica [apple tree]
ref|XP_002283183.2|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  94.7    3e-19   Vitis vinifera
ref|XP_010548185.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  93.2    7e-19   Tarenaya hassleriana [spider flower]
gb|AAL28015.2|AF389879_1  3-hydroxy-3-methylglutaryl-coenzyme A r...  92.8    1e-18   Andrographis paniculata
emb|CAN72217.1|  hypothetical protein VITISV_039086                   92.0    2e-18   Vitis vinifera
gb|KFK40113.1|  hypothetical protein AALP_AA3G332100                  91.7    2e-18   Arabis alpina [alpine rockcress]
ref|XP_008242335.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  90.9    4e-18   Prunus mume [ume]
gb|ABV25902.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       90.9    4e-18   Antirrhinum majus [garden snapdragon]
gb|AGF87122.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 3     90.9    5e-18   Litchi chinensis [litchi]
gb|AAA33359.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       85.5    5e-18   Hevea brasiliensis [jebe]
emb|CBI37717.3|  unnamed protein product                              90.1    8e-18   Vitis vinifera
gb|AEW07959.1|  hypothetical protein 0_15354_01                       84.3    3e-17   Pinus radiata
ref|XP_011458109.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  89.0    3e-17   Fragaria vesca subsp. vesca
gb|AEH95323.1|  HMG-CoA reductase 3                                   87.0    8e-17   Glycyrrhiza uralensis [Chinese licorice]
gb|AAA68966.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       86.3    2e-16   Artemisia annua [sweet Annie]
gb|AEH58930.1|  HMG-CoA reductase                                     85.1    4e-16   Glycyrrhiza uralensis [Chinese licorice]
gb|AAD47596.1|  HMG-CoA reductase                                     85.1    5e-16   Artemisia annua [sweet Annie]
gb|ADX01170.1|  putative 3-hydroxy-3-methyl-glutaryl-CoA reductase    85.1    5e-16   Bacopa monnieri
gb|ACN40476.1|  unknown                                               85.1    5e-16   Picea sitchensis
gb|AAA68965.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       84.0    1e-15   Artemisia annua [sweet Annie]
ref|XP_001763417.1|  predicted protein                                84.0    1e-15   
gb|ABJ16394.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       83.6    2e-15   Ligularia fischeri
ref|XP_010515116.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  83.6    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010467508.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  83.6    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_003629056.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  83.2    2e-15   Medicago truncatula
ref|XP_010489363.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  82.8    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006297340.1|  hypothetical protein CARUB_v10013360mg           82.8    3e-15   Capsella rubella
ref|XP_008782826.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  82.4    4e-15   Phoenix dactylifera
gb|ADM87300.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       82.4    4e-15   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_002884053.1|  3-hydroxy-3-methylglutaryl-CoA reductase 2       82.0    5e-15   
dbj|BAE92731.2|  3-hydroxy-3-methylglutaryl coenzyme A reductase      82.0    5e-15   Gentiana lutea
gb|AAY87014.1|  3-hydroxy-methylglutaryl coenzyme A reductase         81.6    8e-15   Magnolia chapensis
ref|XP_006849945.1|  hypothetical protein AMTR_s00022p00133290        80.9    1e-14   Amborella trichopoda
ref|NP_179329.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 2   80.9    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509470.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  80.9    1e-14   Cicer arietinum [garbanzo]
ref|XP_001771547.1|  predicted protein                                80.9    2e-14   
ref|XP_008796235.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  80.9    2e-14   Phoenix dactylifera
gb|ABE27875.1|  hydroxymethylglutaryl-coenzyme A reductase            80.5    2e-14   Arnebia euchroma
gb|AER00469.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       80.1    3e-14   Tanacetum parthenium [feverfew]
ref|XP_010025657.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  79.7    4e-14   Eucalyptus grandis [rose gum]
gb|AGN32411.1|  3-hydroxy-3-methylglutaryl-CoA reductase 1            79.7    4e-14   Dioscorea zingiberensis
gb|AAL37041.1|AF303583_1  3-hydroxy-3-methylglutaryl coenzyme A       79.3    5e-14   Pisum sativum [garden pea]
ref|XP_003534226.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  79.0    7e-14   Glycine max [soybeans]
ref|XP_010927300.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  79.0    7e-14   Elaeis guineensis
ref|XP_008778179.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  79.0    7e-14   
ref|XP_004512291.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  77.8    2e-13   Cicer arietinum [garbanzo]
ref|XP_001751461.1|  predicted protein                                77.8    2e-13   
ref|XP_003547886.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  77.4    3e-13   Glycine max [soybeans]
gb|AAU89123.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       77.0    3e-13   Ginkgo biloba [ginkgo]
ref|XP_002979148.1|  hypothetical protein SELMODRAFT_177513           76.6    4e-13   Selaginella moellendorffii
ref|XP_002988517.1|  hypothetical protein SELMODRAFT_272011           76.6    4e-13   Selaginella moellendorffii
gb|AIX10146.1|  hydroxymethylglutaryl-CoA reductase                   76.6    4e-13   Dioscorea composita
ref|XP_007156265.1|  hypothetical protein PHAVU_003G271800g           76.3    5e-13   Phaseolus vulgaris [French bean]
tpg|DAA62078.1|  TPA: hypothetical protein ZEAMMB73_122013            75.5    1e-12   
gb|AEL30660.1|  3-hydroxy-3-methylglutaryl-CoA reductase              75.1    1e-12   
ref|XP_008666319.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  72.8    2e-12   
ref|XP_010932149.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-...  74.7    2e-12   
gb|ACR02667.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       74.3    2e-12   
ref|XP_007146046.1|  hypothetical protein PHAVU_006G008200g           74.3    3e-12   
tpg|DAA46962.1|  TPA: hypothetical protein ZEAMMB73_781636            72.8    3e-12   
ref|XP_003612422.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  73.9    3e-12   
ref|XP_003612421.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  73.9    3e-12   
ref|XP_010928980.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  73.2    6e-12   
gb|AHI88624.1|  3-hydroxy-3-methylglutary CoA reductase               72.8    8e-12   
emb|CDY50207.1|  BnaC07g06390D                                        72.8    8e-12   
gb|AFD23288.1|  3-hydroxy-3-methylglutary CoA reductase               72.4    9e-12   
gb|AGT78194.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       72.0    1e-11   
ref|XP_008799136.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  72.0    2e-11   
ref|XP_004957224.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  71.6    2e-11   
ref|XP_009121127.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  71.2    3e-11   
gb|AFW62832.1|  hypothetical protein ZEAMMB73_935848                  71.2    4e-11   
ref|XP_002460459.1|  hypothetical protein SORBIDRAFT_02g028630        70.5    5e-11   
gb|AGN32409.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1     70.5    5e-11   
gb|AID51438.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 3     70.5    6e-11   
ref|XP_010910988.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-...  69.7    9e-11   
dbj|BAJ91127.1|  predicted protein                                    69.7    9e-11   
ref|XP_009387500.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  69.7    9e-11   
dbj|BAJ89341.1|  predicted protein                                    69.3    1e-10   
gb|AAD38873.1|AF110382_1  3-hydroxy-3-methylglutaryl-coenzyme A r...  69.3    1e-10   
ref|XP_007158038.1|  hypothetical protein PHAVU_002G118900g           69.3    1e-10   
sp|Q9XHL5.2|HMDH3_ORYSJ  RecName: Full=3-hydroxy-3-methylglutaryl...  69.3    1e-10   
gb|EEC83870.1|  hypothetical protein OsI_29857                        68.9    1e-10   
ref|XP_003578341.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.9    2e-10   
ref|NP_001130818.1|  hypothetical protein                             68.6    2e-10   
gb|AID51436.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1     68.6    2e-10   
ref|XP_009386797.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.6    2e-10   
ref|XP_002445887.1|  hypothetical protein SORBIDRAFT_07g027480        68.2    3e-10   
gb|AEC33260.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       68.2    3e-10   
ref|XP_003537699.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.2    3e-10   
ref|XP_004973895.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.2    3e-10   
ref|XP_003517117.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  67.4    6e-10   
emb|CDY24329.1|  BnaA07g02540D                                        67.0    6e-10   
ref|XP_003617390.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  66.6    9e-10   
gb|AFW65233.1|  hypothetical protein ZEAMMB73_893790                  65.9    1e-09   
sp|O24594.1|HMDH_MAIZE  RecName: Full=3-hydroxy-3-methylglutaryl-...  66.2    1e-09   
ref|XP_008677153.1|  PREDICTED: uncharacterized protein LOC100280...  66.2    1e-09   
ref|XP_003612563.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  66.2    1e-09   
ref|XP_003612561.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  66.2    1e-09   
gb|EAZ09593.1|  hypothetical protein OsI_31874                        65.9    2e-09   
ref|XP_003572378.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  65.9    2e-09   
emb|CAA92821.1|  3-hydroxy-3-methylglutaryl-CoA reductase             65.9    2e-09   
ref|NP_001063541.1|  Os09g0492700                                     65.9    2e-09   
ref|XP_006605576.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  65.5    2e-09   
gb|AIA62198.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       65.5    3e-09   
ref|XP_009410341.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  65.1    3e-09   
gb|ABY20972.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1     64.7    4e-09   
ref|XP_003612568.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  64.7    4e-09   
ref|XP_009395908.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  64.3    5e-09   
ref|NP_001146733.1|  uncharacterized protein LOC100280335             64.3    5e-09   
gb|AEA92686.1|  3-hydroxy-3-methylglutaryl coenzyme A                 63.5    9e-09   
gb|AAQ82685.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       63.5    9e-09   
gb|AGI56083.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1     63.2    1e-08   
gb|AHC72041.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       63.2    1e-08   
gb|AGA18962.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       63.2    1e-08   
ref|XP_003612565.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  62.4    2e-08   
gb|AID51437.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 2     61.6    5e-08   
ref|XP_010025658.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  61.2    7e-08   
gb|EMT29532.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 3     58.9    3e-07   
gb|ABU92914.1|  3-hydroxy-3-methyl-coenzyme A reductase 1             54.7    3e-07   
gb|AFG66878.1|  hypothetical protein                                  55.1    4e-07   
gb|AAC37436.1|  HMG-CoA reductase                                     54.3    5e-07   
gb|EEE68986.1|  hypothetical protein OsJ_27912                        57.4    1e-06   
gb|KCW53308.1|  hypothetical protein EUGRSUZ_J02561                   57.0    1e-06   
gb|AFW68115.1|  hypothetical protein ZEAMMB73_736455                  55.1    4e-06   
gb|AIZ09174.1|  3-hydroxy-3-methyl-glutaryl-CoA reductase             50.1    3e-04   



>ref|XP_009599355.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Nicotiana tomentosiformis]
 gb|AAB87727.1| hydroxy-methylglutaryl-coenzyme A reductase [Nicotiana tabacum]
Length=604

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K    P+K   +A E++K HKQ    VSSPKASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRPVKPF-YPSKDDVSAGESLKPHKQTQQ-VSSPKASDALPLPLYLTNGLFFTMFF  58

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLLVRWREKIRNSTPLH+VTLSEL A+ SLIASVIYLLGFFGIGFVQSF+ R+N +
Sbjct  59   SVMYFLLVRWREKIRNSTPLHMVTLSELVAMVSLIASVIYLLGFFGIGFVQSFVSRSNSD  118

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD ED + EQ+++EEDSRRG C
Sbjct  119  SWDVEDENTEQFIIEEDSRRGPC  141



>gb|AAB04043.1| HMGR CoA reductase [Solanum lycopersicum]
Length=343

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 112/143 (78%), Gaps = 7/143 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K LC     SA      +  KQQ   VSSPKASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRPVKPLCTSKDASAG-----EPLKQQQ--VSSPKASDALPLPLYLTNGLFFTMFF  53

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLLVRWREKIRNS PLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQSF+ R+N +
Sbjct  54   SVMYFLLVRWREKIRNSIPLHVVTLSELLAMVSLIASVIYLLGFFGIGFVQSFVSRSNSD  113

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD ED + EQ ++EEDSRRG C
Sbjct  114  SWDIEDENAEQLIIEEDSRRGPC  136



>ref|XP_009780786.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Nicotiana sylvestris]
Length=605

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K     +K   +A E +K HKQ    VSSPKASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRPVKPFYS-SKDDVSAGEPLKPHKQTQQ-VSSPKASDALPLPLYLTNGLFFTMFF  58

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLLVRWREKIRNSTPLH+VT SELAA+ SLIASVIYLLGFFGIGFVQSF+ R+N +
Sbjct  59   SVMYFLLVRWREKIRNSTPLHMVTFSELAAMVSLIASVIYLLGFFGIGFVQSFVSRSNSD  118

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD ED + EQ+++EEDSRRG C
Sbjct  119  SWDVEDENTEQFIIEEDSRRGPC  141



>ref|XP_004232593.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Solanum lycopersicum]
Length=601

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 112/143 (78%), Gaps = 7/143 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K LC     SA      +  KQQ   VSSPKASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRPVKPLCTSKDASAG-----EPLKQQQ--VSSPKASDALPLPLYLTNGLFFTMFF  53

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLLVRWREKIRNS PLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQSF+ R+N +
Sbjct  54   SVMYFLLVRWREKIRNSIPLHVVTLSELLAMVSLIASVIYLLGFFGIGFVQSFVSRSNSD  113

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD ED + EQ ++EEDSRRG C
Sbjct  114  SWDIEDENAEQLIIEEDSRRGPC  136



>gb|AEX26934.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Solanum chacoense]
Length=601

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 111/143 (78%), Gaps = 7/143 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K L      SA      +  KQQ   VSSPKASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRPVKPLYTSKDASAG-----EPLKQQE--VSSPKASDALPLPLYLTNGLFFTMFF  53

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLLVRWREKIRNS PLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQSF+ R+N +
Sbjct  54   SVMYFLLVRWREKIRNSIPLHVVTLSELLAMVSLIASVIYLLGFFGIGFVQSFVSRSNSD  113

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD ED + EQ ++EEDSRRG C
Sbjct  114  SWDIEDENTEQLIIEEDSRRGPC  136



>ref|NP_001275084.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like [Solanum 
tuberosum]
 gb|AEX26933.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Solanum tuberosum]
Length=601

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 111/143 (78%), Gaps = 7/143 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K L      SA      +  KQQ   VSSPKASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRPVKPLYTSKDASAG-----EPLKQQE--VSSPKASDALPLPLYLTNGLFFTMFF  53

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLLVRWREKIRNS PLHVVTLSEL A+ SLIASV+YLLGFFGIGFVQSF+ R+N +
Sbjct  54   SVMYFLLVRWREKIRNSIPLHVVTLSELLAMVSLIASVVYLLGFFGIGFVQSFVSRSNSD  113

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD ED + EQ ++EEDSRRG C
Sbjct  114  SWDIEDENAEQLIIEEDSRRGPC  136



>ref|NP_001275461.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Solanum tuberosum]
 sp|P48020.1|HMDH1_SOLTU RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
1; Short=HMG-CoA reductase 1; Short=HMGR; Short=HMGR1 [Solanum 
tuberosum]
 gb|AAA93498.1| hydroxymethylglutaryl coenzyme A reductase [Solanum tuberosum]
Length=596

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 111/143 (78%), Gaps = 7/143 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K L      SA      +  KQQ   VSSPKASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRPVKPLYTSKDASAG-----EPLKQQE--VSSPKASDALPLPLYLTNGLFFTMFF  53

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLLVRWREKIRNS PLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQSF+ R+N +
Sbjct  54   SVMYFLLVRWREKIRNSIPLHVVTLSELLAMVSLIASVIYLLGFFGIGFVQSFVSRSNSD  113

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD ED + EQ ++EEDSRRG C
Sbjct  114  SWDIEDENAEQLIIEEDSRRGPC  136



>gb|AAQ12265.1| hydroxy methyl glutaryl coenzyme A [Solanum melongena]
Length=185

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 113/145 (78%), Gaps = 6/145 (4%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQ--YLLVSSPKASDALPLPLYLTNGLFFTM  234
            MDVRRR S++   P+K  AA  + +K HK+    LL+    ASDALPLPLYLTNGLFFTM
Sbjct  1    MDVRRR-SEKAVYPSKVFAADEKPLKPHKEDNDTLLID---ASDALPLPLYLTNGLFFTM  56

Query  235  XFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRAN  414
             F+VMYFLL RWREKIRNS PLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQSF+ R N
Sbjct  57   FFSVMYFLLSRWREKIRNSIPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQSFVSRGN  116

Query  415  QEGWDGEDXSNEQYLLEEDSRRGAC  489
             + WD ED ++E++LL+EDSR G  
Sbjct  117  NDSWDVEDENDEEFLLKEDSRSGPA  141



>ref|XP_006364832.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Solanum tuberosum]
Length=600

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 110/143 (77%), Gaps = 8/143 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K L      SA      +  KQ+   VSSPKASDALPLPLYLT GLFFTM F
Sbjct  1    MDVRRRPVKPLYTSKDASAG-----EPLKQE---VSSPKASDALPLPLYLTTGLFFTMFF  52

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLLVRWREKIRNS PLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQSF+ R+N +
Sbjct  53   SVMYFLLVRWREKIRNSIPLHVVTLSELLAMVSLIASVIYLLGFFGIGFVQSFVSRSNSD  112

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD ED + EQ ++EEDSRRG C
Sbjct  113  SWDIEDENAEQLIIEEDSRRGPC  135



>sp|Q9XEL8.1|HMDH2_CAPAN RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
2; Short=HMG-CoA reductase 2 [Capsicum annuum]
 gb|AAD28179.1|AF110383_1 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Capsicum annuum]
Length=604

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 115/148 (78%), Gaps = 9/148 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQ-----YLLVSSPKASDALPLPLYLTNGLF  225
            MDVRRR S++    +K  AA  + +K HKQQ      LL+    ASDALPLPLY TNGLF
Sbjct  1    MDVRRR-SEEAVYSSKVFAADEKPLKPHKQQQEEDNTLLID---ASDALPLPLYFTNGLF  56

Query  226  FTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLY  405
            FTM F+VMYFLL RWREKIRNSTPLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQ+F+ 
Sbjct  57   FTMFFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFVA  116

Query  406  RANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            R N + WD ED ++EQ++LEEDSRRG C
Sbjct  117  RGNNDSWDEEDENDEQFILEEDSRRGPC  144



>gb|ADN39417.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Withania somnifera]
Length=599

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 114/143 (80%), Gaps = 7/143 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQ---YLLVSSPKASDALPLPLYLTNGLFFT  231
            MDVRRR S++   P++  AA  + +K HKQQ    LL+    ASDALPLPLYLTNGLFFT
Sbjct  1    MDVRRR-SEKAVYPSEVFAADEKPLKPHKQQEDNTLLID---ASDALPLPLYLTNGLFFT  56

Query  232  MXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRA  411
            M F+VMYFLL RWREKIRNSTPLHVVTLSEL A+  LIASVIYLLGFFGIGFVQ+F+ R 
Sbjct  57   MFFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVLLIASVIYLLGFFGIGFVQTFVSRV  116

Query  412  NQEGWDGEDXSNEQYLLEEDSRR  480
            N + WD ED ++EQ++LEEDSRR
Sbjct  117  NNDSWDVEDENDEQFILEEDSRR  139



>dbj|BAJ51945.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Nicotiana benthamiana]
Length=410

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 111/147 (76%), Gaps = 11/147 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQY-----LLVSSPKASDALPLPLYLTNGLF  225
            MDVRRR S +   P K  AA  E  K HKQQ      LL+    ASDALPLPLYLTNGLF
Sbjct  1    MDVRRR-SDKPAYPAKEFAAGEEPFKPHKQQQEQDNSLLI----ASDALPLPLYLTNGLF  55

Query  226  FTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLY  405
            FTM F VMY+LL RWREKIRNSTPLHVVT SEL A+ SLIASVIYLLGFFGIGFVQSF+ 
Sbjct  56   FTMFFYVMYYLLSRWREKIRNSTPLHVVTFSELVAIVSLIASVIYLLGFFGIGFVQSFVS  115

Query  406  RANQ-EGWDGEDXSNEQYLLEEDSRRG  483
            R N  + WD ED ++EQYLLEEDSRRG
Sbjct  116  RDNNDDSWDVEDENDEQYLLEEDSRRG  142



>ref|NP_001289522.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Nicotiana sylvestris]
 sp|Q01559.1|HMDH_NICSY RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase; 
Short=HMG-CoA reductase [Nicotiana sylvestris]
 emb|CAA45181.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Nicotiana sylvestris]
Length=604

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 115/147 (78%), Gaps = 11/147 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQY-----LLVSSPKASDALPLPLYLTNGLF  225
            MDVRRR S++   P K  AA  + +K HKQQ      LL+    ASDALPLPLYLTNGLF
Sbjct  1    MDVRRR-SEKPAYPTKEFAAGEKPLKPHKQQQEQDNSLLI----ASDALPLPLYLTNGLF  55

Query  226  FTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLY  405
            FTM F+VMY+LL RWREKIRNSTPLHVVT SEL A+ASLIASVIYLLGFFGIGFVQSF+ 
Sbjct  56   FTMFFSVMYYLLSRWREKIRNSTPLHVVTFSELVAIASLIASVIYLLGFFGIGFVQSFVS  115

Query  406  RANQ-EGWDGEDXSNEQYLLEEDSRRG  483
            R N  E WD ED ++EQ+LLEEDSRRG
Sbjct  116  RDNNDECWDEEDENDEQFLLEEDSRRG  142



>gb|AAL54879.1|AF004233_1 hydroxy-methyl-glutaryl-coenzyme A reductase [Nicotiana tabacum]
Length=604

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 115/147 (78%), Gaps = 11/147 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQY-----LLVSSPKASDALPLPLYLTNGLF  225
            MDVRRR S++   P K  AA  + +K HKQQ      LL+    ASDALPLPLYLTNGLF
Sbjct  1    MDVRRR-SEKPAYPTKEFAAGEKPLKPHKQQQEQDNSLLI----ASDALPLPLYLTNGLF  55

Query  226  FTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLY  405
            FTM F+VMY+LL RWREKIRNSTPLHVVT SEL A+ASLIASVIYLLGFFGIGFVQSF+ 
Sbjct  56   FTMFFSVMYYLLSRWREKIRNSTPLHVVTFSELVAIASLIASVIYLLGFFGIGFVQSFVS  115

Query  406  RANQ-EGWDGEDXSNEQYLLEEDSRRG  483
            R N  E WD ED ++EQ+LLEEDSRRG
Sbjct  116  RDNNDECWDVEDENDEQFLLEEDSRRG  142



>gb|AAL54878.1|AF004232_1 hydroxy-methyl-glutaryl-coenzyme A reductase [Nicotiana tabacum]
Length=604

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 114/147 (78%), Gaps = 11/147 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQY-----LLVSSPKASDALPLPLYLTNGLF  225
            MDVRRR S++   P K  AA  + +K HKQQ      LL+    ASDALPLPLYLTNGLF
Sbjct  1    MDVRRR-SEKPAYPTKEFAAGEKPLKPHKQQQQQDNSLLI----ASDALPLPLYLTNGLF  55

Query  226  FTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLY  405
            FTM F+VMY+LL RWREKIRNSTPLHVVT SEL A+ SLIASVIYLLGFFGIGFVQSF+ 
Sbjct  56   FTMFFSVMYYLLSRWREKIRNSTPLHVVTFSELVAIVSLIASVIYLLGFFGIGFVQSFVS  115

Query  406  RANQ-EGWDGEDXSNEQYLLEEDSRRG  483
            R N  + WD ED ++EQ+LLEEDSRRG
Sbjct  116  RDNNDDSWDVEDENDEQFLLEEDSRRG  142



>gb|AAO85554.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Nicotiana attenuata]
Length=604

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 112/147 (76%), Gaps = 11/147 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQY-----LLVSSPKASDALPLPLYLTNGLF  225
            MDVRRR S +   P K   A  + +K HKQQ      LL+    ASDALPLPLYLTNGLF
Sbjct  1    MDVRRR-SDKPAYPTKEFTAGEKPLKPHKQQQEQDNSLLI----ASDALPLPLYLTNGLF  55

Query  226  FTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLY  405
            FTM F+VMY+LL RWREKIRNSTPLHVVT SEL A+ SLIASVIYLLGFFGIGFVQSF+ 
Sbjct  56   FTMFFSVMYYLLSRWREKIRNSTPLHVVTFSELVAIISLIASVIYLLGFFGIGFVQSFVS  115

Query  406  RANQ-EGWDGEDXSNEQYLLEEDSRRG  483
            R N  + WD ED ++EQ+LLEEDSRRG
Sbjct  116  RDNNDDSWDVEDENDEQFLLEEDSRRG  142



>gb|AAB69727.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camptotheca 
acuminata]
Length=589

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 115/143 (80%), Gaps = 5/143 (3%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR +K L RP K +AAA E +K H Q +   SS KASDALPLPLYLTNG+FFT+ F
Sbjct  1    MDVRRRPTKSL-RPAK-TAAAGEPLKPHHQNH---SSLKASDALPLPLYLTNGVFFTLFF  55

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V YFLL RWREKIR STPLH+VT+SELAAL SLIASVIYLLGFFGI FVQSF+ RA+ +
Sbjct  56   SVAYFLLHRWREKIRTSTPLHIVTVSELAALISLIASVIYLLGFFGIDFVQSFITRASHD  115

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD E  ++++++LEEDSR G C
Sbjct  116  SWDVEYDNDDRFILEEDSRPGPC  138



>ref|XP_009601069.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Nicotiana 
tomentosiformis]
Length=605

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 112/148 (76%), Gaps = 12/148 (8%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHK------QQYLLVSSPKASDALPLPLYLTNGL  222
            MDVRRR S++   P K  AA  + +K HK         LL+    ASDALPLPLYLTNGL
Sbjct  1    MDVRRR-SEKPAYPTKEFAAGEKPLKPHKQQQQQQDNSLLI----ASDALPLPLYLTNGL  55

Query  223  FFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFL  402
            FFTM F+VMY+LL RWREKIRNSTPLHVVT SEL A+ SLIASVIYLLGFFGIGFVQSF+
Sbjct  56   FFTMFFSVMYYLLSRWREKIRNSTPLHVVTFSELVAIVSLIASVIYLLGFFGIGFVQSFV  115

Query  403  YRANQ-EGWDGEDXSNEQYLLEEDSRRG  483
             R N  + WD ED ++EQ+LLEEDSRRG
Sbjct  116  SRDNNDDSWDVEDENDEQFLLEEDSRRG  143



>emb|CDP01752.1| unnamed protein product [Coffea canephora]
Length=604

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 109/145 (75%), Gaps = 4/145 (3%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSP--KASDALPLPLYLTNGLFFTM  234
            MDVRRR +  + R  + + A  + IK HK        P  KASDALPLPL+LTNGLFFT+
Sbjct  1    MDVRRRPANPILR--EKADAGEQLIKPHKSHQHQQQQPPMKASDALPLPLHLTNGLFFTI  58

Query  235  XFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRAN  414
             F+VMYFLL RWREKIRNS PLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQ+ + R N
Sbjct  59   FFSVMYFLLSRWREKIRNSIPLHVVTLSELVAVLSLIASVIYLLGFFGIGFVQTLISRPN  118

Query  415  QEGWDGEDXSNEQYLLEEDSRRGAC  489
             +GWD ED + EQ+LL+EDSR G C
Sbjct  119  PDGWDVEDENTEQFLLQEDSRSGTC  143



>gb|ADR51242.1| 3-hydroxy-3-methylglutaryl-CoA reductase, partial [Coffea arabica]
Length=604

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 102/143 (71%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR +  + R    +           Q        KASDALPLPL+LTNGLFFT+ F
Sbjct  1    MDVRRRPANPILREKADAGEQLIKPHKSHQHQQQHPPMKASDALPLPLHLTNGLFFTIFF  60

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLL RWREKIRNS PLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQ+ + R N +
Sbjct  61   SVMYFLLSRWREKIRNSIPLHVVTLSELVAVLSLIASVIYLLGFFGIGFVQTLISRPNPD  120

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
            GWD ED + EQ+LL+EDSR G C
Sbjct  121  GWDVEDENTEQFLLQEDSRSGTC  143



>dbj|BAB20771.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Solanum tuberosum]
Length=595

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 111/147 (76%), Gaps = 13/147 (9%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQ------YLLVSSPKASDALPLPLYLTNGL  222
            MDVRRR S++   P+K  AA  + +K HK Q       LL+    ASDALPLPLYLTNGL
Sbjct  1    MDVRRR-SEKPVYPSKVFAADEKPLKPHKNQQQEDNNTLLID---ASDALPLPLYLTNGL  56

Query  223  FFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFL  402
            FFTM F+VMYFLL RWREKIRNSTPLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQ+F+
Sbjct  57   FFTMFFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFV  116

Query  403  YRANQEGWDGEDXSNEQYLLEEDSRRG  483
             R N + WD  D   E++LL+EDSR G
Sbjct  117  SRGNNDSWDEND---EEFLLKEDSRCG  140



>ref|XP_006350440.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 
[Solanum tuberosum]
Length=596

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 111/147 (76%), Gaps = 13/147 (9%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQ------YLLVSSPKASDALPLPLYLTNGL  222
            MDVRRR S++   P+K  AA  + +K HK Q       LL+    ASDALPLPLYLTNGL
Sbjct  1    MDVRRR-SEKPVYPSKVFAADEKPLKPHKNQQQEDNNTLLID---ASDALPLPLYLTNGL  56

Query  223  FFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFL  402
            FFTM F+VMYFLL RWREKIRNSTPLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQ+F+
Sbjct  57   FFTMFFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFV  116

Query  403  YRANQEGWDGEDXSNEQYLLEEDSRRG  483
             R N + WD  D   E++LL+EDSR G
Sbjct  117  SRGNNDSWDEND---EEFLLKEDSRCG  140



>ref|NP_001275402.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Solanum tuberosum]
 sp|Q41437.1|HMDH2_SOLTU RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
2; Short=HMG-CoA reductase 2; AltName: Full=HMG2.2 [Solanum 
tuberosum]
 gb|AAB52551.1| HMG-CoA reductase [Solanum tuberosum]
Length=595

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 109/147 (74%), Gaps = 13/147 (9%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQ------YLLVSSPKASDALPLPLYLTNGL  222
            MDVRRR S++   P+K   A  + +K H  Q       LL+    ASDALPLPLYLTNGL
Sbjct  1    MDVRRR-SEKPVYPSKVFGADEKPLKPHNNQQQEDNNTLLI---DASDALPLPLYLTNGL  56

Query  223  FFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFL  402
            FFTM F+VMYFLL RWREKIRNSTPLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQ+F+
Sbjct  57   FFTMFFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFV  116

Query  403  YRANQEGWDGEDXSNEQYLLEEDSRRG  483
             R N + WD  D   E++LL+EDSR G
Sbjct  117  SRGNNDSWDEND---EEFLLKEDSRCG  140



>gb|AAB69726.1| 3-hydroxy-3-methylglutaryl coenzyme a reductase [Camptotheca 
acuminata]
Length=575

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 105/143 (73%), Gaps = 8/143 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR   +  RP K S A  E +K H     L  SP  SDALPLPLYLTNG+FF + F
Sbjct  1    MDVRRRHHLKSLRPEKTSTAG-EPLKPH-----LHHSP--SDALPLPLYLTNGVFFALFF  52

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            TV+YFLL RWREKIR STPLH+VTLSELAA+ SL AS+IYLLGFFGI FVQSF+ R++ +
Sbjct  53   TVVYFLLHRWREKIRTSTPLHIVTLSELAAVVSLFASLIYLLGFFGIDFVQSFISRSSHD  112

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD ED + E  +++EDS RG C
Sbjct  113  AWDLEDDTTEHLIIKEDSHRGPC  135



>ref|XP_004231636.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 
[Solanum lycopersicum]
 gb|AAB62581.1| 3-hydroxy-3-methylglutaryl CoA reductase 2 [Solanum lycopersicum]
Length=601

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 110/149 (74%), Gaps = 15/149 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAH--------KQQYLLVSSPKASDALPLPLYLTN  216
            MDVRRR S++   P+K  AA  + +K H         +  LL+    ASDALPLPLYLTN
Sbjct  1    MDVRRR-SEEPVYPSKVFAADEKPLKPHKKQQQQQEDKNTLLID---ASDALPLPLYLTN  56

Query  217  GLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQS  396
            GLFFTM F+VMYFLL RWREKIRNSTPLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQ+
Sbjct  57   GLFFTMFFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQT  116

Query  397  FLYRANQEGWDGEDXSNEQYLLEEDSRRG  483
            F+ R N + WD  D   E++LL+EDSR G
Sbjct  117  FVSRGNNDSWDEND---EEFLLKEDSRCG  142



>sp|P48022.1|HMDH2_SOLLC RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
2; Short=HMG-CoA reductase 2 [Solanum lycopersicum]
 gb|AAA34169.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Solanum lycopersicum]
Length=602

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 110/150 (73%), Gaps = 16/150 (11%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAH--------KQQYLLVSSPKASDALPLPLYLT-  213
            MDVRRR S++   P+K  AA  + +K H         +  LL+    ASDALPLPLYLT 
Sbjct  1    MDVRRR-SEEPVYPSKVFAADEKPLKPHKKQQQQQEDKNTLLI---DASDALPLPLYLTT  56

Query  214  NGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQ  393
            NGLFFTM F+VMYFLL RWREKIRNSTPLHVVTLSEL A+ SLIASVIYLLGFFGIGFVQ
Sbjct  57   NGLFFTMFFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQ  116

Query  394  SFLYRANQEGWDGEDXSNEQYLLEEDSRRG  483
            +F+ R N + WD  D   E++LL+EDSR G
Sbjct  117  TFVSRGNNDSWDEND---EEFLLKEDSRCG  143



>gb|AIY26014.1| HMGR [Jasminum sambac]
Length=594

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 107/144 (74%), Gaps = 9/144 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR + ++ + +K +A        H          KASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRRAAKIPQSDKIAAGELPMKPHHHHHP------KASDALPLPLYLTNGLFFTMFF  54

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLL RWREKIRNSTPLHVVTLSELAAL SL AS+IYLLGFFGI FVQS +YR+N++
Sbjct  55   SVMYFLLTRWREKIRNSTPLHVVTLSELAALVSLFASIIYLLGFFGIDFVQSVIYRSNED  114

Query  421  GWD---GEDXSNEQYLLEEDSRRG  483
             WD    E+  N+++++EEDSR G
Sbjct  115  AWDVEEEEEEENDKFIIEEDSRMG  138



>ref|NP_001274940.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 [Solanum tuberosum]
 sp|Q41438.1|HMDH3_SOLTU RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
3; Short=HMG-CoA reductase 3; AltName: Full=HMG3.3 [Solanum 
tuberosum]
 gb|AAB52552.1| HMG-CoA reductase [Solanum tuberosum]
 dbj|BAA93631.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Solanum tuberosum]
Length=574

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 97/133 (73%), Gaps = 6/133 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K L      S+   E +K H Q     SS KASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRPVKPLYPSEHISSG--EPLKPHNQD----SSVKASDALPLPLYLTNGLFFTMFF  54

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLL RWREKIRN  PLHV+  SEL A+ SLIASVIYLLGFFGIGFVQSF+ + N +
Sbjct  55   SVMYFLLHRWREKIRNGIPLHVLNFSELVAMVSLIASVIYLLGFFGIGFVQSFVSKGNND  114

Query  421  GWDGEDXSNEQYL  459
             WD ED S EQ++
Sbjct  115  SWDVEDESPEQFI  127



>ref|XP_004234589.2| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 
[Solanum lycopersicum]
Length=574

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 97/133 (73%), Gaps = 6/133 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K L      S+   E ++ H Q     SS KASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRAVKPLDASKHISSG--EPLRPHNQD----SSVKASDALPLPLYLTNGLFFTMFF  54

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLL RWREKIRN  PLHV+  SEL A+ SLIASVIYLLGFFGIGFVQSF+ + N +
Sbjct  55   SVMYFLLHRWREKIRNGIPLHVLNFSELVAIFSLIASVIYLLGFFGIGFVQSFVSKGNND  114

Query  421  GWDGEDXSNEQYL  459
             WD ED + EQ++
Sbjct  115  SWDVEDETPEQFI  127



>ref|XP_010270571.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Nelumbo nucifera]
Length=605

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            +P+ASDALPLPLYLTNG+FFT+ F+V Y+LL RWR+KIR STPLHVVTLSE+AA+ SLIA
Sbjct  41   TPQASDALPLPLYLTNGIFFTLFFSVAYYLLHRWRDKIRTSTPLHVVTLSEIAAIVSLIA  100

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXS-NEQYLLEEDSRRGAC  489
            S IYLLGFFGI FVQSF+ RA+ + WD +D + +EQ+LLEED RRG C
Sbjct  101  SFIYLLGFFGIDFVQSFITRASHDAWDVDDENEHEQFLLEEDRRRGPC  148



>gb|AIX87980.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax ginseng]
Length=594

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 104/143 (73%), Gaps = 11/143 (8%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K L   +  +A A E  K+ +Q       PKASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRPVKSLS--SAKTATAGEPPKSQQQH------PKASDALPLPLYLTNGLFFTMFF  52

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLL RWREKIRNSTPLHVVTLSELAAL  L+ASVIYLLGFFGIGFV+S + R + +
Sbjct  53   SVMYFLLHRWREKIRNSTPLHVVTLSELAALVLLMASVIYLLGFFGIGFVRSVI-RPSPD  111

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD  +  N   + EEDSRR  C
Sbjct  112  AWDILEDDNA--INEEDSRREPC  132



>gb|AHI58914.1| 3-hydroxy-3-methylgutary coenzyme A reductase, partial [Centella 
asiatica]
Length=259

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 103/144 (72%), Gaps = 15/144 (10%)
 Frame = +1

Query  61   MDVRRR-LSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMX  237
            MDVRRR ++K L         A E +K+  Q     SS KASDALPLPLYLTNGLFFTM 
Sbjct  1    MDVRRRSVTKTL--------TAGEPLKSQNQHS---SSLKASDALPLPLYLTNGLFFTMF  49

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F+VMYFLL RWREKIRNS PLHVVTLSELAAL  L+ASVIYLLGFFGIGFVQS L R + 
Sbjct  50   FSVMYFLLHRWREKIRNSVPLHVVTLSELAALVLLVASVIYLLGFFGIGFVQS-LIRPSP  108

Query  418  EGWDGEDXSNEQYLLEEDSRRGAC  489
            + WD  +  N   +LEEDSR   C
Sbjct  109  DSWDILEDDNA--ILEEDSRCEPC  130



>gb|AAV54051.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Eucommia ulmoides]
Length=590

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 92/106 (87%), Gaps = 2/106 (2%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYLTNG+FFT+ F+V Y+LL RWR+KIRNSTPLHV+TLSELAA+ SLIAS
Sbjct  39   PKASDALPLPLYLTNGIFFTLFFSVAYYLLHRWRDKIRNSTPLHVLTLSELAAIVSLIAS  98

Query  352  viyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
             IYLLGFFGI FVQSF+ RA+ + WD +D  +E+++LEED RRG C
Sbjct  99   FIYLLGFFGIDFVQSFIARASHDPWDVDD--DERFILEEDRRRGPC  142



>ref|XP_010266284.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Nelumbo nucifera]
Length=608

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 104/152 (68%), Gaps = 11/152 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETI---------KAHKQQYLLVSSPKASDALPLPLYLT  213
            MDVRRR +K   RP   + +              KA          P+ASDALPLPLYLT
Sbjct  1    MDVRRRHTKPP-RPAITAPSGPHRQQQQQHHKHSKAVDHAAPPTPHPQASDALPLPLYLT  59

Query  214  NGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQ  393
            NG+FFT+ F+V YFLL RWR+KIR STPLHVVTLSE+AA+ SLIAS IYLLGFFGI FVQ
Sbjct  60   NGIFFTLFFSVAYFLLHRWRDKIRTSTPLHVVTLSEIAAIVSLIASFIYLLGFFGIDFVQ  119

Query  394  SFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            SF+ RA+ + WD +D  NEQ+L+E+D R G C
Sbjct  120  SFITRASHDAWDVDD-ENEQFLIEDDRRCGPC  150



>gb|AAT52222.1| hydroxymethylglutaryl-CoA reductase [Catharanthus roseus]
Length=601

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 103/142 (73%), Gaps = 10/142 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACE-TIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMX  237
            MD RRR      +     AAA E  +  H+ Q    S P++SD LPLPLYL NG+FFT+ 
Sbjct  1    MDSRRRSPTVTAK-----AAAGELPLAPHEGQNQQPSIPRSSDVLPLPLYLANGVFFTLF  55

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F+VMYFLL RWREKIRN+TPLHVVTLSELAALASLIASVIYL+GFFG+ FVQS +Y+ N 
Sbjct  56   FSVMYFLLTRWREKIRNATPLHVVTLSELAALASLIASVIYLVGFFGLDFVQSLIYKPNN  115

Query  418  EGWDGEDXSNEQYLLEEDSRRG  483
            EGW+ E    E+ L+ EDSR G
Sbjct  116  EGWEIE----EEILMVEDSRNG  133



>gb|AGL08682.1| HMGR2 [Panax ginseng]
Length=589

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 101/143 (71%), Gaps = 13/143 (9%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR       P   +  A E +K+  Q     SS KASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRR-------PVTKTLTAGEPLKSQNQHS---SSLKASDALPLPLYLTNGLFFTMFF  50

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLL RWREKIRNS PLHVVTLSELAAL  L+ASVIYLLGFFGIGFVQS L R + +
Sbjct  51   SVMYFLLHRWREKIRNSVPLHVVTLSELAALVLLVASVIYLLGFFGIGFVQS-LIRPSPD  109

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD  +  N   +LEEDSR   C
Sbjct  110  SWDILEDDNA--ILEEDSRCEPC  130



>ref|XP_002275827.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Vitis vinifera]
Length=593

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            +PKASDALPLPLYLTNG+FFT+ F+V Y+LL RWR+KIR  TPLHVVTLSE+AA+ SLIA
Sbjct  41   TPKASDALPLPLYLTNGIFFTLFFSVAYYLLHRWRDKIRTHTPLHVVTLSEIAAIVSLIA  100

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            S IYLLGFFGI FVQSF+ RA+ + WD +D +   ++++ED RRG C
Sbjct  101  SFIYLLGFFGIDFVQSFISRASHDAWDVDDDAPNHFIIDEDRRRGPC  147



>ref|XP_009785805.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Nicotiana sylvestris]
Length=589

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 103/145 (71%), Gaps = 16/145 (11%)
 Frame = +1

Query  61   MDVRRRLSKQLCR-------PNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNG  219
            MDVRRR  K   R       P + S+AA     +         +PKASDALPLPLYLTNG
Sbjct  1    MDVRRRPPKPSHRNHHLQHHPQRASSAALRRSPS--------PAPKASDALPLPLYLTNG  52

Query  220  LFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
            +FFT+ F+V Y+LL RWR+KIRNSTPLHVVTLSELAA+ SLIAS IYLLGFFGI FVQSF
Sbjct  53   IFFTLFFSVAYYLLHRWRDKIRNSTPLHVVTLSELAAILSLIASFIYLLGFFGIDFVQSF  112

Query  400  LYRANQEGWDGED-XSNEQYLLEED  471
            + RA+ + WD ED   N ++LL+ED
Sbjct  113  IARASHDAWDIEDEEENSRFLLDED  137



>ref|XP_006342182.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Solanum tuberosum]
Length=583

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 103/150 (69%), Gaps = 15/150 (10%)
 Frame = +1

Query  61   MDVRRRLSKQ-------LCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNG  219
            MD+RRR  K        L +P K S+AA     +         +PKASDALPLPLYLTN 
Sbjct  1    MDLRRRPPKPSHRNHHLLKQPQKSSSAAIRRSPS--------PAPKASDALPLPLYLTNA  52

Query  220  LFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
            +FFT+ F+V Y+LL RWR+KIR+STPLHVVTLSELAA+ SLIAS IYLLGFFGI FVQSF
Sbjct  53   IFFTLFFSVAYYLLHRWRDKIRSSTPLHVVTLSELAAILSLIASFIYLLGFFGIDFVQSF  112

Query  400  LYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            + RA+ + WD ED    ++LL +D R   C
Sbjct  113  IARASHDAWDIEDEDETRFLLNQDRRPATC  142



>ref|XP_009588198.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Nicotiana tomentosiformis]
Length=589

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 103/145 (71%), Gaps = 16/145 (11%)
 Frame = +1

Query  61   MDVRRRLSKQLCR-------PNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNG  219
            MDVRRR  K   R       P + S+AA     +         +PKASDALPLPLYLTNG
Sbjct  1    MDVRRRPPKPSHRNHHLQHHPQRASSAALRRSPS--------PAPKASDALPLPLYLTNG  52

Query  220  LFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
            +FFT+ F+V Y+LL RWR+KIRNSTPLHVVTLSELAA+ SLIAS IYLLGFFGI FVQSF
Sbjct  53   IFFTLFFSVAYYLLHRWRDKIRNSTPLHVVTLSELAAILSLIASFIYLLGFFGIDFVQSF  112

Query  400  LYRANQEGWDGED-XSNEQYLLEED  471
            + RA+ + WD ED   N ++LL+ED
Sbjct  113  IARASHDAWDIEDEEENNRFLLDED  137



>ref|XP_010317674.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
[Solanum lycopersicum]
Length=574

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 96/133 (72%), Gaps = 6/133 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K L      S+   E ++   Q     SS KASDALPLPLYLTNGLFFTM F
Sbjct  1    MDVRRRAVKPLDASKHISSG--EPLRPRNQD----SSVKASDALPLPLYLTNGLFFTMFF  54

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLL RWREKIR+  PLHV+  SEL A+ SLIASVIYLLGFFGIGFVQSF+ + N +
Sbjct  55   SVMYFLLHRWREKIRDGIPLHVLNFSELVAMFSLIASVIYLLGFFGIGFVQSFVSKGNND  114

Query  421  GWDGEDXSNEQYL  459
             WD ED + EQ++
Sbjct  115  SWDVEDETPEQFI  127



>gb|AHY03303.1| HMG-CoA reductase 2 [Camellia sinensis]
Length=582

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 3/108 (3%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            SSPKASDALPLPLYLTNG+FFT+ F+V Y+LL RWR+KIR+STPLHVVTLSELAA+ASL+
Sbjct  38   SSPKASDALPLPLYLTNGIFFTLFFSVAYYLLHRWRDKIRSSTPLHVVTLSELAAIASLV  97

Query  346  asviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            AS IYLLGFFGIGFVQSF+ RA+ + WD +D   ++++LEED R   C
Sbjct  98   ASFIYLLGFFGIGFVQSFITRASHDAWDVDD---DRFILEEDRRLLPC  142



>gb|ACV65036.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax quinquefolius]
Length=589

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 103/144 (72%), Gaps = 15/144 (10%)
 Frame = +1

Query  61   MDVRRR-LSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMX  237
            MDVRRR ++K L         A E +K+  Q     SS KASDALPLPLYLTNGLFFTM 
Sbjct  1    MDVRRRSVTKTL--------TAGEPLKSQNQHS---SSLKASDALPLPLYLTNGLFFTMF  49

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F+VMYFLL RWREKIRNS PLHVVTLSELAAL  L+ASVIYLLGFFGIGFVQS L R + 
Sbjct  50   FSVMYFLLHRWREKIRNSVPLHVVTLSELAALVLLVASVIYLLGFFGIGFVQS-LIRPSP  108

Query  418  EGWDGEDXSNEQYLLEEDSRRGAC  489
            + WD  +  N   +LEEDSR   C
Sbjct  109  DSWDILEDDNA--ILEEDSRCEPC  130



>sp|Q03163.1|HMDH_CATRO RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase; 
Short=HMG-CoA reductase [Catharanthus roseus]
 gb|AAA33108.1| hydroxymethylglutaryl-CoA reductase [Catharanthus roseus]
 prf||1909368A hydroxy methylglutaryl CoA reductase [Catharanthus roseus]
Length=601

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 102/142 (72%), Gaps = 10/142 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACE-TIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMX  237
            MD RRR      +     AAA E  +  H+ Q    S P++SD LPLPLYL NG+FFT+ 
Sbjct  1    MDSRRRSPTVTAK-----AAAGELPLAPHEGQNQQPSIPRSSDVLPLPLYLANGVFFTLF  55

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F+VMYFLL RWREKIRN+TPLHVVTLSELAALASLIASVIYL+ FFG+ FVQS +Y+ N 
Sbjct  56   FSVMYFLLTRWREKIRNATPLHVVTLSELAALASLIASVIYLVSFFGLDFVQSLIYKPNN  115

Query  418  EGWDGEDXSNEQYLLEEDSRRG  483
            EGW+ E    E+ L+ EDSR G
Sbjct  116  EGWEIE----EEILMVEDSRNG  133



>gb|AFN89599.1| 3-hydro-3-methylglutary CoA reductase [Gentiana macrophylla]
Length=587

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 98/139 (71%), Gaps = 9/139 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETI-----KAHKQQYLLVSSPKASDALPLPLYLTNGLF  225
            MDVRRR       P   +AAA E +        K Q+      KASDALP PLYL NGLF
Sbjct  1    MDVRRRS----VLPKPINAAAGEQLLKPPTTNQKTQHHHHQQVKASDALPFPLYLANGLF  56

Query  226  FTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLY  405
            FTM F+V+YFLL+RWR KIR+STPLHVVTLSEL A+ SLIASVIYL+GFFGI FVQS +Y
Sbjct  57   FTMFFSVIYFLLIRWRGKIRDSTPLHVVTLSELVAMISLIASVIYLVGFFGIDFVQSLIY  116

Query  406  RANQEGWDGEDXSNEQYLL  462
            + N + WD ED  NEQ+L+
Sbjct  117  KPNHDVWDVEDEQNEQFLV  135



>gb|ADP94147.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Withania somnifera]
Length=575

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 100/143 (70%), Gaps = 9/143 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR      R ++ S++                SPKASDALPLPLYLTNG+FFT+ F
Sbjct  1    MDVRRRPPNPSHRNHQTSSSPV---------LRRSPSPKASDALPLPLYLTNGIFFTLFF  51

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWR+KIR+STPLHVVTLSELAA+ SLIAS IYLLGFFGI FVQSF+ RA+ E
Sbjct  52   SVAYYLLHRWRDKIRSSTPLHVVTLSELAAILSLIASFIYLLGFFGIDFVQSFIARASHE  111

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD E+    + LL+ED R   C
Sbjct  112  AWDMENEDETRLLLDEDRRPTPC  134



>gb|AIK21780.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax notoginseng]
Length=589

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 100/143 (70%), Gaps = 13/143 (9%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR       P   +  A E +K+  Q     S+ KASDA PLPLYLTNGLFFTM F
Sbjct  1    MDVRRR-------PVTKTLTAGEPLKSQNQHS---STLKASDAFPLPLYLTNGLFFTMFF  50

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +VMYFLL RWREKIRNS PLHVVTLSELAAL  L+ASVIYLLGFFGIGFVQS + R + +
Sbjct  51   SVMYFLLHRWREKIRNSVPLHVVTLSELAALVLLVASVIYLLGFFGIGFVQSVI-RPSPD  109

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD     ++  +LEEDSR   C
Sbjct  110  SWD--ILEDDNVILEEDSRCEPC  130



>ref|XP_002301898.1| hydroxymethylglutaryl-CoA reductase family protein [Populus trichocarpa]
 gb|EEE81171.1| hydroxymethylglutaryl-CoA reductase family protein [Populus trichocarpa]
Length=588

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            +PKASDALPLPLYLTN +FFT+ F+V Y+LL RWREKIR+STPLHVVT  E+AA+ SL+A
Sbjct  41   TPKASDALPLPLYLTNAIFFTLFFSVAYYLLHRWREKIRDSTPLHVVTFPEIAAIVSLMA  100

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            S IYLLGFFGI FVQSF+ R + + WD ED  N  YL+ ED R   C
Sbjct  101  SFIYLLGFFGIDFVQSFITRPSHDTWDLEDTDNPNYLINEDHRLVTC  147



>ref|XP_004146762.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
 ref|XP_004170898.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
 gb|KGN47779.1| hypothetical protein Csa_6G401490 [Cucumis sativus]
Length=590

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 6/127 (5%)
 Frame = +1

Query  109  GSAAAC------ETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRW  270
            G AA C      +   A + Q+L  +SPKASDALPLPLYLTN +FFT+ F+V Y+LL RW
Sbjct  18   GGAATCTFSRNEQNASAPEHQHLKTASPKASDALPLPLYLTNTIFFTLFFSVAYYLLHRW  77

Query  271  REKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNE  450
            R+KIRNSTPLHVVTLSE+AA+ SL+AS IYLLGFFGI FVQSF+ R++ + WD ED  + 
Sbjct  78   RDKIRNSTPLHVVTLSEIAAIVSLMASFIYLLGFFGIDFVQSFIARSSSDAWDLEDEIDR  137

Query  451  QYLLEED  471
              L++ +
Sbjct  138  TLLIDNN  144



>dbj|BAE92730.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Gentiana lutea]
Length=586

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 98/139 (71%), Gaps = 8/139 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETI----KAHKQQYLLVSSPKASDALPLPLYLTNGLFF  228
            MDVRRR       P   +AAA E +       K Q       KASDALP PLYL NGLFF
Sbjct  1    MDVRRRP----LMPKPINAAAGELLLKPPSNQKNQSTQQQQVKASDALPFPLYLANGLFF  56

Query  229  TMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYR  408
            TM F+V+YFLL+RWR KIR+STPLHVVTLSEL A+ SLIASVIYL+GFFGI FVQS +Y+
Sbjct  57   TMFFSVIYFLLLRWRGKIRDSTPLHVVTLSELVAMISLIASVIYLVGFFGIDFVQSLIYK  116

Query  409  ANQEGWDGEDXSNEQYLLE  465
             N + WD ED  NEQ+L++
Sbjct  117  PNHDVWDVEDEQNEQFLVQ  135



>gb|AAU08214.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Hevea brasiliensis]
Length=575

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            ++PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLH+VTLSE+ A+ SLI
Sbjct  22   TTPKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRNSTPLHIVTLSEIVAIVSLI  81

Query  346  asviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            AS IYLLGFFGI FVQSF+ RA+ + WD ED ++  YL++ED R   C
Sbjct  82   ASFIYLLGFFGIDFVQSFIARASHDVWDLED-TDPNYLIDEDHRLVTC  128



>sp|P29057.1|HMDH1_HEVBR RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
1; Short=HMG-CoA reductase 1 [Hevea brasiliensis]
 gb|AAL18929.1|AF429388_1 hydroxymethylglutaryl coenzyme A reductase [Hevea brasiliensis]
 emb|CAA38467.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
 emb|CAA38469.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
 gb|AAQ63055.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hevea brasiliensis]
Length=575

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            ++PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLH+VTLSE+ A+ SLI
Sbjct  22   TTPKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRNSTPLHIVTLSEIVAIVSLI  81

Query  346  asviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            AS IYLLGFFGI FVQSF+ RA+ + WD ED ++  YL++ED R   C
Sbjct  82   ASFIYLLGFFGIDFVQSFIARASHDVWDLED-TDPNYLIDEDHRLVTC  128



>dbj|BAF98282.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
Length=575

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            ++PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLH+VTLSE+ A+ SLI
Sbjct  22   TTPKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRNSTPLHIVTLSEIVAIVSLI  81

Query  346  asviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            AS IYLLGFFGI FVQSF+ RA+ + WD ED ++  YL++ED R   C
Sbjct  82   ASFIYLLGFFGIDFVQSFIARASHDVWDLED-TDPNYLIDEDHRLVTC  128



>gb|ACE80213.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Pyrus pyrifolia]
Length=609

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 101/145 (70%), Gaps = 3/145 (2%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR S       K  +   +     +++ +     KASDALPLPLYLTNG+FFT+ F
Sbjct  1    MDVRRR-STMDTPATKARSGPMKVNVVDQEEEVGAVGAKASDALPLPLYLTNGVFFTLFF  59

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL  WREKIR STPLHVVTLSE+ A+ SL+ASVIYLLGFFGI FVQSF+ R + +
Sbjct  60   SVVYFLLTAWREKIRTSTPLHVVTLSEIVAILSLVASVIYLLGFFGIEFVQSFILRPSND  119

Query  421  GWDG--EDXSNEQYLLEEDSRRGAC  489
                  E+  +E+++LEEDSR G C
Sbjct  120  VCSARCEEEDDERFILEEDSRNGPC  144



>gb|ABK88909.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Atractylodes 
lancea]
Length=583

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 99/145 (68%), Gaps = 12/145 (8%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLV--SSPKASDALPLPLYLTNGLFFTM  234
            MDVRRR  K L            ++K HK   LL     PKA DA PLPLYLTNGLFFT+
Sbjct  1    MDVRRRPVKHLLH---------RSLKQHKSGELLKHQDQPKAIDAFPLPLYLTNGLFFTI  51

Query  235  XFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRAN  414
             F+V+YFLL RWREKIRNSTPLH++T SE+AAL SL+ASVIYLLGFFGI FVQS + R +
Sbjct  52   FFSVIYFLLHRWREKIRNSTPLHLLTFSEMAALVSLLASVIYLLGFFGIDFVQSII-RPS  110

Query  415  QEGWDGEDXSNEQYLLEEDSRRGAC  489
               W  ED + EQ +L+ED+    C
Sbjct  111  PSSWIIEDDNAEQIMLQEDTPVKPC  135



>gb|KDP36739.1| hypothetical protein JCGZ_08030 [Jatropha curcas]
Length=584

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            +PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLH+VTLSE+AA+ SLIA
Sbjct  35   TPKASDALPLPLYLTNAIFFTLFFSVAYYLLHRWRDKIRNSTPLHIVTLSEIAAIVSLIA  94

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            S IYLLGFFGI FVQSF+ RA+ + WD +D ++  YL+ ED R   C
Sbjct  95   SFIYLLGFFGIDFVQSFIARASHDAWDLDD-TDPAYLINEDHRLVTC  140



>ref|XP_011034792.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Populus euphratica]
Length=588

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            +PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIR+STPLHVVT  E+AA+ SL+A
Sbjct  41   TPKASDALPLPLYLTNAIFFTLFFSVAYYLLHRWRDKIRDSTPLHVVTFPEIAAIVSLMA  100

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            S IYLLGFFGI FVQSF+ R + + WD ED  N   L+ ED R   C
Sbjct  101  SFIYLLGFFGIDFVQSFITRPSHDAWDLEDTDNPNCLINEDHRLVTC  147



>ref|XP_002510732.1| hmg-CoA reductase, putative [Ricinus communis]
 gb|EEF52919.1| hmg-CoA reductase, putative [Ricinus communis]
Length=576

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            +PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLHV+TLSE+AA+ SLIA
Sbjct  35   TPKASDALPLPLYLTNAIFFTLFFSVAYYLLHRWRDKIRNSTPLHVLTLSEIAAIVSLIA  94

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            S IYLLGFFGI FVQSF+ RA+ E WD  D ++  YL+ ED R   C
Sbjct  95   SFIYLLGFFGIDFVQSFITRASHESWD-LDGADPDYLIREDHRLVTC  140



>gb|AHB64333.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camellia sinensis]
Length=573

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 12/144 (8%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K    P+  SA   E +K H Q+   V+SPKASDALPLPLY+TNG+FFT+ F
Sbjct  1    MDVRRRNDK----PSPKSAG--EPLKPH-QRNGQVTSPKASDALPLPLYITNGVFFTLFF  53

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLY-RANQ  417
            +V YFLL RWREKIRNS PLH+VTLSELAA+ SLIASVIYLLGFFGI FVQS L  + + 
Sbjct  54   SVAYFLLHRWREKIRNSMPLHIVTLSELAAVISLIASVIYLLGFFGIDFVQSLLTGKPSP  113

Query  418  EGWDGEDXSNEQYLLEEDSRRGAC  489
            + W+ +D      +L++D R   C
Sbjct  114  DSWEDDDL----VILQDDRRTTPC  133



>ref|XP_006390187.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
 gb|ESQ27473.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
Length=431

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 100/149 (67%), Gaps = 6/149 (4%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKG----SAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFF  228
            MD+RRR  K    P+         +  +   H+++  +   PKASDALPLPLYLTN +FF
Sbjct  1    MDIRRRPPKPPVNPDGSYRFQKDRSPSSSDDHRRRTTIAPPPKASDALPLPLYLTNAVFF  60

Query  229  TMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYR  408
            T+ F+V Y+LL RWR+KIR +TPLHVVT++EL AL +LIAS IYLLGFFGI FVQSF+ R
Sbjct  61   TLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGALVALIASFIYLLGFFGIDFVQSFISR  120

Query  409  ANQEGWDGEDX--SNEQYLLEEDSRRGAC  489
            A+ + WD  D   ++  +L+ +D R   C
Sbjct  121  ASGDAWDLADSNDADTNFLINDDHRLVTC  149



>ref|XP_011458111.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Fragaria vesca subsp. vesca]
Length=595

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 97/144 (67%), Gaps = 5/144 (3%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAA-ACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMX  237
            MDVRRR +    RP  G+     + +  H  Q     + KASDALPLPLYLTN +FFT+ 
Sbjct  1    MDVRRRSAGGAGRPVNGAVKMKVKMVDHHHHQN---DAAKASDALPLPLYLTNAVFFTLF  57

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F+V+YFLL RWREKIR STPLH+V LSE+ A+ + +AS IYLLGFFGI FVQS + R + 
Sbjct  58   FSVVYFLLTRWREKIRTSTPLHMVNLSEIVAILAFVASFIYLLGFFGIDFVQSLILRPSN  117

Query  418  EGWDGEDXSNEQYLLEEDSRRGAC  489
            + W  ED  ++  +L+ED+R   C
Sbjct  118  DVWAAEDEEDD-IILKEDARTVPC  140



>ref|XP_008348952.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Malus domestica]
Length=605

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 98/144 (68%), Gaps = 3/144 (2%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR    +  P   + +    +K    +  +V   KASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRR--STMDTPATKARSGPIKVKVVDHENDVVVGAKASDALPLPLYLTNAVFFTLFF  58

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKIR STPLHVV LSE+ A+ + +AS IYLLGFFGI FVQS + R N +
Sbjct  59   SVVYFLLTRWREKIRTSTPLHVVDLSEIVAIVAFVASFIYLLGFFGIDFVQSLILRPNND  118

Query  421  GWDGED-XSNEQYLLEEDSRRGAC  489
             W  +D   +E+ +L++D+R+  C
Sbjct  119  VWAADDEEEHERLILKDDARKVPC  142



>ref|XP_002265638.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Vitis vinifera]
Length=572

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 100/143 (70%), Gaps = 11/143 (8%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR   +  R +  ++A    +K     +L     K SDALPLPLYLTNG+FF + F
Sbjct  1    MDVRRRPPMRSVRQSSTTSAGEPPVK-----HL-----KPSDALPLPLYLTNGIFFALFF  50

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V YFLL RWREKIR STPLHV+TLSE+AA+ S++ASVIYLLGFFG+ FVQS + R + +
Sbjct  51   SVAYFLLHRWREKIRTSTPLHVLTLSEIAAIVSMLASVIYLLGFFGVDFVQSLVTRPSGD  110

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             WD ED  +   +LEEDSR G C
Sbjct  111  VWDAEDEPHGA-ILEEDSRPGPC  132



>gb|AEM42971.1| HMG-CoA reductase [Siraitia grosvenorii]
Length=582

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +1

Query  127  ETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHV  306
            +   A   Q L   SPKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLHV
Sbjct  28   QNASAADHQRLKTPSPKASDALPLPLYLTNTIFFTLFFSVAYYLLHRWRDKIRNSTPLHV  87

Query  307  VTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGA  486
            VTLSE+AA+ SLIAS IYLLGFFGI FVQSF+ R++ + WD +D  ++  L++ +     
Sbjct  88   VTLSEIAAIVSLIASFIYLLGFFGIDFVQSFIARSSPDAWDLDDEIDQTLLIDNNRYAAP  147

Query  487  C  489
            C
Sbjct  148  C  148



>gb|AFZ93642.1| hydroxymethylglutaryl coenzyme A reductase [Euphorbia lathyris]
Length=582

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLHVVTLSE+AA+ SLIAS
Sbjct  32   PKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRNSTPLHVVTLSEIAAIVSLIAS  91

Query  352  viyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
             IYLLGFFGI FVQSF+ RA+ + WD +D ++  YL++ D R   C
Sbjct  92   FIYLLGFFGIDFVQSFIARASHDTWDLDD-ADRNYLIDGDHRLVTC  136



>ref|XP_006390188.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
 gb|ESQ27474.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
Length=594

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 100/149 (67%), Gaps = 6/149 (4%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKG----SAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFF  228
            MD+RRR  K    P+         +  +   H+++  +   PKASDALPLPLYLTN +FF
Sbjct  1    MDIRRRPPKPPVNPDGSYRFQKDRSPSSSDDHRRRTTIAPPPKASDALPLPLYLTNAVFF  60

Query  229  TMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYR  408
            T+ F+V Y+LL RWR+KIR +TPLHVVT++EL AL +LIAS IYLLGFFGI FVQSF+ R
Sbjct  61   TLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGALVALIASFIYLLGFFGIDFVQSFISR  120

Query  409  ANQEGWDGEDX--SNEQYLLEEDSRRGAC  489
            A+ + WD  D   ++  +L+ +D R   C
Sbjct  121  ASGDAWDLADSNDADTNFLINDDHRLVTC  149



>gb|KGN46640.1| hypothetical protein Csa_6G117710 [Cucumis sativus]
Length=665

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 105/155 (68%), Gaps = 10/155 (6%)
 Frame = +1

Query  46   FSPLRMDVRRRLSKQLCR-------PNKGSAAACETIKAHKQQYLLVSSPKASDALPLPL  204
            FS L MD RRR S  L +       P K        +K  ++Q++   + KASD LPLP+
Sbjct  64   FSCLTMDARRRRSSTLVKKLTADEPPVKSMDKNPLKVKMLERQHVHDDAVKASDVLPLPI  123

Query  205  YLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIG  384
            YLTN  FFT+ F+V+YFLL RWREKIR+STPLHVVTLSE+ A+++ IAS IYLLGFFGI 
Sbjct  124  YLTNAAFFTLFFSVVYFLLTRWREKIRSSTPLHVVTLSEMVAISAFIASFIYLLGFFGID  183

Query  385  FVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            FVQS ++R + + W  ED  +E  +++ED+R+  C
Sbjct  184  FVQS-IFRPSHDVWTSED--DEVVIIKEDTRKVPC  215



>gb|AHX36946.1| 3-hydroxy-3-methyl glutaryl coenzyme a reductase [Betula platyphylla]
Length=587

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            S+P+ASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLHVVTLSE+AA+ SLI
Sbjct  46   STPRASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRNSTPLHVVTLSEIAAIVSLI  105

Query  346  asviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGA  486
            AS IYLLGFFGI FVQSF+ RA+ + WD +D  +  +L+++ + R A
Sbjct  106  ASFIYLLGFFGIDFVQSFISRASHDAWDLDDPHHHNFLVDDRTPRIA  152



>ref|XP_006435453.1| hypothetical protein CICLE_v10000761mg [Citrus clementina]
 gb|ESR48693.1| hypothetical protein CICLE_v10000761mg [Citrus clementina]
 gb|KDO85247.1| hypothetical protein CISIN_1g011423mg [Citrus sinensis]
Length=387

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 93/130 (72%), Gaps = 13/130 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR       P K         + +K++     +PKASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRR-------PLKVDD------EVNKEKRPTSPTPKASDALPLPLYLTNAIFFTLFF  47

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWREKIRNSTPLHVVTLSE+AA+ SLIAS IYLLGFFGI FVQSF+ RA  E
Sbjct  48   SVAYYLLHRWREKIRNSTPLHVVTLSEIAAIVSLIASFIYLLGFFGIDFVQSFISRATPE  107

Query  421  GWDGEDXSNE  450
             WD E+  ++
Sbjct  108  AWDLEEDDSD  117



>ref|NP_001284380.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Cucumis melo]
 dbj|BAA36291.1| HMG-CoA reductase [Cucumis melo]
 gb|ACZ50511.1| 3-hydroxy-3-methylglutaryl coenzyme-A reductase [Cucumis melo]
Length=587

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +1

Query  139  AHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTls  318
            A    +L  +SPKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLHVVTLS
Sbjct  31   ASAADHLKRASPKASDALPLPLYLTNTIFFTLFFSVAYYLLHRWRDKIRNSTPLHVVTLS  90

Query  319  elaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEED  471
            E+AA+ SL+AS IYLLGFFGI FVQSF+ R++ + WD ED  +   L++ +
Sbjct  91   EIAAIVSLMASFIYLLGFFGIDFVQSFIARSSPDAWDLEDEIDRTLLIDNN  141



>ref|XP_011041288.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1, 
partial [Populus euphratica]
Length=577

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLHVVT  E+AA+ SL AS
Sbjct  31   PKASDALPLPLYLTNAIFFTLFFSVAYYLLYRWRDKIRNSTPLHVVTFPEIAAIISLTAS  90

Query  352  viyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSR  477
             IYLLGFFGI FVQSF+ R++ + W+ E   N  +L+ +D R
Sbjct  91   FIYLLGFFGIDFVQSFITRSSHDAWELEGSDNPNFLINKDQR  132



>gb|KDO85245.1| hypothetical protein CISIN_1g011423mg [Citrus sinensis]
Length=486

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 92/130 (71%), Gaps = 13/130 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K                + +K++     +PKASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRPLKV-------------DDEVNKEKRPTSPTPKASDALPLPLYLTNAIFFTLFF  47

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWREKIRNSTPLHVVTLSE+AA+ SLIAS IYLLGFFGI FVQSF+ RA  E
Sbjct  48   SVAYYLLHRWREKIRNSTPLHVVTLSEIAAIVSLIASFIYLLGFFGIDFVQSFISRATPE  107

Query  421  GWDGEDXSNE  450
             WD E+  ++
Sbjct  108  AWDLEEDDSD  117



>ref|XP_006473861.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Citrus sinensis]
Length=550

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 92/130 (71%), Gaps = 13/130 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K                + +K++     +PKASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRPLKV-------------DDEVNKEKLPTSPTPKASDALPLPLYLTNAIFFTLFF  47

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWREKIRNSTPLHVVTLSE+AA+ SLIAS IYLLGFFGI FVQSF+ RA  E
Sbjct  48   SVAYYLLHRWREKIRNSTPLHVVTLSEIAAIVSLIASFIYLLGFFGIDFVQSFISRATPE  107

Query  421  GWDGEDXSNE  450
             WD E+  ++
Sbjct  108  AWDLEEDDSD  117



>gb|KDO85246.1| hypothetical protein CISIN_1g011423mg [Citrus sinensis]
Length=474

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 92/130 (71%), Gaps = 13/130 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K                + +K++     +PKASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRPLKV-------------DDEVNKEKRPTSPTPKASDALPLPLYLTNAIFFTLFF  47

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWREKIRNSTPLHVVTLSE+AA+ SLIAS IYLLGFFGI FVQSF+ RA  E
Sbjct  48   SVAYYLLHRWREKIRNSTPLHVVTLSEIAAIVSLIASFIYLLGFFGIDFVQSFISRATPE  107

Query  421  GWDGEDXSNE  450
             WD E+  ++
Sbjct  108  AWDLEEDDSD  117



>gb|KJB14840.1| hypothetical protein B456_002G146000 [Gossypium raimondii]
Length=560

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 91/132 (69%), Gaps = 17/132 (13%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR SK L    K  ++A E   A           KASDALPLPLY TN LFFT+ F
Sbjct  1    MDVRRRPSKALRPAPKEPSSAPEPTGA-----------KASDALPLPLYFTNALFFTLFF  49

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL+RWR+KIRNS PLHVVT SELAA+ SLIAS IYLLGFFGI FVQSF+ RA+ E
Sbjct  50   SVAYYLLLRWRDKIRNSVPLHVVTFSELAAILSLIASFIYLLGFFGIDFVQSFIARASNE  109

Query  421  GWD------GED  438
             WD      GED
Sbjct  110  AWDLVDEEEGED  121



>gb|AET72044.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Dimocarpus 
longan]
Length=564

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 92/126 (73%), Gaps = 10/126 (8%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K    P++ +     T     Q      SPKASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRPPK----PSRVADDEQRTTTPSPQ------SPKASDALPLPLYLTNAIFFTLFF  50

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V YFLL RWR+KIR+STPLHVVTLSE+AA+ SLIAS IYLLGFFGI FVQSF+ RA+ +
Sbjct  51   SVAYFLLHRWRDKIRSSTPLHVVTLSEIAAIVSLIASFIYLLGFFGIDFVQSFISRASND  110

Query  421  GWDGED  438
             WD +D
Sbjct  111  AWDLDD  116



>ref|XP_006435454.1| hypothetical protein CICLE_v10000761mg [Citrus clementina]
 gb|ESR48694.1| hypothetical protein CICLE_v10000761mg [Citrus clementina]
Length=550

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 92/130 (71%), Gaps = 13/130 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K                + +K++     +PKASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRPLKV-------------DDEVNKEKRPTSPTPKASDALPLPLYLTNAIFFTLFF  47

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWREKIRNSTPLHVVTLSE+AA+ SLIAS IYLLGFFGI FVQSF+ RA  E
Sbjct  48   SVAYYLLHRWREKIRNSTPLHVVTLSEIAAIVSLIASFIYLLGFFGIDFVQSFISRATPE  107

Query  421  GWDGEDXSNE  450
             WD E+  ++
Sbjct  108  AWDLEEDDSD  117



>ref|XP_007018657.1| Hydroxy methylglutaryl CoA reductase 1 [Theobroma cacao]
 gb|EOY15882.1| Hydroxy methylglutaryl CoA reductase 1 [Theobroma cacao]
Length=578

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K + RP   +AA     +  + Q    ++PKASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRAYK-VPRP---TAAVIHQEQQQQSQASGSAAPKASDALPLPLYLTNAIFFTLFF  56

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL+RWR+KIRNS PLHVVTL ELAA+ SLIAS IYLLGFFGI FVQSF+ RA+ +
Sbjct  57   SVAYYLLLRWRDKIRNSMPLHVVTLPELAAIVSLIASFIYLLGFFGIDFVQSFIARASND  116

Query  421  GWD  429
             WD
Sbjct  117  AWD  119



>ref|XP_010537243.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Tarenaya hassleriana]
Length=603

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 97/145 (67%), Gaps = 5/145 (3%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVS---SPKASDALPLPLYLTNGLFFT  231
            MDVRRR  K     + G         +  Q     S   +PKASDALPLPLYLTN +FFT
Sbjct  1    MDVRRRPPKPPVTSHTGGFHGFNGSHSPAQDDPRRSPAPTPKASDALPLPLYLTNAVFFT  60

Query  232  MXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRA  411
            + F+V Y+LL RWR+KIR++TPLHVVTLSEL A+ +LIAS IYLLGFFGI FVQSF+ RA
Sbjct  61   LFFSVAYYLLHRWRDKIRSNTPLHVVTLSELGAIVALIASFIYLLGFFGIDFVQSFISRA  120

Query  412  NQEGWDGEDXSN--EQYLLEEDSRR  480
            + +GWD  D  N    +L+ +D  R
Sbjct  121  SGDGWDIADEGNAGSNFLIGDDDHR  145



>ref|XP_008448157.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis melo]
Length=597

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 102/150 (68%), Gaps = 10/150 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCR-------PNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNG  219
            MD RRR S  L +       P K        +K  ++Q++   + KASD LPLP+YLTN 
Sbjct  1    MDARRRRSSTLVKKLPSDEPPVKSMDKNPLKVKMVERQHVHDDAVKASDVLPLPIYLTNA  60

Query  220  LFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
             FFT+ F+V+YFLL RWREKIR+STPLHVVTLSE+ A+++ IAS IYLLGFFGI FVQS 
Sbjct  61   AFFTLFFSVVYFLLTRWREKIRSSTPLHVVTLSEMVAISAFIASFIYLLGFFGIDFVQS-  119

Query  400  LYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            ++R + + W  ED  +E  +++ED+R+  C
Sbjct  120  IFRPSHDVWTSED--DEVVMIKEDTRKVPC  147



>ref|XP_004139979.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
Length=597

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 102/150 (68%), Gaps = 10/150 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCR-------PNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNG  219
            MD RRR S  L +       P K        +K  ++Q++   + KASD LPLP+YLTN 
Sbjct  1    MDARRRRSSTLVKKLTADEPPVKSMDKNPLKVKMLERQHVHDDAVKASDVLPLPIYLTNA  60

Query  220  LFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
             FFT+ F+V+YFLL RWREKIR+STPLHVVTLSE+ A+++ IAS IYLLGFFGI FVQS 
Sbjct  61   AFFTLFFSVVYFLLTRWREKIRSSTPLHVVTLSEMVAISAFIASFIYLLGFFGIDFVQS-  119

Query  400  LYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            ++R + + W  ED  +E  +++ED+R+  C
Sbjct  120  IFRPSHDVWTSED--DEVVIIKEDTRKVPC  147



>gb|AHI85949.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Pyrus communis]
Length=608

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 97/145 (67%), Gaps = 3/145 (2%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR +         S      +  H+    +V + KASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRSTMDTPATKARSGPMKVKVVDHENDVGVVGA-KASDALPLPLYLTNAVFFTLFF  59

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKIR STPLHVV  SE+ A+ + +AS IYLLGFFGI FVQS + R + +
Sbjct  60   SVVYFLLTRWREKIRTSTPLHVVNFSEIVAILAFVASFIYLLGFFGIDFVQSLILRPSSD  119

Query  421  GW--DGEDXSNEQYLLEEDSRRGAC  489
             W  D ++  +E+ +L++D+R+  C
Sbjct  120  VWAADDDEEEHERLILKDDARKVPC  144



>gb|AAK64657.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Malus domestica]
Length=608

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 98/145 (68%), Gaps = 3/145 (2%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR +         S      +  H+    +V + KASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRSTMDTPATKARSGPMKVKVVDHEGDVGVVGA-KASDALPLPLYLTNAVFFTLFF  59

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKIR STPLHVV LSE+ A+ + +AS IYLLGFFGI FVQS + R + +
Sbjct  60   SVVYFLLTRWREKIRTSTPLHVVNLSEIVAILAFVASFIYLLGFFGIDFVQSLILRPSND  119

Query  421  GW--DGEDXSNEQYLLEEDSRRGAC  489
             W  D ++  +E+ +L++D+R+  C
Sbjct  120  VWAADDDEEEHERLILKDDARKVPC  144



>ref|XP_008347553.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Malus domestica]
Length=608

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 98/145 (68%), Gaps = 3/145 (2%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR +         S      +  H+    +V + KASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRSTMDTPATKARSGPMKVKVVDHEGDVGVVGA-KASDALPLPLYLTNAVFFTLFF  59

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKIR STPLHVV LSE+ A+ + +AS IYLLGFFGI FVQS + R + +
Sbjct  60   SVVYFLLTRWREKIRTSTPLHVVNLSEIVAILAFVASFIYLLGFFGIDFVQSLILRPSND  119

Query  421  GW--DGEDXSNEQYLLEEDSRRGAC  489
             W  D ++  +E+ +L++D+R+  C
Sbjct  120  VWAADDDEEEHERLILKDDARKVPC  144



>ref|XP_004154522.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
Length=597

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 102/150 (68%), Gaps = 10/150 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCR-------PNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNG  219
            MD RRR S  L +       P K        +K  ++Q++   + KASD LPLP+YLTN 
Sbjct  1    MDARRRRSSTLVKKLTADEPPLKSMDKNPLKVKMLERQHVHDDAVKASDVLPLPIYLTNA  60

Query  220  LFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
             FFT+ F+V+YFLL RWREKIR+STPLHVVTLSE+ A+++ IAS IYLLGFFGI FVQS 
Sbjct  61   AFFTLFFSVVYFLLTRWREKIRSSTPLHVVTLSEMVAISAFIASFIYLLGFFGIDFVQS-  119

Query  400  LYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            ++R + + W  ED  +E  +++ED+R+  C
Sbjct  120  IFRPSHDVWTSED--DEVVIIKEDTRKVPC  147



>gb|ABP04052.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Corylus avellana]
Length=567

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 99/145 (68%), Gaps = 14/145 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR + +   P K        +   K+       P+ASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRSTNKPTTPMKMGV----VVDDEKE-------PRASDALPLPLYLTNAVFFTLFF  49

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKIRNSTPLHVV LSE+ AL +L+AS IYLLGFFGI FVQS ++R + +
Sbjct  50   SVVYFLLTRWREKIRNSTPLHVVDLSEIVALVALVASFIYLLGFFGIDFVQS-IFRPSAD  108

Query  421  GWDGEDXSN--EQYLLEEDSRRGAC  489
             W  +   N  E+ +L+ED+R+  C
Sbjct  109  VWAADYDKNHAEELILDEDARKVPC  133



>ref|XP_010534322.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Tarenaya hassleriana]
Length=589

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 98/146 (67%), Gaps = 9/146 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNK----GSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFF  228
            MDVRRR  K            S  +  T+  H+       SPKASDALPLPLYLTN +FF
Sbjct  1    MDVRRRSPKPPASDVSFNGFHSNRSPSTVDHHRSPD---PSPKASDALPLPLYLTNAVFF  57

Query  229  TMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYR  408
            T+ F+V Y+LL RWREKIR++TPLHVVTLSEL A+ +LIAS IYLLGFFGI FVQSF+ R
Sbjct  58   TLFFSVAYYLLHRWREKIRSNTPLHVVTLSELGAIVALIASFIYLLGFFGIDFVQSFISR  117

Query  409  ANQEGWDGEDXSNEQ--YLLEEDSRR  480
            A+ E WD  D  + +  +L+ +D  R
Sbjct  118  ASGETWDISDGGDAERSFLIGDDDHR  143



>gb|ABK56831.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Euphorbia pekinensis]
Length=583

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLHVVTLSE+AA+ SLIAS 
Sbjct  34   KASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRNSTPLHVVTLSEIAAIVSLIASF  93

Query  355  iyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            IYLLGFFGIGFVQS + R + + WD +D ++  YL++ D R   C
Sbjct  94   IYLLGFFGIGFVQSLIARPSHDTWDLDD-ADRSYLIDGDHRLVTC  137



>gb|AGW82424.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Corylus avellana]
Length=565

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 99/145 (68%), Gaps = 16/145 (11%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR +      NK +      +   K+       P+ASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRST------NKPTPMKMGVVDDEKE-------PRASDALPLPLYLTNAVFFTLFF  47

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKIRNSTPLHVV LSE+ AL +L+AS IYLLGFFGI FVQS ++R + +
Sbjct  48   SVVYFLLTRWREKIRNSTPLHVVDLSEIVALVALVASFIYLLGFFGIDFVQS-IFRPSAD  106

Query  421  GWDGEDXSN--EQYLLEEDSRRGAC  489
             W  +   N  E+ +L+ED+R+  C
Sbjct  107  VWAADYDKNHAEELILDEDARKVPC  131



>ref|XP_002306999.1| hydroxymethylglutaryl-CoA reductase family protein [Populus trichocarpa]
 gb|EEE93995.1| hydroxymethylglutaryl-CoA reductase family protein [Populus trichocarpa]
Length=563

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            SS  ASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIRNSTPLHVVT  E+AA+ SL+
Sbjct  15   SSQDASDALPLPLYLTNAIFFTLFFSVAYYLLYRWRDKIRNSTPLHVVTFPEIAAIISLM  74

Query  346  asviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            AS IYLLGFFGI FVQSF+ R++ + W+ E   +  +L+ +D R   C
Sbjct  75   ASFIYLLGFFGIDFVQSFITRSSHDAWELEGSDHPNFLINKDHRLVTC  122



>ref|XP_010690585.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Beta vulgaris subsp. vulgaris]
Length=581

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 101/146 (69%), Gaps = 14/146 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR      +P   S A  +  K++++      SPKASDALPLPLYLTNG+F T+ F
Sbjct  1    MDVRRRQ-----QPLSSSPAPMK--KSYRKTIAGEESPKASDALPLPLYLTNGVFLTLFF  53

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKIRNSTPLHVV+LSE+AA+ + +AS IYLLGFFGI FVQSF+   +  
Sbjct  54   SVVYFLLQRWREKIRNSTPLHVVSLSEIAAIVAFLASFIYLLGFFGIDFVQSFISPRSSS  113

Query  421  GWDGEDXS-------NEQYLLEEDSR  477
             +D E+         +++ +L+ED R
Sbjct  114  CYDDEEEEVNDAVSVDDKQILKEDKR  139



>gb|AIM19608.1| 3-hydroxy-3-methyl-glutaryl-CoA reductase, partial [Centella 
asiatica]
Length=595

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 100/146 (68%), Gaps = 15/146 (10%)
 Frame = +1

Query  55   LRMDVRRR-LSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFT  231
            + MDVRRR +++ L         A E +K+  Q     SS KAS ALPLPLYLTNGLFFT
Sbjct  5    IEMDVRRRSVTRTL--------TAGEPLKSQNQHS---SSLKASAALPLPLYLTNGLFFT  53

Query  232  MXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRA  411
            M F+VMYFLL RWREKIRNS PLHV  LSELAAL  L+ASV+YLLGFFGIGFVQS L R 
Sbjct  54   MFFSVMYFLLHRWREKIRNSVPLHVGPLSELAALVLLVASVVYLLGFFGIGFVQS-LIRP  112

Query  412  NQEGWDGEDXSNEQYLLEEDSRRGAC  489
            +   WD  + +N   +LEED R   C
Sbjct  113  SPARWDILEEANA--ILEEDRRCEPC  136



>ref|XP_009358901.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Pyrus x bretschneideri]
Length=608

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 3/145 (2%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR S       K      +      +  + V   KASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRR-STMDTPATKARRGPMKVKVVDHENDVGVVGAKASDALPLPLYLTNAVFFTLFF  59

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKIR STPLHVV  SE+ A+ + +AS IYLLGFFGI FVQS + R + +
Sbjct  60   SVVYFLLTRWREKIRTSTPLHVVNFSEIVAILAFVASFIYLLGFFGIDFVQSLILRPSND  119

Query  421  GW--DGEDXSNEQYLLEEDSRRGAC  489
             W  D ++  +E+ +L++D+R+  C
Sbjct  120  VWAADDDEEEHERLILKDDARKMPC  144



>ref|XP_003519474.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Glycine max]
Length=556

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 93/126 (74%), Gaps = 8/126 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MD+ RR       P+  +AA    I   K++    SSPKASDALPLPLYLTN +FFT+ F
Sbjct  1    MDLHRR------PPH--AAADDGAIHHKKRRDSSTSSPKASDALPLPLYLTNAIFFTLFF  52

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V YFLL RWR+KIR+ TPLHVVTLSE+AA+ SLIAS IYLLGFFGI FVQSF+ RA+ +
Sbjct  53   SVAYFLLHRWRDKIRSHTPLHVVTLSEIAAIFSLIASFIYLLGFFGIDFVQSFISRASHD  112

Query  421  GWDGED  438
             WD +D
Sbjct  113  SWDLDD  118



>ref|XP_003545556.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Glycine max]
Length=565

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +1

Query  142  HKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlse  321
            H ++    SSPKASDALPLPLYLTN +FFT+ F+V YFLL RWR+KIR+ TPLHVVTLSE
Sbjct  17   HPKKRRDTSSPKASDALPLPLYLTNAIFFTLFFSVAYFLLHRWRDKIRSHTPLHVVTLSE  76

Query  322  laalasliasviyllGFFGIGFVQSFLYRANQEGWDGED  438
            +AA+ SLIAS IYLLGFFGI FVQSF+ RA+ + WD +D
Sbjct  77   IAAIFSLIASFIYLLGFFGIDFVQSFISRASNDAWDLDD  115



>gb|AET72045.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 [Dimocarpus 
longan]
Length=568

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%), Gaps = 7/121 (6%)
 Frame = +1

Query  139  AHKQQYL----LVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHV  306
            A KQ +L    L  + KASDALPLPLY+TN +F T+ FTV+Y+LL RWREK+R STPLHV
Sbjct  8    ASKQSHLDAKALDGTTKASDALPLPLYITNAVFLTLFFTVVYYLLSRWREKVRTSTPLHV  67

Query  307  VTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGA  486
            VT+SE+ A+ + +AS IYLLGFFGI FVQS L+R + E W  E+   ++ +++EDSR+  
Sbjct  68   VTMSEMGAIVAFVASCIYLLGFFGIDFVQSLLFRPSSEMWTEEE---DEVIIKEDSRQLP  124

Query  487  C  489
            C
Sbjct  125  C  125



>emb|CDP07253.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 92/131 (70%), Gaps = 12/131 (9%)
 Frame = +1

Query  61   MDVRRRLSKQLCRP--------NKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTN  216
            MDVRRR  K    P        NKGS++A   +           +PKASDALPLPLYLTN
Sbjct  1    MDVRRRPPKPSGPPTNSLDHQQNKGSSSASARVLDRSPS----PTPKASDALPLPLYLTN  56

Query  217  GLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQS  396
             +FFT+ F+V Y+LL RWR+KIRNSTPLHV+TLS+LAA+ SLIAS IYLLGFFGI FVQS
Sbjct  57   CIFFTLFFSVAYYLLHRWRDKIRNSTPLHVLTLSDLAAILSLIASFIYLLGFFGIDFVQS  116

Query  397  FLYRANQEGWD  429
            F+ R + + WD
Sbjct  117  FIARPSNDHWD  127



>sp|O64967.1|HMDH2_GOSHI RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
2; Short=HMG-CoA reductase 2 [Gossypium hirsutum]
 gb|AAC05089.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Gossypium 
hirsutum]
Length=628

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 87/123 (71%), Gaps = 3/123 (2%)
 Frame = +1

Query  130  TIKAHKQQYLLVSSP-KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHV  306
             +K  K+  L+  +P KASDALPLPLYLTN +FFT+ FTV+YFLL RWREKIR S PLH 
Sbjct  14   VLKPSKRFPLVEDTPGKASDALPLPLYLTNAVFFTLFFTVVYFLLSRWREKIRASIPLHA  73

Query  307  VTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGED--XSNEQYLLEEDSRR  480
            VT  E+ A+ + +AS+IYLLGFFGI FVQS + R + + W GED    NE  L EED+R 
Sbjct  74   VTFPEIVAIFAFVASLIYLLGFFGIDFVQSLIIRPSGDVWSGEDYEEENEVLLHEEDART  133

Query  481  GAC  489
              C
Sbjct  134  VPC  136



>ref|XP_010061229.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Eucalyptus grandis]
 gb|KCW68146.1| hypothetical protein EUGRSUZ_F01818 [Eucalyptus grandis]
Length=588

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 83/106 (78%), Gaps = 4/106 (4%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            SSPKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIR+S PLHVVT  E+AA+ SLI
Sbjct  40   SSPKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRSSVPLHVVTFPEIAAIVSLI  99

Query  346  asviyllGFFGIGFVQSFLYRANQEGWDGED----XSNEQYLLEED  471
            AS IYLLGFFGIGFVQSF+ RA+ + WD  D       + +L E+D
Sbjct  100  ASFIYLLGFFGIGFVQSFISRASHDAWDVLDDEVAVGGDGFLPEDD  145



>gb|ABF56518.2| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Litchi chinensis]
Length=562

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            SPKASDA+PLPLYLTN +FFT+ F+V YFLL RWR+KIR+STPLHVVTLSE+AA+ SLIA
Sbjct  25   SPKASDAVPLPLYLTNAIFFTLFFSVAYFLLHRWRDKIRSSTPLHVVTLSEIAAIVSLIA  84

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGED  438
            S IYLLGFFGI FVQSF+ RA+ + WD +D
Sbjct  85   SFIYLLGFFGIDFVQSFISRASNDAWDLDD  114



>ref|XP_011092919.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Sesamum 
indicum]
Length=582

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 91/120 (76%), Gaps = 3/120 (3%)
 Frame = +1

Query  139  AHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTls  318
            A + Q L   S KASDALPLPLY+TN +FFT+ F+V+Y+LL+RWREKIRNSTPLHVVTLS
Sbjct  12   AFQPQPLADGSLKASDALPLPLYITNAVFFTLFFSVVYYLLLRWREKIRNSTPLHVVTLS  71

Query  319  elaalasliasviyllGFFGIGFVQSFLY-RANQEGWDGEDXSN--EQYLLEEDSRRGAC  489
            E+AA+ + +AS IYLLGFFGIGFVQS +  RA+ E    ED  N  +  +L+ED+R   C
Sbjct  72   EIAAIVTFVASFIYLLGFFGIGFVQSLIIPRASHEDILDEDEINDYDSLMLKEDTRAIPC  131



>ref|XP_004287703.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Fragaria vesca subsp. vesca]
Length=566

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 84/106 (79%), Gaps = 6/106 (6%)
 Frame = +1

Query  115  AAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNST  294
            A   E +K H++ +     PKASDALPLPLYLTNGLFFT+ FTV YFLL RWREKIR+ST
Sbjct  13   AGGVEPVKQHQRNH-----PKASDALPLPLYLTNGLFFTLFFTVAYFLLHRWREKIRSST  67

Query  295  PLHVVTlselaalasliasviyllGFFGIGFVQSFLY-RANQEGWD  429
            PLHVVTLSE+ AL SL ASVIYLLGFFGI FVQSF++ RA  + W+
Sbjct  68   PLHVVTLSEIVALFSLFASVIYLLGFFGIDFVQSFVHPRAPHDPWN  113



>ref|XP_008235831.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Prunus mume]
Length=605

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDV RR S       KG  A    +K   +  ++V   KASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVARR-STMETAAGKGRRAGPMKVKVVDENDVVVVGAKASDALPLPLYLTNAVFFTLFF  59

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKIR STPLHVV LSE+ A+ + +AS IYLLGFFGI FVQS + R + +
Sbjct  60   SVVYFLLTRWREKIRTSTPLHVVNLSEIVAILAFVASFIYLLGFFGIDFVQSLILRPSND  119

Query  421  GW--DGEDXSNEQYLLEEDSRRGAC  489
             W  D ++  +E+ +L++D+R+  C
Sbjct  120  VWAADDDEEEHERMILKDDARKVPC  144



>gb|AAC37432.1| HMG-CoA reductase, partial [Solanum tuberosum]
 gb|AAC37434.1| HMG-CoA reductase, partial [Solanum tuberosum]
 prf||2116416B hydroxymethylglutaryl CoA reductase
 prf||2116416D hydroxymethylglutaryl CoA reductase
Length=82

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 61/84 (73%), Gaps = 8/84 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K L       A+A E +K        VSSPKASDALPLPLYLT GLFFTM F
Sbjct  1    MDVRRRPVKPLY--TSKDASAGEPLKQE------VSSPKASDALPLPLYLTTGLFFTMFF  52

Query  241  TVMYFLLVRWREKIRNSTPLHVVT  312
            +VMYFLLVRWREKIRNS PLHVVT
Sbjct  53   SVMYFLLVRWREKIRNSIPLHVVT  76



>ref|XP_010028873.1| PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-methylglutaryl-coenzyme 
A reductase 1 [Eucalyptus grandis]
Length=603

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 96/155 (62%), Gaps = 18/155 (12%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLV---SSPKASDALPLPLYLTNGLFFT  231
            MD RRR +K L              K H+    +    SS KASDALPLPLYLTN +FFT
Sbjct  1    MDARRRPAKPL------DGTVHPRSKQHRADVGVAGDASSLKASDALPLPLYLTNAVFFT  54

Query  232  MXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRA  411
            + F+V+Y+LL RWREKIR STPLH+VT +E+AA+ + +AS IYL+GFFG+ FVQS + R 
Sbjct  55   LFFSVVYYLLSRWREKIRTSTPLHLVTPAEMAAIVAFVASFIYLVGFFGVDFVQSLILRP  114

Query  412  NQEGWDGEDXSNE---------QYLLEEDSRRGAC  489
              + W  +D  +E         + LL+EDSR   C
Sbjct  115  AGDVWTADDEDDEVVVAGADHDKILLKEDSRSSPC  149



>ref|XP_010530977.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010530978.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like 
isoform X2 [Tarenaya hassleriana]
Length=579

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 94/145 (65%), Gaps = 16/145 (11%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR        N   A    ++        + S PKASDALPLPLYLTN +F T+ F
Sbjct  1    MDVRRR--------NHSKA----SVHGDHVAGDVGSPPKASDALPLPLYLTNTIFLTLFF  48

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
             V+YFLL RWREKIR STPLHVV  SE+ A+ + +AS IYLLGFFG+GFVQS ++R + E
Sbjct  49   AVVYFLLSRWREKIRRSTPLHVVDFSEILAIIAFVASFIYLLGFFGVGFVQSLIFRPSSE  108

Query  421  G--WDGEDXSNEQYLLEEDSRRGAC  489
               W  ED   ++ +L+EDSR+  C
Sbjct  109  DDVWASEDV--DRLVLKEDSRKIPC  131



>ref|XP_002300544.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
 gb|EEE85349.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
Length=577

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            +S KASDALPLPLYLTNGLFF + F+V YFLL RWREKIRNSTPLH++T  E+A +  L 
Sbjct  27   TSVKASDALPLPLYLTNGLFFGLFFSVAYFLLHRWREKIRNSTPLHIITFPEIAGIVCLA  86

Query  346  asviyllGFFGIGFVQSFLYRANQEGWDGEDXSN  447
            ASVIYLLGFFGIG VQSF+ R + + WD E+ +N
Sbjct  87   ASVIYLLGFFGIGVVQSFISRGSNDSWDVEEDNN  120



>sp|P48021.1|HMDH_CAMAC RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase; 
Short=HMG-CoA reductase [Camptotheca acuminata]
 gb|AAA33040.1| 3-hydroxy-3-methylglutaryl coA reductase [Camptotheca acuminata]
Length=593

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 100/149 (67%), Gaps = 6/149 (4%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYL----LVSSPKASDALPLPLYLTNGLFF  228
            MDVRRR    + +       A   +K  +   +    L  SPKASDALPLPLY+TNG+FF
Sbjct  1    MDVRRRSINSIHQIPSVGGTAPPMLKPKQPTKVDAVDLPDSPKASDALPLPLYITNGVFF  60

Query  229  TMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYR  408
            T+ FTV+Y+LLVRWREKIRNSTPLHVVTLSE+AA+ + +AS IYLLGFFGIG VQ F  R
Sbjct  61   TLFFTVVYYLLVRWREKIRNSTPLHVVTLSEIAAIFTFVASFIYLLGFFGIGLVQPFTSR  120

Query  409  ANQ--EGWDGEDXSNEQYLLEEDSRRGAC  489
            ++        +D   ++ +L+ED+R   C
Sbjct  121  SSHDDVWGVDDDEDVDEIVLKEDTRTVPC  149



>gb|ABQ52378.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Malus domestica]
Length=569

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 90/125 (72%), Gaps = 17/125 (14%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            M VRRR       P+  SAA  E IK+ KQ        KASDALPLPLYLTNGLFFT+ F
Sbjct  1    MAVRRR-------PSTASAAG-EPIKSDKQLL------KASDALPLPLYLTNGLFFTLFF  46

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFL---YRA  411
            TV YFLL RWREKIR+STPLHVVTLSELAAL SL ASVIYLLGFFGI FVQSF+    RA
Sbjct  47   TVAYFLLTRWREKIRSSTPLHVVTLSELAALFSLFASVIYLLGFFGIDFVQSFVSPSSRA  106

Query  412  NQEGW  426
              + W
Sbjct  107  AHDPW  111



>gb|AAK95406.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Malus domestica]
Length=608

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 97/145 (67%), Gaps = 3/145 (2%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR +         S      +  H+    +V + KASDALPLPLYLTN + FT+ F
Sbjct  1    MDVRRRSTMDTPATKARSGPMKVKVVDHENDVGVVGA-KASDALPLPLYLTNAVCFTLFF  59

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKI+ STPLHVV LSE+ A+ + +AS IYLLGFFGI FVQS + R + +
Sbjct  60   SVVYFLLTRWREKIKTSTPLHVVNLSEIVAILAFVASFIYLLGFFGIDFVQSLILRPSND  119

Query  421  GW--DGEDXSNEQYLLEEDSRRGAC  489
             W  D ++  +E+ +L++D+R+  C
Sbjct  120  VWAADDDEEEHERLILKDDARKVPC  144



>ref|XP_008357826.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Malus domestica]
Length=569

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 90/125 (72%), Gaps = 17/125 (14%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            M VRRR       P+  SAA  E IK+ KQ        KASDALPLPLYLTNGLFFT+ F
Sbjct  1    MAVRRR-------PSTASAAG-EPIKSDKQLL------KASDALPLPLYLTNGLFFTLFF  46

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFL---YRA  411
            TV YFLL RWREKIR+STPLHVVTLSELAAL SL ASVIYLLGFFGI FVQSF+    RA
Sbjct  47   TVAYFLLTRWREKIRSSTPLHVVTLSELAALFSLFASVIYLLGFFGIDFVQSFVSPSSRA  106

Query  412  NQEGW  426
              + W
Sbjct  107  AHDPW  111



>gb|AET72043.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 [Litchi chinensis]
Length=568

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 90/121 (74%), Gaps = 7/121 (6%)
 Frame = +1

Query  139  AHKQQYL----LVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHV  306
            A KQ  L    +  + KASDALPLPLY+TN +FFT+ FTV+Y+LL RWREK+R STPLHV
Sbjct  8    ASKQSQLDAKAVDGTTKASDALPLPLYITNAVFFTLFFTVVYYLLSRWREKVRTSTPLHV  67

Query  307  VTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGA  486
            VT+SE+ A+ + +AS IYLLGFFGI FVQS L+R + E W  ED   ++ +++EDSR+  
Sbjct  68   VTMSEMGAIVAFVASCIYLLGFFGIDFVQSLLFRPSSEMWT-ED--EDEVIIKEDSRQLP  124

Query  487  C  489
            C
Sbjct  125  C  125



>gb|KCW55693.1| hypothetical protein EUGRSUZ_I01544 [Eucalyptus grandis]
Length=626

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 96/155 (62%), Gaps = 18/155 (12%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLV---SSPKASDALPLPLYLTNGLFFT  231
            MD RRR +K L              K H+    +    SS KASDALPLPLYLTN +FFT
Sbjct  24   MDARRRPAKPL------DGTVHPRSKQHRADVGVAGDASSLKASDALPLPLYLTNAVFFT  77

Query  232  MXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRA  411
            + F+V+Y+LL RWREKIR STPLH+VT +E+AA+ + +AS IYL+GFFG+ FVQS + R 
Sbjct  78   LFFSVVYYLLSRWREKIRTSTPLHLVTPAEMAAIVAFVASFIYLVGFFGVDFVQSLILRP  137

Query  412  NQEGWDGEDXSNE---------QYLLEEDSRRGAC  489
              + W  +D  +E         + LL+EDSR   C
Sbjct  138  AGDVWTADDEDDEVVVAGADHDKILLKEDSRSSPC  172



>ref|XP_011038101.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Populus euphratica]
Length=576

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            +S KASDALPLPLYLTNGLFF + F+V YFLL RWREKIRNSTPLH++T  E+A +  L 
Sbjct  27   TSVKASDALPLPLYLTNGLFFGLFFSVAYFLLHRWREKIRNSTPLHIITFPEIAGIVCLA  86

Query  346  asviyllGFFGIGFVQSFLYRANQEGWDGEDXSN  447
            AS IYLLGFFGIG VQSF+ R + + WD E+ +N
Sbjct  87   ASFIYLLGFFGIGVVQSFISRGSNDSWDVEEDNN  120



>gb|AAL03986.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Malus domestica]
Length=588

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 2/111 (2%)
 Frame = +1

Query  163  VSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasl  342
            V   KASDALPLPLYLTN +FFT+ F+V+YFLL RWREKIR STPLHVV LSE+ A+ + 
Sbjct  14   VVGAKASDALPLPLYLTNAVFFTLFFSVVYFLLTRWREKIRTSTPLHVVNLSEIVAILAF  73

Query  343  iasviyllGFFGIGFVQSFLYRANQEGW--DGEDXSNEQYLLEEDSRRGAC  489
            +AS IYLLGFFGI FVQS + R + + W  D ++  +E+ +L++D+R+  C
Sbjct  74   VASFIYLLGFFGIDFVQSLILRPSNDVWAADDDEEEHERLILKDDARKVPC  124



>gb|KJB79754.1| hypothetical protein B456_013G065200 [Gossypium raimondii]
Length=628

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLYLTN +FFT+ F+V+YFLL RWREKIR S PLH VT  E+ A+ +L+AS+
Sbjct  30   KASDALPLPLYLTNAVFFTLFFSVVYFLLSRWREKIRASIPLHAVTFPEIVAVFALVASL  89

Query  355  iyllGFFGIGFVQSFLYRANQEGWDGED--XSNEQYLLEEDSRRGAC  489
            IYLLGFFGI FVQS + R + + W GED    NE  L EED+R   C
Sbjct  90   IYLLGFFGIDFVQSLIIRPSGDVWSGEDDEEGNEVLLREEDARTVPC  136



>ref|XP_006302045.1| hypothetical protein CARUB_v10020027mg [Capsella rubella]
 gb|EOA34943.1| hypothetical protein CARUB_v10020027mg [Capsella rubella]
Length=515

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 98/150 (65%), Gaps = 12/150 (8%)
 Frame = +1

Query  61   MDVRRRLSKQLCR--PNKGSAAACETIKAHKQQYLLVSS-----PKASDALPLPLYLTNG  219
            MD+RRR  K      PN  S  +    ++    + L ++     PKASDALPLPLYLTN 
Sbjct  1    MDLRRRPPKPPVNSNPNGSSYPSSYQPRSSDDDHRLRTASIAPPPKASDALPLPLYLTNA  60

Query  220  LFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
            +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS IYLLGFFGI FVQSF
Sbjct  61   VFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQSF  120

Query  400  LYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            + RA+ + WD  D  +     E+D R   C
Sbjct  121  ISRASGDAWDLADTID-----EDDHRLVTC  145



>gb|KJB12364.1| hypothetical protein B456_002G014700 [Gossypium raimondii]
Length=535

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 89/129 (69%), Gaps = 5/129 (4%)
 Frame = +1

Query  118  AACETIKAHKQQYLLV---SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRN  288
            ++  ++++HK    +     S KASDALPLPLYLTN +FFT+ F+ +YFLL RWREKIR+
Sbjct  7    SSINSVRSHKPARPIALEDDSTKASDALPLPLYLTNAVFFTLFFSAVYFLLCRWREKIRS  66

Query  289  STPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLL--  462
            STPLHVVT SE+ A+ + +AS IYLLGFFGI FVQS + R + + W  ED   E  +L  
Sbjct  67   STPLHVVTFSEIVAILASVASFIYLLGFFGIDFVQSLVLRPSADVWATEDDEVESEVLLR  126

Query  463  EEDSRRGAC  489
             ED+R   C
Sbjct  127  NEDARHVPC  135



>ref|XP_010090727.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Morus notabilis]
 gb|EXB40446.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Morus notabilis]
Length=586

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 95/143 (66%), Gaps = 8/143 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVR R S +   P    A     +++ +        PK SDALP+PLYLTN  FFT+ F
Sbjct  1    MDVRNRQSAKPAGPTVLKAKKLVDVESDRN-------PKVSDALPMPLYLTNVTFFTLFF  53

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKIR STPLHV+T SE++AL +L+AS IYLLGFFGI FVQS + R + +
Sbjct  54   SVVYFLLTRWREKIRTSTPLHVLTFSEISALFALLASFIYLLGFFGIDFVQSLILRPSAD  113

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
             W  +D    + +L++DSR+  C
Sbjct  114  VWAADDDEMVE-ILKDDSRKVPC  135



>sp|O64966.1|HMDH1_GOSHI RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
1; Short=HMG-CoA reductase 1 [Gossypium hirsutum]
 gb|AAC05088.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Gossypium 
hirsutum]
Length=585

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 87/125 (70%), Gaps = 5/125 (4%)
 Frame = +1

Query  130  TIKAHKQQYLLV---SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPL  300
            +I++HK    +     S KASDALPLPLYLTN +FFT+ F+ +YFLL RWREKIR+STPL
Sbjct  11   SIRSHKPARPIALEDDSTKASDALPLPLYLTNAVFFTLFFSAVYFLLCRWREKIRSSTPL  70

Query  301  HVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLL--EEDS  474
            HVVT SE+ A+ + +AS IYLLGFFGI FVQS + R + + W  ED   E  +L   ED+
Sbjct  71   HVVTFSEIVAILASVASFIYLLGFFGIDFVQSLVLRPSADVWATEDDEVESEVLLRNEDA  130

Query  475  RRGAC  489
            R   C
Sbjct  131  RHVPC  135



>ref|XP_009359638.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Pyrus x bretschneideri]
Length=569

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 90/125 (72%), Gaps = 17/125 (14%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            M VRRR S         ++AA E IK+ KQ        KASDALPLPLYLTNGLFFT+ F
Sbjct  1    MAVRRRSST--------ASAAGEPIKSDKQLL------KASDALPLPLYLTNGLFFTLFF  46

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFL---YRA  411
            TV YFLL RWREKIR+STPLHVVTLSELAAL SL ASVIYLLGFFGI FVQSF+    RA
Sbjct  47   TVAYFLLHRWREKIRSSTPLHVVTLSELAALFSLFASVIYLLGFFGIDFVQSFVSPSSRA  106

Query  412  NQEGW  426
              + W
Sbjct  107  AHDPW  111



>ref|XP_003617066.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 gb|AET00025.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
Length=565

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 89/127 (70%), Gaps = 7/127 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHK-QQYLLVSSPKASDALPLPLYLTNGLFFTMX  237
            MD+ RR       P   + A      +H+ +    + SPKASDALPLPLYLTN +FFT+ 
Sbjct  1    MDLHRR------PPQTTTGAVATNPHSHRLKSRSPLPSPKASDALPLPLYLTNTIFFTLF  54

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F V Y+LL RWR+KIR+STPLHVV  +ELAA+ SLIAS IYLLGFFGI FVQSF  RA+ 
Sbjct  55   FAVAYYLLHRWRDKIRSSTPLHVVNFTELAAIVSLIASFIYLLGFFGIDFVQSFATRASH  114

Query  418  EGWDGED  438
            +GWD +D
Sbjct  115  DGWDLDD  121



>gb|ABC74565.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Picrorhiza kurrooa]
Length=561

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 92/129 (71%), Gaps = 16/129 (12%)
 Frame = +1

Query  61   MDVRRR------LSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGL  222
            MD RRR      +  QL  P  G++A       H Q     SSPKASDALPLPLYLTNG+
Sbjct  1    MDFRRRPPRPSQIKHQLQSPASGASA-----DHHNQS----SSPKASDALPLPLYLTNGI  51

Query  223  FFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFL  402
            FFT+ F+V YFLL RWR+KIRNS PLHV+T+SELAA+  LIAS IYLLGFFGI FVQSF 
Sbjct  52   FFTLFFSVAYFLLHRWRDKIRNSIPLHVLTVSELAAIICLIASFIYLLGFFGIDFVQSFT  111

Query  403  YRA-NQEGW  426
             ++ N++G+
Sbjct  112  SKSENEDGF  120



>gb|KHG00733.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Gossypium 
arboreum]
Length=585

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 89/129 (69%), Gaps = 5/129 (4%)
 Frame = +1

Query  118  AACETIKAHKQQYLLV---SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRN  288
            ++  ++++HK    +     S KASDALPLPLYLTN +FFT+ F+ +YFLL RWREKIR+
Sbjct  7    SSTNSVRSHKPARPIALEDDSTKASDALPLPLYLTNAVFFTLFFSAVYFLLCRWREKIRS  66

Query  289  STPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLL--  462
            STPLHVVT SE+ A+ + +AS IYLLGFFGI FVQS + R + + W  ED   E  +L  
Sbjct  67   STPLHVVTFSEIVAILASVASFIYLLGFFGIDFVQSLVLRPSADVWATEDDEVETEVLLR  126

Query  463  EEDSRRGAC  489
             ED+R   C
Sbjct  127  NEDARHVTC  135



>ref|XP_007199742.1| hypothetical protein PRUPE_ppa002715mg [Prunus persica]
 gb|EMJ00941.1| hypothetical protein PRUPE_ppa002715mg [Prunus persica]
Length=641

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLYLTN +FFT+ F+V+YFLL RWREKIR STPLHVV LSE+ A+ + +AS 
Sbjct  74   KASDALPLPLYLTNAVFFTLFFSVVYFLLTRWREKIRTSTPLHVVNLSEIVAILAFVASF  133

Query  355  iyllGFFGIGFVQSFLYRANQEGWDGED--XSNEQYLLEEDSRRGAC  489
            IYLLGFFGI FVQS + R + + W  +D    +E+ +L++D+R+  C
Sbjct  134  IYLLGFFGIDFVQSLILRPSNDVWAADDDLEEHERMILKDDARKVPC  180



>gb|KJB12363.1| hypothetical protein B456_002G014700 [Gossypium raimondii]
 gb|KJB12365.1| hypothetical protein B456_002G014700 [Gossypium raimondii]
Length=585

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 87/125 (70%), Gaps = 5/125 (4%)
 Frame = +1

Query  130  TIKAHKQQYLLV---SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPL  300
            ++++HK    +     S KASDALPLPLYLTN +FFT+ F+ +YFLL RWREKIR+STPL
Sbjct  11   SVRSHKPARPIALEDDSTKASDALPLPLYLTNAVFFTLFFSAVYFLLCRWREKIRSSTPL  70

Query  301  HVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLL--EEDS  474
            HVVT SE+ A+ + +AS IYLLGFFGI FVQS + R + + W  ED   E  +L   ED+
Sbjct  71   HVVTFSEIVAILASVASFIYLLGFFGIDFVQSLVLRPSADVWATEDDEVESEVLLRNEDA  130

Query  475  RRGAC  489
            R   C
Sbjct  131  RHVPC  135



>emb|CDX88285.1| BnaC06g37290D [Brassica napus]
Length=574

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 94/145 (65%), Gaps = 8/145 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSP--KASDALPLPLYLTNGLFFTM  234
            MD+RRR  K    PN+        + +         SP  KASDALPLPLYLTN +FFT+
Sbjct  1    MDIRRRPPKPPVNPNRFLDNRSPPLPSDDDDIDRNRSPRPKASDALPLPLYLTNAVFFTL  60

Query  235  XFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRAN  414
             F+V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS IYLLGFFGI FVQSF+ RA 
Sbjct  61   FFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIVALIASFIYLLGFFGIDFVQSFISRA-  119

Query  415  QEGWDGEDXSNEQYLLEEDSRRGAC  489
                D  D S+  YL+ ED R   C
Sbjct  120  ----DSSD-SDRDYLVNEDHRLATC  139



>gb|AAC37431.1| HMG-CoA reductase, partial [Solanum tuberosum]
 prf||2116416A hydroxymethylglutaryl CoA reductase
Length=82

 Score =   105 bits (261),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 60/84 (71%), Gaps = 8/84 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K L       A+A E +K        VSSPKASDALPLPLYLT GLFFTM F
Sbjct  1    MDVRRRPVKPLY--TSKDASAGEPLKQE------VSSPKASDALPLPLYLTTGLFFTMFF  52

Query  241  TVMYFLLVRWREKIRNSTPLHVVT  312
            +VMYFLL+RWREKIRNS PLH VT
Sbjct  53   SVMYFLLIRWREKIRNSIPLHAVT  76



>ref|XP_006302046.1| hypothetical protein CARUB_v10020027mg [Capsella rubella]
 gb|EOA34944.1| hypothetical protein CARUB_v10020027mg [Capsella rubella]
Length=592

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 94/138 (68%), Gaps = 7/138 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCR--PNKGSAAACETIKAHKQQYLLVSS-----PKASDALPLPLYLTNG  219
            MD+RRR  K      PN  S  +    ++    + L ++     PKASDALPLPLYLTN 
Sbjct  1    MDLRRRPPKPPVNSNPNGSSYPSSYQPRSSDDDHRLRTASIAPPPKASDALPLPLYLTNA  60

Query  220  LFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
            +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS IYLLGFFGI FVQSF
Sbjct  61   VFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQSF  120

Query  400  LYRANQEGWDGEDXSNEQ  453
            + RA+ + WD  D  +E 
Sbjct  121  ISRASGDAWDLADTIDED  138



>gb|AAP14352.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Andrographis 
paniculata]
Length=556

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 95/137 (69%), Gaps = 18/137 (13%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDV RR      RP K   A  + +   ++     SSPKASDALPLPLYLTNG+FFT+ F
Sbjct  1    MDVVRR------RPTK--PAPSDKVVVDRRP----SSPKASDALPLPLYLTNGIFFTLFF  48

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V YFLL RWR+KIRNSTPLHV+TLSELAA+  LIAS IYLLGFFGI FVQSF+ + +  
Sbjct  49   SVAYFLLHRWRDKIRNSTPLHVLTLSELAAIVCLIASFIYLLGFFGIDFVQSFISKPDA-  107

Query  421  GWDGEDXSNEQYLLEED  471
                 D   ++++L ED
Sbjct  108  -----DDDPQRFILHED  119



>ref|XP_002887642.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63901.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis lyrata 
subsp. lyrata]
Length=635

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 97/136 (71%), Gaps = 5/136 (4%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPN-KGSAAACETIKA---HKQQYLLVSSP-KASDALPLPLYLTNGLF  225
            MD+RRR  K     N  GS  + +T  +   H+++   ++ P KASDALPLPLYLTN +F
Sbjct  48   MDLRRRPPKPPVNNNTDGSFRSYQTRTSDDDHRRRTTTIAPPPKASDALPLPLYLTNAVF  107

Query  226  FTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLY  405
            FT+ F+V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS IYLLGFFGI FVQSF+ 
Sbjct  108  FTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQSFIS  167

Query  406  RANQEGWDGEDXSNEQ  453
            RA+ + WD  D  +E 
Sbjct  168  RASGDAWDLADTIDED  183



>ref|XP_002317026.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
 gb|EEE97638.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
Length=588

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 15/133 (11%)
 Frame = +1

Query  118  AACETIKA-HKQQYL--------LVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRW  270
            AA ET+K  H+Q++           +S KASDALPLPLYLTNGLFF + F+V YFLL RW
Sbjct  4    AAGETLKQYHRQRHHHNDHHNLPTPTSLKASDALPLPLYLTNGLFFGLFFSVAYFLLHRW  63

Query  271  REKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNE  450
            REKIRNSTPLH++T  E+A +  L ASV+YLLGFFGIG  QS + R +Q+ WD E    E
Sbjct  64   REKIRNSTPLHILTFPEIAGIVCLSASVVYLLGFFGIGIAQSLISRGSQDSWDVE----E  119

Query  451  QYLLEEDSRRGAC  489
             +++E+  + G C
Sbjct  120  DHMMEK--KGGLC  130



>gb|AHZ59734.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax notoginseng]
Length=574

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 4/103 (4%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            +PKASDALPLPLYLTNG+FFT+ F+V Y+LL RWR+KIR+STPLH+VTLSEL A+ SLIA
Sbjct  41   TPKASDALPLPLYLTNGIFFTLFFSVAYYLLHRWRDKIRSSTPLHIVTLSELTAIVSLIA  100

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSR  477
            S IYLLGFFGI FVQSF+ RA+ +     D   E  +LE DSR
Sbjct  101  SFIYLLGFFGIDFVQSFVSRADVD----VDIDVEPDILEADSR  139



>dbj|BAF98280.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
Length=526

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 94/146 (64%), Gaps = 14/146 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MD RRR       P  G+      +KA + +    ++ K SDALPL +YLTN L FT+ F
Sbjct  1    MDARRR-------PTSGNPIHSRKVKALEDE----NTQKPSDALPLHIYLTNALCFTVFF  49

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
             V+YFLL RWREKIR S PLHVVTLSE+AA+ +L AS IYLLGFFGI FVQS + R   +
Sbjct  50   WVVYFLLSRWREKIRTSAPLHVVTLSEIAAIVALFASFIYLLGFFGIDFVQSLILRPPTD  109

Query  421  GW---DGEDXSNEQYLLEEDSRRGAC  489
             W   D E+   EQ LL+ED+R+  C
Sbjct  110  MWAVDDEEEEPAEQILLKEDARKSPC  135



>ref|XP_011030717.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
[Populus euphratica]
Length=588

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            +S KASDALPLPLYLTNGLFF + FTV YFLL RWREKIRNSTPLH++T  E+  +  L 
Sbjct  29   TSLKASDALPLPLYLTNGLFFGLFFTVAYFLLHRWREKIRNSTPLHILTFPEIGGIICLS  88

Query  346  asviyllGFFGIGFVQSFLYRANQEGWDGED  438
            ASV+YLLGFFGIG  QS + R +Q+ WD E+
Sbjct  89   ASVVYLLGFFGIGIAQSLISRGSQDSWDVEE  119



>gb|ACD37361.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Salvia miltiorrhiza]
Length=565

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 82/104 (79%), Gaps = 6/104 (6%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            SSPKASDALPLPLYLTNG+FFT+ F+V YFLL RWR+KIRNSTPLH++TLSELA +  LI
Sbjct  29   SSPKASDALPLPLYLTNGIFFTLFFSVAYFLLHRWRDKIRNSTPLHILTLSELAGILCLI  88

Query  346  asviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSR  477
            AS IYLLGFFGI FVQSF+ +         D  +++++L ED +
Sbjct  89   ASFIYLLGFFGIDFVQSFISKPES------DEDHQRFILHEDRK  126



>ref|XP_009369772.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Pyrus x bretschneideri]
Length=562

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 89/128 (70%), Gaps = 17/128 (13%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            M VRRR       P   SAA  E IK+  Q        KASDALPLPLYLTNGLFFT+ F
Sbjct  1    MAVRRR-------PPTASAAG-EPIKSDNQLL------KASDALPLPLYLTNGLFFTLFF  46

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFL---YRA  411
             V YFLL RWREKIR+STPLHVVTLSELAAL SL AS+IYLLGFFGI FVQSF+   YRA
Sbjct  47   AVAYFLLNRWREKIRSSTPLHVVTLSELAALFSLFASIIYLLGFFGIDFVQSFVSPNYRA  106

Query  412  NQEGWDGE  435
                W+ +
Sbjct  107  AHGPWNDD  114



>gb|AFN89600.1| 3-hydro-3-methylglutary CoA reductase [Gentiana macrophylla]
Length=580

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYLTNG+FFT+ F+V Y+LL RWR+KIR STPLHVVTLSELAA+ SLIAS
Sbjct  39   PKASDALPLPLYLTNGIFFTLFFSVAYYLLHRWRDKIRTSTPLHVVTLSELAAILSLIAS  98

Query  352  viyllGFFGIGFVQSFLYRANQEGWD  429
             IYLLGFFGI FVQS + RA+ + WD
Sbjct  99   FIYLLGFFGIDFVQSVITRASPDSWD  124



>gb|AAC37433.1| HMG-CoA reductase, partial [Solanum tuberosum]
 prf||2116416C hydroxymethylglutaryl CoA reductase
Length=82

 Score =   102 bits (254),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 59/84 (70%), Gaps = 8/84 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR  K L       A+A E +K        VSSPKASDALPLPLYLT  LFFTM F
Sbjct  1    MDVRRRPVKPLY--TSKDASAGEPLKQE------VSSPKASDALPLPLYLTTRLFFTMFF  52

Query  241  TVMYFLLVRWREKIRNSTPLHVVT  312
            +VMYFLLVRWREKIRNS P HVVT
Sbjct  53   SVMYFLLVRWREKIRNSIPFHVVT  76



>ref|XP_007141592.1| hypothetical protein PHAVU_008G208900g [Phaseolus vulgaris]
 gb|ESW13586.1| hypothetical protein PHAVU_008G208900g [Phaseolus vulgaris]
Length=567

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLYLTN +FFT+ F+V YFLL RWR+KIR+ TPLHVVTLSE+AA+ SLIAS 
Sbjct  36   KASDALPLPLYLTNAIFFTLFFSVAYFLLHRWRDKIRSHTPLHVVTLSEIAAIFSLIASF  95

Query  355  iyllGFFGIGFVQSFLYRANQEGWDGED  438
            IYLLGFFGI FVQSF+ RA+Q+ WD ++
Sbjct  96   IYLLGFFGIDFVQSFITRASQDAWDVDE  123



>gb|AIX87979.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax ginseng]
Length=573

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 4/103 (4%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            +PKASDALPLPLYLTNG+FFT+ F+V Y+LL RWR+KIR+STPLH+VTLSELAA+ SLIA
Sbjct  40   TPKASDALPLPLYLTNGIFFTLFFSVAYYLLHRWRDKIRSSTPLHIVTLSELAAIVSLIA  99

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSR  477
            S IYLLGFFGI FVQSF+ RA+ +     D   E  +LE D R
Sbjct  100  SFIYLLGFFGIDFVQSFVSRADVD----VDIDVEPDILEADRR  138



>ref|XP_010428711.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
isoform X1 [Camelina sativa]
Length=574

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 93/139 (67%), Gaps = 8/139 (6%)
 Frame = +1

Query  61   MDVRRRLSK------QLCRPNKGSAAACETIKAHKQQYL--LVSSPKASDALPLPLYLTN  216
            MD+RRR  K         +   GS  + +  ++     L  +   PKASDALPLPLYLTN
Sbjct  1    MDLRRRPPKPPVNNATNNKNPNGSYPSYQPTRSSDDDRLRSITPPPKASDALPLPLYLTN  60

Query  217  GLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQS  396
             +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS IYLLGFFGI FVQS
Sbjct  61   AVFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQS  120

Query  397  FLYRANQEGWDGEDXSNEQ  453
            F+ RA+ + WD  D  +E 
Sbjct  121  FISRASGDSWDLADSIDED  139



>ref|XP_010428712.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
isoform X2 [Camelina sativa]
Length=595

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 93/139 (67%), Gaps = 8/139 (6%)
 Frame = +1

Query  61   MDVRRRLSK------QLCRPNKGSAAACETIKAHKQQYL--LVSSPKASDALPLPLYLTN  216
            MD+RRR  K         +   GS  + +  ++     L  +   PKASDALPLPLYLTN
Sbjct  1    MDLRRRPPKPPVNNATNNKNPNGSYPSYQPTRSSDDDRLRSITPPPKASDALPLPLYLTN  60

Query  217  GLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQS  396
             +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS IYLLGFFGI FVQS
Sbjct  61   AVFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQS  120

Query  397  FLYRANQEGWDGEDXSNEQ  453
            F+ RA+ + WD  D  +E 
Sbjct  121  FISRASGDSWDLADSIDED  139



>ref|XP_010471802.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Camelina sativa]
Length=590

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS
Sbjct  46   PKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIAS  105

Query  352  viyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQ  453
             IYLLGFFGI FVQSF+ RA+ + WD  D  +E 
Sbjct  106  FIYLLGFFGIDFVQSFISRASGDAWDLADSIDED  139



>ref|XP_010416569.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Camelina sativa]
Length=594

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS
Sbjct  46   PKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIAS  105

Query  352  viyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQ  453
             IYLLGFFGI FVQSF+ RA+ + WD  D  +E 
Sbjct  106  FIYLLGFFGIDFVQSFISRASGDAWDLADSIDED  139



>gb|AEZ55672.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 [Salvia miltiorrhiza]
Length=562

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 87/111 (78%), Gaps = 4/111 (4%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            S KASDALPLPLYLTN  FFT+ F+V+YFLL+RWREKIRNSTPLHVVTLS++AA+ + +A
Sbjct  16   SVKASDALPLPLYLTNAFFFTLFFSVVYFLLLRWREKIRNSTPLHVVTLSDIAAVLTFVA  75

Query  349  sviyllGFFGIGFVQSFLY-RANQEG-WDGEDXSN--EQYLLEEDSRRGAC  489
            S IYLLGFFGIGFVQS +  RA  E   D ED  +  ++ +++EDS +  C
Sbjct  76   SFIYLLGFFGIGFVQSIIIPRAPLEDVTDDEDEISDFDRLMVKEDSPKIPC  126



>ref|XP_009369771.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Pyrus x bretschneideri]
Length=564

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 88/130 (68%), Gaps = 16/130 (12%)
 Frame = +1

Query  64   DVRRR----LSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFT  231
            D+RRR     S    RPN+ ++AA              S PKASDALPLPLYLTNGLF T
Sbjct  3    DLRRRRPLPKSHHHRRPNQTASAADPN-----------SYPKASDALPLPLYLTNGLFVT  51

Query  232  MXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLY-R  408
            + FTV YFLL RWREKIR STPLHVVTLSE+AA+ SL ASVIYLLGFFGI FVQSF+  R
Sbjct  52   LFFTVAYFLLNRWREKIRTSTPLHVVTLSEIAAIFSLFASVIYLLGFFGIDFVQSFVAPR  111

Query  409  ANQEGWDGED  438
               + W   D
Sbjct  112  TPHDDWHEHD  121



>ref|XP_009106317.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Brassica rapa]
 emb|CDX87592.1| BnaA07g32810D [Brassica napus]
Length=576

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 97/148 (66%), Gaps = 21/148 (14%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNK--------GSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTN  216
            MD+RRR  K    PN+           ++ + I  ++       SPKASDALPLPLYLTN
Sbjct  1    MDIRRRPPKPPVNPNRFLDNRSPPPPPSSDDDIDRNR-------SPKASDALPLPLYLTN  53

Query  217  GLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQS  396
             +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS IYLLGFFGI FVQS
Sbjct  54   AVFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIVALIASFIYLLGFFGIDFVQS  113

Query  397  FLYRANQEGWDGEDXSNEQYLLEEDSRR  480
            F+ RA+       + S+  YL+ +D  R
Sbjct  114  FISRADS------NDSDRDYLVNDDHHR  135



>gb|ADI80346.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax ginseng]
Length=573

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 4/103 (4%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            +PKASDALPLPLYLTNG+FFT+ F+V Y+LL RWR+KIR+STPLH+VTLSELAA+ SLIA
Sbjct  40   TPKASDALPLPLYLTNGVFFTLFFSVAYYLLHRWRDKIRSSTPLHIVTLSELAAIVSLIA  99

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSR  477
            S IYLLGFFGI FVQSF+ RA+ +     D   E  +LE D R
Sbjct  100  SFIYLLGFFGIDFVQSFVSRADVD----VDIDVEPDILETDRR  138



>gb|AFM77981.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Eleutherococcus 
senticosus]
Length=570

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 95/146 (65%), Gaps = 17/146 (12%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVS-------SPKASDALPLPLYLTNG  219
            MDVRRRL  +   P        E+   H++             +PKASDALP+PLYL NG
Sbjct  1    MDVRRRLPPKPSLP----IPTTESSHHHRKTPFPADVDRSPSPTPKASDALPVPLYLANG  56

Query  220  LFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
            +FFT+ F+V Y+LL RWR+KIR+STPLH+VTL++LAA+ SLIAS IYLLGFFGI FVQSF
Sbjct  57   IFFTLFFSVAYYLLHRWRDKIRSSTPLHIVTLADLAAIVSLIASFIYLLGFFGINFVQSF  116

Query  400  LYRANQEGWDGEDXSNEQYLLEEDSR  477
            + RA+       D   +  +LE D R
Sbjct  117  VSRADV------DFDADPVILEADRR  136



>gb|KFK42070.1| hypothetical protein AALP_AA2G207200 [Arabis alpina]
Length=572

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MD RRR  K    P+        +  +      +   PKASDALPLPLYLTN +FFT+ F
Sbjct  1    MDFRRRPPKSPVTPSPFHKP--PSSTSSHHHTTISPPPKASDALPLPLYLTNTIFFTLFF  58

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS IYLLGFFGI FVQSF+ RA+ +
Sbjct  59   SVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQSFISRASND  118

Query  421  GWDGEDX-SNEQYLL  462
             W+ E+  SN+  L+
Sbjct  119  TWEDEEIQSNDHRLI  133



>ref|XP_004491163.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cicer arietinum]
Length=575

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            SPKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIR+ TPLHVVTLSE+ A+ SLIA
Sbjct  33   SPKASDALPLPLYLTNTIFFTLFFSVAYYLLHRWRDKIRSHTPLHVVTLSEITAIVSLIA  92

Query  349  sviyllGFFGIGFVQSFLYRANQEGWD  429
            S IYLLGFFGI FVQSF+ RA+ + WD
Sbjct  93   SFIYLLGFFGIDFVQSFISRASNDVWD  119



>gb|AAC37435.1| HMG-CoA reductase, partial [Solanum tuberosum]
 prf||2116416E hydroxymethylglutaryl CoA reductase
Length=82

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 59/84 (70%), Gaps = 8/84 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDV RR  K L       A A E +K        VSSPKASDALPLPLYLT GLFFTM F
Sbjct  1    MDVCRRPVKPLY--TSKDAFAGEPLKQE------VSSPKASDALPLPLYLTTGLFFTMFF  52

Query  241  TVMYFLLVRWREKIRNSTPLHVVT  312
            +VMYFLLVRWREKIRNS PLHVVT
Sbjct  53   SVMYFLLVRWREKIRNSIPLHVVT  76



>gb|AGQ04159.1| hydroxymethylglutaryl-CoA reductase [Lavandula angustifolia]
Length=565

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLYLTN  F T+ F+V+YFLL+RWREKIRNSTPLHVVTLSE++A+ + +AS 
Sbjct  16   KASDALPLPLYLTNAFFLTLFFSVVYFLLIRWREKIRNSTPLHVVTLSEISAIVTFVASF  75

Query  355  iyllGFFGIGFVQSFLY-RANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            IYLLGFFGIGFVQS +  RA  E  + +    +Q +++ED+R   C
Sbjct  76   IYLLGFFGIGFVQSVIIPRAPVEDDEDDIIDFDQLMVKEDTRSTPC  121



>gb|AEU08408.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Clematis armandii]
Length=578

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 88/131 (67%), Gaps = 11/131 (8%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR S +   P K      +  K HK       S  ASDALPLPLYLTN  FFT  F
Sbjct  1    MDVRRR-SIKAAYPTKEFTGE-KPAKPHK-------SLIASDALPLPLYLTNANFFTF-F  50

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ-  417
            +VMYFLL RWR+KIRNSTPLHVVT    AA+ SLIASVIYLL FFGIGFVQSF  R N  
Sbjct  51   SVMYFLLQRWRDKIRNSTPLHVVTALASAAIISLIASVIYLLQFFGIGFVQSFQNRDNHD  110

Query  418  EGWDGEDXSNE  450
            + WD ED ++E
Sbjct  111  DSWDVEDENDE  121



>gb|ADX31913.1| HMG CoA reductase [Bacopa monnieri]
Length=589

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 84/112 (75%), Gaps = 6/112 (5%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPL  TN +F T+ F+V+Y+LL RWREKIRNSTPLHVVTLSE+AA+ + +AS
Sbjct  29   PKASDALPLPLAFTNAVFITLFFSVVYYLLRRWREKIRNSTPLHVVTLSEIAAIVTFVAS  88

Query  352  viyllGFFGIGFVQSFLY-RANQEGWDGEDXSN-----EQYLLEEDSRRGAC  489
             IYL+GFFG+GFVQS +  RA+ +   GED        ++ +L+EDSR   C
Sbjct  89   FIYLIGFFGVGFVQSLIIPRASHDDILGEDDEIVDGDLDRQMLKEDSRSAPC  140



>gb|ADX31914.1| HMG CoA reductase [Bacopa monnieri]
Length=589

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 83/112 (74%), Gaps = 6/112 (5%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPL  TN +F T+ F+V+Y+LL RWREKIRNSTPLHVVTLSE+AA+ + +AS
Sbjct  29   PKASDALPLPLAFTNAVFITLFFSVVYYLLRRWREKIRNSTPLHVVTLSEIAAIVTFVAS  88

Query  352  viyllGFFGIGFVQSFLY-RANQEGWDGEDXSN-----EQYLLEEDSRRGAC  489
             IYL+GFFG+GFVQS +  RA+ +   GED        +  +L+EDSR   C
Sbjct  89   FIYLIGFFGVGFVQSLIIPRASHDDILGEDDEIVDGDLDHQMLKEDSRSAPC  140



>sp|P14891.1|HMDH1_ARATH RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
1; Short=AtHMGR1; Short=HMG-CoA reductase 1 [Arabidopsis thaliana]
 gb|AAF16652.1|AC012394_1 hydroxy methylglutaryl CoA reductase (AA 1-592); 9510-7255 [Arabidopsis 
thaliana]
 gb|AAG51957.1|AC015450_18 3-hydroxy-3-methylglutaryl CoA reductase (AA 1-592); 32253-34508 
[Arabidopsis thaliana]
 gb|AAK60283.1|AF385690_1 At1g76490/F15M4.1 [Arabidopsis thaliana]
 emb|CAA33139.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAA76821.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis thaliana]
 gb|AAA32814.1| hydroxymethylglutaryl CoA reductase [Arabidopsis thaliana]
 gb|AAN31847.1| putative 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis 
thaliana]
 gb|AAQ65091.1| At1g76490/F15M4.1 [Arabidopsis thaliana]
Length=592

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (71%), Gaps = 7/129 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKA------HKQQYLLVSSP-KASDALPLPLYLTNG  219
            MD+RRR  K     N  S  +  + +       H+++   ++ P KASDALPLPLYLTN 
Sbjct  1    MDLRRRPPKPPVTNNNNSNGSFRSYQPRTSDDDHRRRATTIAPPPKASDALPLPLYLTNA  60

Query  220  LFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
            +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS IYLLGFFGI FVQSF
Sbjct  61   VFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQSF  120

Query  400  LYRANQEGW  426
            + RA+ + W
Sbjct  121  ISRASGDAW  129



>ref|XP_007204574.1| hypothetical protein PRUPE_ppa003627mg [Prunus persica]
 gb|EMJ05773.1| hypothetical protein PRUPE_ppa003627mg [Prunus persica]
Length=560

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 87/127 (69%), Gaps = 18/127 (14%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            M VRRR       PN  S    E  K+ KQ        KASDALPLPLYLTNGLFFT+ F
Sbjct  1    MAVRRR------PPNPSSPG--EPAKSQKQNL------KASDALPLPLYLTNGLFFTLFF  46

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFL----YR  408
            TV YFLL RWREKIR STPLHV+TLSE+AAL SL ASVIYLLGFFGI FVQSF+     R
Sbjct  47   TVAYFLLHRWREKIRTSTPLHVLTLSEIAALFSLFASVIYLLGFFGIDFVQSFVSPNNAR  106

Query  409  ANQEGWD  429
            A  + W+
Sbjct  107  APHDPWN  113



>gb|EYU41201.1| hypothetical protein MIMGU_mgv1a003775mg [Erythranthe guttata]
 gb|EYU41202.1| hypothetical protein MIMGU_mgv1a003775mg [Erythranthe guttata]
Length=564

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 7/103 (7%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTP-LHVVTlselaalasl  342
            SSPKASDALPLPLYLTNG+FFT+ F+V YFLL RWR+KIRNSTP LHV+TLSELA +  L
Sbjct  31   SSPKASDALPLPLYLTNGIFFTLFFSVAYFLLNRWRDKIRNSTPLLHVLTLSELAGIICL  90

Query  343  iasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEED  471
            +AS IYL+GFFGI FVQSF+ ++        D  + Q++L ED
Sbjct  91   VASFIYLIGFFGIDFVQSFICKSET------DDDHHQFVLHED  127



>ref|NP_177775.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Arabidopsis 
thaliana]
 gb|AAR83122.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase isoform 1L [Arabidopsis 
thaliana]
 gb|AEE35849.1| hydroxy methylglutaryl CoA reductase 1 [Arabidopsis thaliana]
Length=642

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (71%), Gaps = 7/129 (5%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKA------HKQQYLLVSSP-KASDALPLPLYLTNG  219
            MD+RRR  K     N  S  +  + +       H+++   ++ P KASDALPLPLYLTN 
Sbjct  51   MDLRRRPPKPPVTNNNNSNGSFRSYQPRTSDDDHRRRATTIAPPPKASDALPLPLYLTNA  110

Query  220  LFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
            +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS IYLLGFFGI FVQSF
Sbjct  111  VFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQSF  170

Query  400  LYRANQEGW  426
            + RA+ + W
Sbjct  171  ISRASGDAW  179



>gb|AIG55301.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camellia sinensis]
Length=590

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 17/133 (13%)
 Frame = +1

Query  130  TIKAHKQQYLLVSSP----------KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREK  279
            +IK  +QQ+  + SP          KAS+A+PLPLYLTNG+FFT+ F+V+Y+LL RWREK
Sbjct  4    SIKPIQQQHHQIPSPAALKPLSKGTKASEAVPLPLYLTNGVFFTLFFSVVYYLLSRWREK  63

Query  280  IRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSN----  447
            IRNSTPLH++TLSE+AA+ + +AS IYLLGFFGIGFVQS   R++ +   G D       
Sbjct  64   IRNSTPLHLITLSEIAAIVAFVASFIYLLGFFGIGFVQSLFLRSSHDDVWGSDDDLDLQE  123

Query  448  ---EQYLLEEDSR  477
               +Q LL++D+R
Sbjct  124  QDVDQILLKDDTR  136



>ref|XP_004169656.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like, 
partial [Cucumis sativus]
Length=501

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 91/133 (68%), Gaps = 7/133 (5%)
 Frame = +1

Query  94   CRPNKGSAAACETIKAH-KQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRW  270
            CR  K +     T+KA    + +   S KASDAL LPLY+TN +FFT+ F+V+Y+LL RW
Sbjct  5    CRSTKPT-----TVKAKPTTKTVDGDSTKASDALALPLYITNAVFFTLFFSVVYYLLSRW  59

Query  271  REKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNE  450
            REKIRNS PLH VT SE+ +L +L+AS +YL+GFFGI FVQS   R + + W   D  +E
Sbjct  60   REKIRNSVPLHFVTPSEIVSLLALVASFVYLIGFFGIDFVQSLFLRPSGDVWT-TDEDDE  118

Query  451  QYLLEEDSRRGAC  489
            + ++++DSR+  C
Sbjct  119  RSIVKDDSRKVPC  131



>gb|ABX82838.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Cyclocarya paliurus]
Length=583

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 13/118 (11%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYL N +FFT+ F+V+YFLL RWREKIRNSTPLH+V LSE+ A+ +  AS
Sbjct  30   PKASDALPLPLYLINAVFFTLFFSVVYFLLTRWREKIRNSTPLHIVDLSEIVAIVAFFAS  89

Query  352  viyllGFFGIGFVQSFLYRANQEGWDGEDXS------------NEQYLLEEDSRRGAC  489
             +YLLGFFGI FVQS L R + + W  ED              +E+ +L+ED+ +  C
Sbjct  90   FVYLLGFFGIDFVQSIL-RPSADVWAAEDDDASVTADAIAQKHDEEAILKEDACKVPC  146



>gb|ABV25900.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Antirrhinum 
majus]
Length=586

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 89/117 (76%), Gaps = 16/117 (14%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLYLTNG+FFT+ F+V+Y+LL+RWREKIRNSTPLHVVTLSELAA+ + +AS 
Sbjct  25   KASDALPLPLYLTNGVFFTLFFSVVYYLLLRWREKIRNSTPLHVVTLSELAAILTFLASF  84

Query  355  iyllGFFGIGFVQSFLY-RANQ-------EGWDGED--------XSNEQYLLEEDSR  477
            IYLLGFFGIGFVQS +  RA+        +  +GE+          +++ LL+EDSR
Sbjct  85   IYLLGFFGIGFVQSLIIPRASHLDLDLDLDLDEGEEFKIRKQVVVDDDRLLLKEDSR  141



>ref|XP_002313569.2| hypothetical protein POPTR_0009s17090g [Populus trichocarpa]
 gb|EEE87524.2| hypothetical protein POPTR_0009s17090g [Populus trichocarpa]
Length=646

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +1

Query  163  VSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasl  342
            ++ PKASDALPLPLY+TN LFFT+ F+V+YFLL RWREKIRNSTPLH+VTLS++ A+ + 
Sbjct  84   LTGPKASDALPLPLYITNALFFTVFFSVVYFLLTRWREKIRNSTPLHLVTLSDIVAIFAF  143

Query  343  iasviyllGFFGIGFVQSFLYRANQEGW  426
            +AS IY+LGFFGI FVQS + R + + W
Sbjct  144  VASFIYMLGFFGIDFVQSLILRPSPDVW  171



>gb|AAY68034.1| 3-hydroxy-methylglutaryl coenzyme A reductase [Tilia miqueliana]
Length=585

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 12/145 (8%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            M+ RRR S +            +++K  K   L  +S KASDALP PLY+ N +FFT+ F
Sbjct  1    MEARRRSSTK----------PIQSLKTTKTVSLEENSTKASDALPPPLYIMNAVFFTLFF  50

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V+YFLL RWREKIR STPLH+VT SE+ A+ +L+AS IYLLGFFGI FVQS + R + +
Sbjct  51   SVVYFLLSRWREKIRISTPLHIVTFSEIVAVLALVASFIYLLGFFGIDFVQSLILRPSTD  110

Query  421  GWDGEDXSNEQYLL--EEDSRRGAC  489
             W+ E+   E  +L  +EDSR+  C
Sbjct  111  IWNSEEEEEENEVLLRKEDSRKVPC  135



>ref|XP_011000849.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
isoform X3 [Populus euphratica]
Length=617

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +1

Query  163  VSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasl  342
            ++ PKASDALPLPLY+TN LFFT+ F+V+YFLL RWREKIRNSTPLH++TLS++ A+ + 
Sbjct  69   LTGPKASDALPLPLYITNALFFTVFFSVVYFLLTRWREKIRNSTPLHLLTLSDIVAIFAF  128

Query  343  iasviyllGFFGIGFVQSFLYRANQEGWDGE  435
            +AS IY+LGFFGI FVQS + R + + W  E
Sbjct  129  VASFIYMLGFFGIDFVQSLILRPSPDVWAAE  159



>gb|ACE80254.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 [Pyrus pyrifolia]
Length=569

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 90/123 (73%), Gaps = 14/123 (11%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            M VRRR       P+  SAA  E IK+     LL++   ASDALPLPLYLTNGLFFT+ F
Sbjct  1    MAVRRR-------PSTASAAG-EPIKSDN---LLLN---ASDALPLPLYLTNGLFFTLFF  46

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            TV YFLL RWREKIR+STPLHVVTLSELAAL SL ASVIYLLGFFGI FVQSF+  ++  
Sbjct  47   TVAYFLLTRWREKIRSSTPLHVVTLSELAALFSLFASVIYLLGFFGIEFVQSFVSTSSGG  106

Query  421  GWD  429
              D
Sbjct  107  AHD  109



>ref|XP_008451185.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis melo]
Length=582

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 91/133 (68%), Gaps = 7/133 (5%)
 Frame = +1

Query  94   CRPNKGSAAACETIKAH-KQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRW  270
            CR  K +     T+KA    + +   S KASDAL LPLY+TN +FFT+ F+V+Y+LL RW
Sbjct  5    CRSTKPT-----TVKAKPTTKTVDGDSTKASDALALPLYITNAVFFTLFFSVVYYLLSRW  59

Query  271  REKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNE  450
            REKIRNS PLH VT SE+ +L +L+AS +YL+GFFGI FVQS   R + + W   D  +E
Sbjct  60   REKIRNSVPLHFVTPSEIISLLALVASFVYLIGFFGIDFVQSLFLRPSGDVWT-TDEDDE  118

Query  451  QYLLEEDSRRGAC  489
            + ++++DSR+  C
Sbjct  119  RSIVKDDSRKVPC  131



>ref|XP_004144569.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
 gb|KGN43374.1| hypothetical protein Csa_7G029390 [Cucumis sativus]
Length=582

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            S KASDAL LPLY+TN +FFT+ F+V+Y+LL RWREKIRNS PLH VT SE+ +L +L+A
Sbjct  26   STKASDALALPLYITNAVFFTLFFSVVYYLLSRWREKIRNSVPLHFVTPSEIVSLLALVA  85

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            S +YL+GFFGI FVQS   R + + W   D  +E+ ++++DSR+  C
Sbjct  86   SFVYLIGFFGIDFVQSLFLRPSGDVWT-TDEDDERSIVKDDSRKVPC  131



>gb|AAC15476.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Tagetes erecta]
Length=483

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 95/144 (66%), Gaps = 22/144 (15%)
 Frame = +1

Query  61   MDVRRR-LSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMX  237
            MDVRRR L+ +  +P                   ++  PKASDALP PLYLTN LFF++ 
Sbjct  1    MDVRRRPLNHRTLKPTLAGG--------------VLEQPKASDALPFPLYLTNALFFSLF  46

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F+VMYFLL RWREKIRNS PLHV+TLSEL AL SL+ASV+YL+GFFGI FVQS ++R + 
Sbjct  47   FSVMYFLLHRWREKIRNSVPLHVLTLSELLALLSLVASVVYLVGFFGIDFVQS-IFRPSP  105

Query  418  EGWDGEDXSNEQYLLEEDSRRGAC  489
            + WD +D      LL++D     C
Sbjct  106  DTWDIDD------LLDQDKPIKPC  123



>ref|XP_006384871.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
 gb|ERP62668.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
Length=594

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  163  VSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasl  342
            V  PKASDALPLPLY+TN LFFT+ F+V+YFLL RWREKIRNSTPLH++TLSE+AA+ + 
Sbjct  26   VIGPKASDALPLPLYITNALFFTVFFSVVYFLLTRWREKIRNSTPLHLLTLSEIAAIFAF  85

Query  343  iasviyllGFFGIGFVQSFLYRANQEGW  426
            I S IY+LGFFGI FVQS + R + + W
Sbjct  86   ITSFIYMLGFFGIDFVQSLILRPSPDVW  113



>ref|XP_004290090.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Fragaria vesca subsp. vesca]
Length=596

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLY+TN +FF + F+V+YFLL  WREKIR +TPLH++ LSE+ A+ + +AS 
Sbjct  35   KASDALPLPLYITNAVFFALFFSVVYFLLTSWREKIRTNTPLHIINLSEIVAILAFVASF  94

Query  355  iyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            IYLLGFFGI FVQS + + + + W  +D   E+ +L+ED+R+  C
Sbjct  95   IYLLGFFGIDFVQSLILQPSNDIWAADD-DEEEIILKEDARKVPC  138



>ref|XP_002514400.1| hmg-CoA reductase, putative [Ricinus communis]
 gb|EEF47996.1| hmg-CoA reductase, putative [Ricinus communis]
Length=586

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 91/133 (68%), Gaps = 8/133 (6%)
 Frame = +1

Query  97   RPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWRE  276
            RP   +A A + +K  K       +PK+SDALP+ LY+TN + FT+ F+V+YFLL RWRE
Sbjct  6    RPTNATAKAVQPLKV-KMVDDETCAPKSSDALPVSLYITNAICFTLFFSVVYFLLSRWRE  64

Query  277  KIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYR--ANQEGWDGEDXSNE  450
            KIR STPLHVVTLSE+AA+   IAS IYLLGFFG  FVQS + R   + + W+ ED    
Sbjct  65   KIRTSTPLHVVTLSEIAAIFGFIASFIYLLGFFGFDFVQSLILRPPTDDDVWEVEDA---  121

Query  451  QYLLEEDSRRGAC  489
              LL++DSRR +C
Sbjct  122  --LLKDDSRRFSC  132



>ref|XP_008242115.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Prunus mume]
Length=561

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 87/127 (69%), Gaps = 18/127 (14%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            M VRRR       P   S+   E  K+ KQ        KASDALPLPLYLTNGLFFT+ F
Sbjct  2    MGVRRR-------PQNPSSPG-EPAKSQKQNL------KASDALPLPLYLTNGLFFTLFF  47

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFL----YR  408
            TV YFLL RWREKIR STPLHV+TLSE+AAL SL ASVIYLLGFFGI FVQSF+     R
Sbjct  48   TVAYFLLHRWREKIRTSTPLHVLTLSEIAALFSLFASVIYLLGFFGIDFVQSFVSPNNAR  107

Query  409  ANQEGWD  429
            A  + W+
Sbjct  108  APHDPWN  114



>gb|KJB31954.1| hypothetical protein B456_005G215800 [Gossypium raimondii]
Length=584

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 90/128 (70%), Gaps = 2/128 (2%)
 Frame = +1

Query  112  SAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNS  291
            S    +++K  K+  L   + KASDALPLPLYLTN LFFT+ F+V+YFLL RWREKIR S
Sbjct  8    STKPVQSLKPTKKIPLEEDTGKASDALPLPLYLTNALFFTLFFSVVYFLLSRWREKIRTS  67

Query  292  TPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLL--E  465
            TPLHVVT SE+ A+ S  AS IYLLGFFGI FVQS +++ + + W  ED   +  +L  +
Sbjct  68   TPLHVVTFSEIIAILSFFASFIYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDDEVLLAK  127

Query  466  EDSRRGAC  489
            E++R+  C
Sbjct  128  EEARKVPC  135



>gb|AAC15475.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Tagetes erecta]
Length=574

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 95/144 (66%), Gaps = 22/144 (15%)
 Frame = +1

Query  61   MDVRRR-LSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMX  237
            MDVRRR L+ +  +P                   ++  PKASDALP PLYLTN LFF++ 
Sbjct  1    MDVRRRPLNHRTLKPTLAGG--------------VLEQPKASDALPFPLYLTNALFFSLF  46

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F+VMYFLL RWREKIRNS PLHV+TLSEL AL SL+ASV+YL+GFFGI FVQS ++R + 
Sbjct  47   FSVMYFLLHRWREKIRNSVPLHVLTLSELLALLSLVASVVYLVGFFGIDFVQS-IFRPSP  105

Query  418  EGWDGEDXSNEQYLLEEDSRRGAC  489
            + WD +D      LL++D     C
Sbjct  106  DTWDIDD------LLDQDKPIKPC  123



>gb|KJB31953.1| hypothetical protein B456_005G215700 [Gossypium raimondii]
Length=585

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +1

Query  100  PNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREK  279
            P   S    +++K  K+  L     KASDALPLPL+LTN LFFT+ F+V+YFLL RWREK
Sbjct  4    PRLYSTKPVQSLKPSKKIPLEEDHGKASDALPLPLHLTNALFFTLFFSVVYFLLSRWREK  63

Query  280  IRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYL  459
            IR STPLHVVT SE+ A+ S +AS IYLLGFFGI FVQS +++ + + W  ED   +  +
Sbjct  64   IRTSTPLHVVTFSEIIAILSFLASFIYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDDEV  123

Query  460  L--EEDSRRGAC  489
            L  +ED+R+  C
Sbjct  124  LLAKEDARKVPC  135



>ref|XP_010063168.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Eucalyptus grandis]
 gb|KCW70364.1| hypothetical protein EUGRSUZ_F03606 [Eucalyptus grandis]
Length=568

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 9/104 (9%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIR+S PLH VTL E+AA+ SLIAS
Sbjct  33   PKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRDSVPLHFVTLPEIAAIVSLIAS  92

Query  352  viyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRG  483
             IYLLGFFGI FVQ+F+ RA+ + W  ED       L++D  RG
Sbjct  93   FIYLLGFFGIDFVQTFIARASHDAW--ED-------LDDDVNRG  127



>ref|XP_008344180.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Malus domestica]
Length=563

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 87/126 (69%), Gaps = 16/126 (13%)
 Frame = +1

Query  64   DVRRR--LSK--QLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFT  231
            D+RRR  L K     RPN+ ++AA              S PKASDALPLPLYLTNGLF T
Sbjct  3    DLRRRPPLPKPHHHRRPNQTASAADPN-----------SYPKASDALPLPLYLTNGLFVT  51

Query  232  MXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLY-R  408
            + FTV YFLL RWREKIR STPLHVVTL E+AA+ SL ASVIYLLGFFGI FVQSF+  R
Sbjct  52   LFFTVAYFLLNRWREKIRTSTPLHVVTLXEIAAIFSLFASVIYLLGFFGIDFVQSFVAPR  111

Query  409  ANQEGW  426
               + W
Sbjct  112  TPHDDW  117



>ref|XP_011000847.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
isoform X1 [Populus euphratica]
 ref|XP_011000848.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
isoform X2 [Populus euphratica]
Length=631

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +1

Query  163  VSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasl  342
            ++ PKASDALPLPLY+TN LFFT+ F+V+YFLL RWREKIRNSTPLH++TLS++ A+ + 
Sbjct  69   LTGPKASDALPLPLYITNALFFTVFFSVVYFLLTRWREKIRNSTPLHLLTLSDIVAIFAF  128

Query  343  iasviyllGFFGIGFVQSFLYRANQEGW  426
            +AS IY+LGFFGI FVQS + R + + W
Sbjct  129  VASFIYMLGFFGIDFVQSLILRPSPDVW  156



>emb|CDY71344.1| BnaAnng37030D, partial [Brassica napus]
Length=356

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL AL +L+AS
Sbjct  32   PKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTVTELGALIALVAS  91

Query  352  viyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYL  459
             IYLLGFFGI FVQSF+ RA+    D  D  + + +
Sbjct  92   FIYLLGFFGIDFVQSFISRADTNDTDTNDFEDHRLV  127



>ref|XP_007204578.1| hypothetical protein PRUPE_ppa003613mg [Prunus persica]
 gb|EMJ05777.1| hypothetical protein PRUPE_ppa003613mg [Prunus persica]
Length=562

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            S PKASDALPLPLYLTNGLF T+ FTV YFLL RWREKIR STPLHVVTLSE+AA+ SL 
Sbjct  31   SYPKASDALPLPLYLTNGLFVTLFFTVAYFLLTRWREKIRTSTPLHVVTLSEIAAIFSLF  90

Query  346  asviyllGFFGIGFVQSFL  402
            ASVIYLLGFFGI FVQSF+
Sbjct  91   ASVIYLLGFFGIDFVQSFV  109



>gb|KJB31952.1| hypothetical protein B456_005G215600 [Gossypium raimondii]
Length=585

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +1

Query  100  PNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREK  279
            P   S    +++K  K+  L     KASDALPLPL+LTN LFFT+ F+V+YFLL RWREK
Sbjct  4    PRLYSTKPVQSLKPTKKIPLEEDHGKASDALPLPLHLTNALFFTLFFSVVYFLLSRWREK  63

Query  280  IRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYL  459
            IR STPLHVVT SE+ A+ S +AS IYLLGFFGI FVQS +++ + + W  ED   +  +
Sbjct  64   IRTSTPLHVVTFSEIIAILSFLASFIYLLGFFGIDFVQSLVFQPSPDVWIAEDEEEDDEV  123

Query  460  L--EEDSRRGAC  489
            L  +ED+R+  C
Sbjct  124  LLAKEDARKVPC  135



>sp|Q00583.1|HMDH3_HEVBR RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
3; Short=HMG-CoA reductase 3 [Hevea brasiliensis]
 gb|AAA33360.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hevea brasiliensis]
Length=586

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 93/143 (65%), Gaps = 6/143 (4%)
 Frame = +1

Query  64   DVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFT  243
            +VRRR  K + R +       E + +    + L     +  +LPL LYL N L F++ F+
Sbjct  3    EVRRRPPKHIVRKDHDG----EVLNSFSHGHHLPPLKPSDYSLPLSLYLANALVFSLFFS  58

Query  244  VMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEG  423
            V YFLL RWREKIR STPLH+VT  E+AAL  L+ASVIYLLGFFGIGFV SF  RA+ + 
Sbjct  59   VAYFLLHRWREKIRKSTPLHIVTFPEIAALICLVASVIYLLGFFGIGFVHSF-SRASTDS  117

Query  424  WDGEDXSNEQYLLEEDSR-RGAC  489
            WD E+  ++  +++ED+R  GAC
Sbjct  118  WDVEEYDDDNIIIKEDTRPTGAC  140



>emb|CAA48611.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Raphanus sativus]
Length=573

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 83/119 (70%), Gaps = 3/119 (3%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MD+RRR  K     N+      +     K    L S PKASDALPLPLYLTN +FFT+ F
Sbjct  1    MDIRRRPPKPPVNSNRFLDNRSDDDDRRKT---LTSPPKASDALPLPLYLTNAVFFTLFF  57

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            +V Y+LL RWR+KIR +TPLHVVT++EL A+ +LIAS IYLLGFFGI FVQSF+ R + 
Sbjct  58   SVAYYLLHRWRDKIRYNTPLHVVTVTELGAIVALIASFIYLLGFFGIDFVQSFISRPDS  116



>ref|XP_010094509.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Morus notabilis]
 gb|EXB56263.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Morus notabilis]
Length=548

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 86/126 (68%), Gaps = 19/126 (15%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MD+RRR SK   R  K S A                 PKASDALPLPLYLTN +FFT+ F
Sbjct  1    MDLRRRPSKLQSR--KPSPA----------------PPKASDALPLPLYLTNAVFFTLFF  42

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWR+KIRNSTPLHVVT  E+AA+ SLIAS IYLLGFFGI FVQSF+  + + 
Sbjct  43   SVAYYLLHRWRDKIRNSTPLHVVTFPEIAAIVSLIASFIYLLGFFGIDFVQSFII-SPRA  101

Query  421  GWDGED  438
             +D ED
Sbjct  102  SYDEED  107



>gb|EPS64817.1| hypothetical protein M569_09963, partial [Genlisea aurea]
Length=531

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 80/101 (79%), Gaps = 6/101 (6%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLYLTNG+FFT+ F+V YFLL RWREKIR+STPLHV+TLSELA +  LIAS 
Sbjct  1    KASDALPLPLYLTNGIFFTLFFSVAYFLLHRWREKIRSSTPLHVLTLSELAGVICLIASF  60

Query  355  iyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSR  477
            IYLLGFFGI FVQSF+ +         D  ++ ++++E+S+
Sbjct  61   IYLLGFFGIDFVQSFISKPEA------DEDHQNFIIQEESK  95



>emb|CDY20406.1| BnaC02g24100D [Brassica napus]
Length=581

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL AL +L+AS
Sbjct  32   PKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTVTELGALIALVAS  91

Query  352  viyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYL  459
             IYLLGFFGI FVQSF+ RA+    D  D  + + +
Sbjct  92   FIYLLGFFGIDFVQSFISRADTNDTDANDFEDHRLV  127



>ref|XP_006409321.1| hypothetical protein EUTSA_v10022614mg [Eutrema salsugineum]
 gb|ESQ50774.1| hypothetical protein EUTSA_v10022614mg [Eutrema salsugineum]
Length=582

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 92/140 (66%), Gaps = 11/140 (8%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR S     P++ +  A   ++        V+S KASDALPLPLYLTN +F  + F
Sbjct  1    MDVRRRRSPAKL-PSQNNDVASSNVE--------VTSRKASDALPLPLYLTNTVFLALFF  51

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
              +YFLL RWREKIRNSTPLHVV LSE++AL   +AS IYLLGFFG+ FVQS  +R++ E
Sbjct  52   ATVYFLLSRWREKIRNSTPLHVVDLSEISALFGFVASCIYLLGFFGVDFVQSVFFRSSSE  111

Query  421  GWDGEDXSNEQYLLEEDSRR  480
              D     ++  +L ED R+
Sbjct  112  --DDVYEIDDHLVLNEDLRK  129



>gb|KJB31951.1| hypothetical protein B456_005G215500 [Gossypium raimondii]
Length=585

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = +1

Query  127  ETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHV  306
            +++K  K+  L     KASDALPLP +LTN +FFT+ F+V+YFLL RWREKIR STPLHV
Sbjct  13   QSLKPTKKIPLEEDPTKASDALPLPFHLTNAVFFTLFFSVVYFLLSRWREKIRTSTPLHV  72

Query  307  VTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLL--EEDSRR  480
            VT SE+ A+ +  AS IYLLGFFG+ FVQS ++R + + W  ED   E  +L  +ED+R+
Sbjct  73   VTFSEIIAILAFFASFIYLLGFFGLDFVQSLVFRPSSDDWIAEDEEEENEVLLAKEDARK  132

Query  481  GAC  489
              C
Sbjct  133  VPC  135



>gb|EYU40486.1| hypothetical protein MIMGU_mgv1a003590mg [Erythranthe guttata]
Length=575

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 4/111 (4%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            S KASDALPLPLYLTN +FFT+ F+V+Y+LL+RWREKIRNSTPLHVVTLSE+AA+ + +A
Sbjct  21   SVKASDALPLPLYLTNAVFFTLFFSVVYYLLLRWREKIRNSTPLHVVTLSEIAAIVTFVA  80

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXSN----EQYLLEEDSRRGAC  489
            S IYLLGFFGIGFVQS +   + +  D  D       ++ +L+ED+R   C
Sbjct  81   SFIYLLGFFGIGFVQSLVIPRSSDEEDLMDEDEIIDYDRLMLKEDTRAVPC  131



>gb|KJB47156.1| hypothetical protein B456_008G013000 [Gossypium raimondii]
Length=512

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 2/130 (2%)
 Frame = +1

Query  106  KGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIR  285
            + S    +++K  K   +     KASDALPLPL+L+N +FFT+ F+ +YFLL  WREKIR
Sbjct  6    RSSTKPVQSLKPTKTVSVDEDLTKASDALPLPLHLSNAVFFTLFFSAVYFLLSHWREKIR  65

Query  286  NSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSN--EQYL  459
             STPL VVT SE+ A+ + +AS IYLLGFFGI FVQS + R   E W+ ED     +  L
Sbjct  66   TSTPLSVVTFSEIIAILAFVASFIYLLGFFGIDFVQSLILRPQTEVWNSEDDDEVADVLL  125

Query  460  LEEDSRRGAC  489
             +ED+R+  C
Sbjct  126  HKEDARKVPC  135



>ref|XP_007043108.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007043109.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007043110.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 gb|EOX98939.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 gb|EOX98940.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 gb|EOX98941.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
Length=584

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLY+TN +FFT+ F+V+YFLL RWREKIR STPLHVV  SE+AA+ +L+AS 
Sbjct  28   KASDALPLPLYITNAVFFTLFFSVVYFLLSRWREKIRTSTPLHVVNFSEIAAIFALVASF  87

Query  355  iyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLL--EEDSRRGAC  489
            IYLLGFFGI FVQS + R + + W+ ED   E  +L  +ED+R+  C
Sbjct  88   IYLLGFFGIDFVQSLILRPSADVWNSEDDEEENEVLLRKEDARKVPC  134



>ref|XP_009128179.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Brassica rapa]
Length=581

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIR +TPLHVVT++EL AL +L+AS
Sbjct  32   PKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTVTELGALIALVAS  91

Query  352  viyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYL  459
             IYLLGFFGI FVQSF+ RA+    D  D  + + +
Sbjct  92   FIYLLGFFGIDFVQSFISRADTNDTDTNDFEDHRLV  127



>gb|EYU36597.1| hypothetical protein MIMGU_mgv1a003864mg [Erythranthe guttata]
Length=559

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 95/137 (69%), Gaps = 16/137 (12%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MD+RRR  K   RP                     SSPKASDALPLPLYLTNG+FFT+ F
Sbjct  1    MDIRRRPPKPSLRP-------------QVPPPPPSSSPKASDALPLPLYLTNGVFFTLFF  47

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V YFLL RWR+KIRNS PLHV+TLSELAA+ +LI+S IYLLGFFGI FVQSF+ +++ +
Sbjct  48   SVAYFLLHRWRDKIRNSVPLHVLTLSELAAIITLISSFIYLLGFFGIDFVQSFISKSDSD  107

Query  421  GWDGEDXSNEQYLLEED  471
                +   ++++++EED
Sbjct  108  DDSPQ---HQRFIIEED  121



>gb|AEO12148.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camellia sinensis]
Length=590

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 93/133 (70%), Gaps = 17/133 (13%)
 Frame = +1

Query  130  TIKAHKQQYLLVSSP----------KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREK  279
            +IK  +QQ+  + SP          KAS+A+PLPLYLTNG+FFT+ F+V+Y+LL R REK
Sbjct  4    SIKPIQQQHHQIPSPAALKPLSKGTKASEAVPLPLYLTNGVFFTLFFSVVYYLLSRSREK  63

Query  280  IRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSN----  447
            IRNSTPLH++TLSE+AA+ + +AS IYLLGFFGIGFVQS   R++ +   G D       
Sbjct  64   IRNSTPLHLITLSEIAAIVAFVASFIYLLGFFGIGFVQSLFLRSSHDDVWGSDDDLDLQE  123

Query  448  ---EQYLLEEDSR  477
               +Q LL++D+R
Sbjct  124  QDVDQILLKDDTR  136



>gb|AEZ55673.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 4 [Salvia miltiorrhiza]
Length=550

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            ++P+ASDALPLPL+LTNG+FFT+ F+V YFLL RWREKIR+S PLHV+TLSELAA+ SLI
Sbjct  22   AAPRASDALPLPLFLTNGIFFTLFFSVAYFLLHRWREKIRSSVPLHVLTLSELAAVLSLI  81

Query  346  asviyllGFFGIGFVQSFLYRANQE  420
            AS IYLLGFFGI FVQSF+ +++ E
Sbjct  82   ASFIYLLGFFGIDFVQSFISKSDGE  106



>gb|KJB47155.1| hypothetical protein B456_008G013000 [Gossypium raimondii]
Length=585

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 2/130 (2%)
 Frame = +1

Query  106  KGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIR  285
            + S    +++K  K   +     KASDALPLPL+L+N +FFT+ F+ +YFLL  WREKIR
Sbjct  6    RSSTKPVQSLKPTKTVSVDEDLTKASDALPLPLHLSNAVFFTLFFSAVYFLLSHWREKIR  65

Query  286  NSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSN--EQYL  459
             STPL VVT SE+ A+ + +AS IYLLGFFGI FVQS + R   E W+ ED     +  L
Sbjct  66   TSTPLSVVTFSEIIAILAFVASFIYLLGFFGIDFVQSLILRPQTEVWNSEDDDEVADVLL  125

Query  460  LEEDSRRGAC  489
             +ED+R+  C
Sbjct  126  HKEDARKVPC  135



>gb|AAD03789.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Morus alba]
Length=548

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 92/140 (66%), Gaps = 20/140 (14%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            M++RRR SK               I++ K      + PKASDALPLPLYLTN +FFT+ F
Sbjct  1    MELRRRPSK---------------IQSRKPSQ---APPKASDALPLPLYLTNAVFFTLFF  42

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWR+KIRNSTPLHVVT  E+AA+ SLIAS IYLLGFFGI FVQSF+   +  
Sbjct  43   SVAYYLLHRWRDKIRNSTPLHVVTFPEIAAIVSLIASFIYLLGFFGIDFVQSFII--SPR  100

Query  421  GWDGEDXSNEQYLLEEDSRR  480
              D E+  +   ++ +++ R
Sbjct  101  ASDDEEDDDLHVVVRDNACR  120



>gb|ADC44451.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Salvia miltiorrhiza]
Length=550

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            ++ KASDALPLPLYLTNG+FFT+ F+V+YFLL+RWREKIRNS PLHVVTLSE++A+   +
Sbjct  9    AAAKASDALPLPLYLTNGVFFTLFFSVVYFLLLRWREKIRNSVPLHVVTLSEISAIVVFV  68

Query  346  asviyllGFFGIGFVQSFL  402
            AS IYLLGFFGI FVQS +
Sbjct  69   ASFIYLLGFFGITFVQSLV  87



>gb|KDO38001.1| hypothetical protein CISIN_1g007956mg [Citrus sinensis]
Length=583

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = +1

Query  190  LPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllG  369
            LPLPLY+ N LFFT+ FTV+Y+LL RWREKIRNSTPLHVVTLSE+ A+ + +AS IYLLG
Sbjct  28   LPLPLYIINALFFTLFFTVVYYLLSRWREKIRNSTPLHVVTLSEMVAIVAFVASCIYLLG  87

Query  370  FFGIGFVQSFLYRANQEGWDGEDXSNE--QYLLEEDSRRGAC  489
            FFGI FVQS L R + + W  ED   E    ++++DSR   C
Sbjct  88   FFGIDFVQSIL-RPSADVWASEDLEEEDSHVIIKDDSRNLPC  128



>ref|XP_006422382.1| hypothetical protein CICLE_v10028082mg [Citrus clementina]
 gb|ESR35622.1| hypothetical protein CICLE_v10028082mg [Citrus clementina]
Length=583

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = +1

Query  190  LPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllG  369
            LPLPLY+ N LFFT+ FTV+Y+LL RWREKIRNSTPLHVVTLSE+ A+ + +AS IYLLG
Sbjct  28   LPLPLYIINALFFTLFFTVVYYLLSRWREKIRNSTPLHVVTLSEMVAIVAFVASCIYLLG  87

Query  370  FFGIGFVQSFLYRANQEGWDGEDXSNE--QYLLEEDSRRGAC  489
            FFGI FVQS L R + + W  ED   E    ++++DSR   C
Sbjct  88   FFGIDFVQSIL-RPSADVWASEDLEEEDSHVIIKDDSRNLPC  128



>ref|XP_006486561.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Citrus sinensis]
Length=583

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 76/102 (75%), Gaps = 3/102 (3%)
 Frame = +1

Query  190  LPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllG  369
            LPLPLY+ N LFFT+ FTV+Y+LL RWREKIRNSTPLHVVTLSE+ A+ + +AS IYLLG
Sbjct  28   LPLPLYIINALFFTLFFTVVYYLLSRWREKIRNSTPLHVVTLSEMVAIVAFVASCIYLLG  87

Query  370  FFGIGFVQSFLYRANQEGWDGEDXSNE--QYLLEEDSRRGAC  489
            FFGI FVQS L R + + W  ED   E    ++++DSR   C
Sbjct  88   FFGIDFVQSIL-RPSADVWASEDLEEEDSHVIIKDDSRNLPC  128



>gb|ACT65734.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Salvia miltiorrhiza]
Length=550

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  166  SSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasli  345
            ++ KASDALPLPLYLTNG+FFT+ F+V+YFLL+RWREKIRNS PLHVVTLSE++A+   +
Sbjct  9    AAAKASDALPLPLYLTNGVFFTLFFSVVYFLLLRWREKIRNSVPLHVVTLSEISAIVVFV  68

Query  346  asviyllGFFGIGFVQSFL  402
            AS IYLLGFFG+ FVQS +
Sbjct  69   ASFIYLLGFFGVTFVQSLV  87



>ref|XP_011074058.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Sesamum indicum]
Length=555

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 81/105 (77%), Gaps = 7/105 (7%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLYLTN +FFT+ F+V YFLL RWR+KIRNS PLHV+TLSELAA+ SLIAS 
Sbjct  25   KASDALPLPLYLTNTIFFTLFFSVAYFLLHRWRDKIRNSVPLHVLTLSELAAVLSLIASF  84

Query  355  iyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            IYLLGFFGI FVQSF+ ++        D  N+Q ++ E +R+  C
Sbjct  85   IYLLGFFGIDFVQSFISKSE------SDDENQQCVVHE-ARKSLC  122



>gb|AGA83240.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aquilaria sinensis]
Length=582

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +1

Query  145  KQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlsel  324
            KQ  L   S KASDALPLPL++TN + FT+ F V+YFLL RWREKIRNSTPLH+++ SE+
Sbjct  15   KQLALDEGSTKASDALPLPLHVTNTVSFTLLFWVVYFLLTRWREKIRNSTPLHMISFSEM  74

Query  325  aalasliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
             A+ +L+ S+IYLLGFFGI FVQS + R + + W  +   ++  L +ED+R+  C
Sbjct  75   LAIFALLVSLIYLLGFFGIEFVQSII-RPSSDMWADDGEEDDIALQKEDARKVPC  128



>ref|XP_008392877.1| PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-methylglutaryl-coenzyme 
A reductase 1-like, partial [Malus domestica]
Length=561

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 76/97 (78%), Gaps = 6/97 (6%)
 Frame = +1

Query  112  SAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNS  291
            ++AA E IK+  Q        KASDALP PLYLTNGLFFT  F V YFLL RWREKIR+S
Sbjct  9    ASAAGEPIKSDNQLL------KASDALPXPLYLTNGLFFTXFFAVAYFLLNRWREKIRSS  62

Query  292  TPLHVVTlselaalasliasviyllGFFGIGFVQSFL  402
            TPLHVVTLSELAAL SL AS+IYLLGFFGI FVQSF+
Sbjct  63   TPLHVVTLSELAALFSLFASIIYLLGFFGIDFVQSFV  99



>gb|KJB77453.1| hypothetical protein B456_012G138100 [Gossypium raimondii]
Length=582

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = +1

Query  178  ASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasvi  357
            +S+ALPL L+LTN +FF++ F+V+YFLL RWREKIR STPLH+V LSE+ A+ + IAS +
Sbjct  32   SSEALPLSLHLTNAVFFSLFFSVVYFLLSRWREKIRTSTPLHLVNLSEIVAIFAFIASFV  91

Query  358  yllGFFGIGFVQSFLYRANQEGWDGED-XSNEQYLLEEDSRRGAC  489
            YLLGFFGI FV S + R + + W+ ED   NE  L +ED+R+  C
Sbjct  92   YLLGFFGIDFVHSLILRPSTDLWNSEDEEENEALLRKEDARKIPC  136



>emb|CAA48610.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Raphanus sativus]
Length=583

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIR+STPLHV+T++EL AL +L+AS 
Sbjct  29   KASDALPLPLYLTNAVFFTLFFSVAYYLLRRWRDKIRHSTPLHVITITELGALLALVASF  88

Query  355  iyllGFFGIGFVQSFLYRAN  414
            IYLLGFFGI FVQSF+ RA+
Sbjct  89   IYLLGFFGIDFVQSFISRAD  108



>dbj|BAF98281.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
Length=606

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 95/147 (65%), Gaps = 16/147 (11%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLL-VSSPKASDALPLPLYLTNGLFFTMX  237
            MDVRRR       P  G     +TI + K + +   S+ K SDALPLPLYL N L FT+ 
Sbjct  1    MDVRRR-------PTSG-----KTIHSVKPKSVEDESAQKPSDALPLPLYLINALCFTVF  48

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F V+YFLL RWREKIR STPLHVV LSE+AA+ + +AS IYLLGFFGI FVQS + R   
Sbjct  49   FYVVYFLLSRWREKIRTSTPLHVVALSEIAAIVAFVASFIYLLGFFGIDFVQSLILRPPT  108

Query  418  EGW---DGEDXSNEQYLLEEDSRRGAC  489
            + W   D E+ + E  +L ED+R+  C
Sbjct  109  DMWAVDDDEEETEEGIVLREDTRKLPC  135



>ref|XP_002528521.1| hmg-CoA reductase, putative [Ricinus communis]
 gb|EEF33833.1| hmg-CoA reductase, putative [Ricinus communis]
Length=576

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 87/122 (71%), Gaps = 11/122 (9%)
 Frame = +1

Query  64   DVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFT  243
            +VRRR +  +  P+  SAA        +  + + S+  +SDALPLPLYL NG+FF++ F+
Sbjct  3    EVRRRPANHV--PHHDSAAG-------EPPFPMKST--SSDALPLPLYLANGVFFSLFFS  51

Query  244  VMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEG  423
            V YFLL RWREKIRNSTPLH++T  E+AAL  L+ASVIYLLGFFGIGFVQSF  +   E 
Sbjct  52   VAYFLLHRWREKIRNSTPLHILTFPEIAALFCLVASVIYLLGFFGIGFVQSFTSKDIVED  111

Query  424  WD  429
            +D
Sbjct  112  YD  113



>ref|XP_008357165.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Malus domestica]
Length=501

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            +ASD LPLPLYLTNGLF T+ FTV YFLL RWREKIR STPLHVVTLSE+AA+ SL ASV
Sbjct  18   QASDVLPLPLYLTNGLFVTLFFTVAYFLLNRWREKIRTSTPLHVVTLSEIAAIFSLFASV  77

Query  355  iyllGFFGIGFVQSFLY-RANQEGW  426
            IYL+GFFGI FVQSF+  R   + W
Sbjct  78   IYLIGFFGIDFVQSFVAPRTPHDDW  102



>gb|AFU75319.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aquilaria sinensis]
Length=572

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 81/128 (63%), Gaps = 12/128 (9%)
 Frame = +1

Query  61   MDVRRRLSK--QLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTM  234
            M+VRR+LS+  Q  +P+K         +      +    PKASDA+P PLY+ N LF T+
Sbjct  1    MEVRRKLSRPVQSLQPSK---------QTSLHDAVDAQPPKASDAVPFPLYVVNALFLTL  51

Query  235  XFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRAN  414
             F V+YFLL RWREKIRNSTPLH+V  SE+ A+ +   S IYLLGFFGI F+Q F+ R  
Sbjct  52   FFWVVYFLLARWREKIRNSTPLHIVNFSEMVAIVAFFVSFIYLLGFFGIDFIQ-FILRPA  110

Query  415  QEGWDGED  438
             + W  E+
Sbjct  111  SDIWTDEE  118



>ref|XP_004300101.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Fragaria vesca subsp. vesca]
Length=568

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLYLTN +FFT+ F+V Y+LL RWR+KIR STPLHVV LSELAA+ SLIAS 
Sbjct  42   KASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRTSTPLHVVNLSELAAILSLIASF  101

Query  355  iyllGFFGIGFVQSFLYRANQ  417
            IYLLGFFGI FVQSF+ RA+ 
Sbjct  102  IYLLGFFGIDFVQSFISRASH  122



>ref|XP_011458110.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Fragaria vesca subsp. vesca]
Length=578

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            K SDA+ LPLY+TN +FFT+ F+V+YFLL  WREKIR +TPLH++ LSE+ A+ +L+AS 
Sbjct  21   KPSDAMSLPLYITNAVFFTLFFSVVYFLLTSWREKIRTNTPLHMIDLSEVVAILALVASF  80

Query  355  iyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            IYLLGFFG  FVQS   + + + W  +D  +E  +L+ED+R+  C
Sbjct  81   IYLLGFFGFDFVQSLFLQPSNDIWAADDDEDE-IMLKEDARKVPC  124



>emb|CBI37502.3| unnamed protein product [Vitis vinifera]
Length=551

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 88/143 (62%), Gaps = 32/143 (22%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR   +  R +  ++A    +K     +L     K SDALPLPLYLTNG+FF + F
Sbjct  1    MDVRRRPPMRSVRQSSTTSAGEPPVK-----HL-----KPSDALPLPLYLTNGIFFALFF  50

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V YFLL RWREKIR STPLHV+TLSE+AA+ S++ASVIYLLGFFG+ FVQS        
Sbjct  51   SVAYFLLHRWREKIRTSTPLHVLTLSEIAAIVSMLASVIYLLGFFGVDFVQSL-------  103

Query  421  GWDGEDXSNEQYLLEEDSRRGAC  489
                           EDSR G C
Sbjct  104  ---------------EDSRPGPC  111



>gb|ABV25901.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Antirrhinum 
majus]
Length=548

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +1

Query  160  LVSSPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalas  339
            +VS  KASDALP+PLYLTNG+FF + F+V YFLL +WR+KIRNS PLHV+TLSELAA+  
Sbjct  19   VVSWAKASDALPVPLYLTNGIFFCLFFSVAYFLLHQWRDKIRNSIPLHVLTLSELAAIIC  78

Query  340  liasviyllGFFGIGFVQSFLYRANQE  420
            LIAS IYLLGFFGI FVQSF+ ++  +
Sbjct  79   LIASFIYLLGFFGIDFVQSFISKSESD  105



>gb|AGB06349.1| HMG-CoA reductase [Camellia sinensis]
Length=549

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVS-SPKASDALPLPLYLTNGLFFTMX  237
            MDVRRR       P   +    +  +  ++    +  +PKASDALPLPLYLTN +F T+ 
Sbjct  1    MDVRRR------APGPATTVVGDHQQQKQKSQSSIGPTPKASDALPLPLYLTNCIFSTLF  54

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRA  411
            FT  Y+LL RWR+KI +STPLHVVTL EL A+ SLIAS IYLLGFFGI FVQSF+ RA
Sbjct  55   FTASYYLLERWRDKILSSTPLHVVTLFELVAIVSLIASFIYLLGFFGIDFVQSFISRA  112



>gb|KDP24920.1| hypothetical protein JCGZ_24298 [Jatropha curcas]
Length=572

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 90/142 (63%), Gaps = 12/142 (8%)
 Frame = +1

Query  67   VRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXFTV  246
            VR+R SK + +   G     E +   +  +L     K +D  PLPLYL N +FF + F+V
Sbjct  5    VRQRSSKPVRKDCAG-----EPLNPFRHNHL--PPLKVTDPFPLPLYLANAVFFFLFFSV  57

Query  247  MYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQEGW  426
             YFLL RWREKIRNSTPLH+V   E+AAL  L+ASVIYLLGFFGIGFV SF  + + + W
Sbjct  58   AYFLLHRWREKIRNSTPLHIVNFPEIAALVCLVASVIYLLGFFGIGFVHSFTSKVSTDAW  117

Query  427  DGEDXSNEQYLLEEDSRR-GAC  489
            + E    E  ++++D+R  G C
Sbjct  118  EIE----EYDVVKKDTRSPGPC  135



>ref|XP_010029551.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Eucalyptus grandis]
 gb|KCW56467.1| hypothetical protein EUGRSUZ_I02200 [Eucalyptus grandis]
Length=603

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +1

Query  172  PKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslias  351
            PKASDALPLPLYLTN +F  + F+V  FLL RWREKI +STPLHVVTLSEL AL SL+AS
Sbjct  47   PKASDALPLPLYLTNAVFLALFFSVACFLLRRWREKILDSTPLHVVTLSELTALVSLLAS  106

Query  352  viyllGFFGIGFVQSFLYRA  411
            +IYLLGFFGIG VQSF+ R+
Sbjct  107  LIYLLGFFGIGLVQSFVSRS  126



>gb|KDP47034.1| hypothetical protein JCGZ_10761 [Jatropha curcas]
Length=596

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +1

Query  178  ASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasvi  357
            AS+ALPL LYLTN   F++ F V+YFLL RWREKIR STPLHVV+LSE++A+ + IAS +
Sbjct  30   ASEALPLSLYLTNAFSFSVFFWVVYFLLSRWREKIRTSTPLHVVSLSEISAIVAFIASFV  89

Query  358  yllGFFGIGFVQSFLYRANQEGWDGED------XSNEQYLLEEDSRRGAC  489
            YLLGFFGI FVQS + R   + W  +D       + E  LL+EDS +  C
Sbjct  90   YLLGFFGIDFVQSLILRPPTDVWAADDDDEVEETAAEGILLKEDSSKLPC  139



>ref|XP_007046440.1| Hydroxy methylglutaryl CoA reductase 1 isoform 1 [Theobroma cacao]
 gb|EOX90597.1| Hydroxy methylglutaryl CoA reductase 1 isoform 1 [Theobroma cacao]
Length=569

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 85/123 (69%), Gaps = 20/123 (16%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSP---KASDA-LPLPLYLTNGLFF  228
            MDVRRR       P+  S          ++  L +  P   KASDA LPLPLYLTNG+FF
Sbjct  1    MDVRRR-------PSATSG---------EEALLKLGEPLKVKASDADLPLPLYLTNGIFF  44

Query  229  TMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYR  408
             + F+V YFLL RWR+KIR  +PLHV+TLSE+AAL SL+AS+IYLLGFFGI FVQSF++R
Sbjct  45   ALFFSVAYFLLHRWRDKIRTCSPLHVLTLSEIAALVSLVASIIYLLGFFGIDFVQSFIFR  104

Query  409  ANQ  417
             + 
Sbjct  105  TSH  107



>ref|XP_007046441.1| Hydroxy methylglutaryl CoA reductase 1 isoform 2 [Theobroma cacao]
 gb|EOX90598.1| Hydroxy methylglutaryl CoA reductase 1 isoform 2 [Theobroma cacao]
Length=564

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 85/123 (69%), Gaps = 20/123 (16%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSP---KASDA-LPLPLYLTNGLFF  228
            MDVRRR       P+  S          ++  L +  P   KASDA LPLPLYLTNG+FF
Sbjct  1    MDVRRR-------PSATSG---------EEALLKLGEPLKVKASDADLPLPLYLTNGIFF  44

Query  229  TMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYR  408
             + F+V YFLL RWR+KIR  +PLHV+TLSE+AAL SL+AS+IYLLGFFGI FVQSF++R
Sbjct  45   ALFFSVAYFLLHRWRDKIRTCSPLHVLTLSEIAALVSLVASIIYLLGFFGIDFVQSFIFR  104

Query  409  ANQ  417
             + 
Sbjct  105  TSH  107



>gb|AAM19212.1|AF495909_1 3-hydroxy-3-methylglutaryl coenzyme A [Malus domestica]
Length=92

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MDVRRR +         S      +  H+    +V + KASDALPLPLYLTN +FFT+ F
Sbjct  1    MDVRRRSTMDTPATKARSGPMKVKVVDHEGDVGVVGA-KASDALPLPLYLTNAVFFTLFF  59

Query  241  TVMYFLLVRWREKIRNSTPLHVV  309
            +V+YFLL RWREKIR STPLHVV
Sbjct  60   SVVYFLLTRWREKIRTSTPLHVV  82



>ref|XP_002283183.2| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vitis 
vinifera]
Length=641

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 97/156 (62%), Gaps = 19/156 (12%)
 Frame = +1

Query  43   RFSPLR-----MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSP-KASDALPLPL  204
            RFSPL      MDVRRR          GS  A    K   +  + V  P KASDALPLPL
Sbjct  56   RFSPLVNPSAVMDVRRR--------PVGSVEAKPNGKPLVEVDVDVHDPIKASDALPLPL  107

Query  205  YLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIG  384
            YL N +FF + F+V+YFLL RWREKIR STPLHVVTLSE+AA+ + + S I+LLGFFGI 
Sbjct  108  YLANAVFFGVFFSVVYFLLTRWREKIRTSTPLHVVTLSEIAAIVTFMGSCIFLLGFFGID  167

Query  385  FVQSFLYRANQEG-WDGEDXSNEQYLLEEDSRRGAC  489
            FVQ F+ R   +  WD ED      +++ED+R   C
Sbjct  168  FVQGFIARPGHDNEWDAED----DIIVKEDARAVPC  199



>ref|XP_010548185.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Tarenaya hassleriana]
Length=583

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 84/115 (73%), Gaps = 8/115 (7%)
 Frame = +1

Query  163  VSSP-KASDA---LPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaa  330
            V +P KASDA   +PLPL LTN +F ++ F V+YFLL RWREKIR S PLHVV LSE+ A
Sbjct  22   VDAPSKASDAFPQVPLPLSLTNTIFLSLFFAVVYFLLSRWREKIRRSAPLHVVDLSEILA  81

Query  331  lasliasviyllGFFGIGFVQSFLYR--ANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            + + +AS IYLLGFFG+ FVQ+ ++R  ++++ W  +D   ++ +L+EDSR+  C
Sbjct  82   IIAFVASFIYLLGFFGVDFVQALIFRPSSDEDVWASDDV--DRLVLKEDSRKIPC  134



>gb|AAL28015.2|AF389879_1 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Andrographis 
paniculata]
 gb|AAR03707.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Andrographis 
paniculata]
Length=595

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +1

Query  166  SSP--KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalas  339
            SSP  KASDALPLPLYLTN +FF + F+ +Y+LL++WREKIR+S PLHVVTLSE+ ++ S
Sbjct  24   SSPPTKASDALPLPLYLTNAVFFALFFSSVYYLLLQWREKIRSSIPLHVVTLSEICSIVS  83

Query  340  liasviyllGFFGIGFVQSFL  402
             +AS IYLLGFFGIGFVQS +
Sbjct  84   FVASFIYLLGFFGIGFVQSLV  104



>emb|CAN72217.1| hypothetical protein VITISV_039086 [Vitis vinifera]
Length=575

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 92/145 (63%), Gaps = 14/145 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSP-KASDALPLPLYLTNGLFFTMX  237
            MDVRRR          GS  A    K   +  + V  P KASDALPLPLYL N +FF + 
Sbjct  1    MDVRRR--------PVGSVKAKPNGKPLVEVDVDVHDPIKASDALPLPLYLANAVFFGVF  52

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F+V+YFLL RWREKIR STPLHVVTLSE+AA+ + + S IYLLGFFGI FVQ F+ R   
Sbjct  53   FSVVYFLLTRWREKIRTSTPLHVVTLSEIAAIVTFMGSCIYLLGFFGIDFVQGFIARPGH  112

Query  418  EG-WDGEDXSNEQYLLEEDSRRGAC  489
            +  WD ED      +++ED+R   C
Sbjct  113  DNEWDAED----DIIVKEDARTVPC  133



>gb|KFK40113.1| hypothetical protein AALP_AA3G332100 [Arabis alpina]
Length=541

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 80/126 (63%), Gaps = 22/126 (17%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MD+RRR+  +L     G                 +SS KASDALPLPLY+TN +F ++ F
Sbjct  1    MDIRRRIPTKL----DGE----------------ISSSKASDALPLPLYITNTVFLSLFF  40

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
              +YFLL RWREKIRNSTPLHVV LSE++AL + +AS IYLLGFFG+  +  F   ++ E
Sbjct  41   ATVYFLLSRWREKIRNSTPLHVVDLSEISALITFLASFIYLLGFFGVDLL--FRSSSDDE  98

Query  421  GWDGED  438
             W  +D
Sbjct  99   AWTTDD  104



>ref|XP_008242335.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like, 
partial [Prunus mume]
Length=534

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  190  LPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllG  369
            LPLPLYLTNGLF T+ FTV YFLL RWREKIR S PLHVVTLSE+AA+ SL ASVIYLLG
Sbjct  11   LPLPLYLTNGLFVTLFFTVAYFLLTRWREKIRTSAPLHVVTLSEIAAIFSLFASVIYLLG  70

Query  370  FFGIGFVQSFL  402
            FFGI FVQSF+
Sbjct  71   FFGIDFVQSFV  81



>gb|ABV25902.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Antirrhinum 
majus]
Length=555

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +1

Query  187  ALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyll  366
            ALPLPLYLTNG+FFT+ F+V YFLL RWR+KIRNS PLHV+ LSELAA+  LIAS IYLL
Sbjct  29   ALPLPLYLTNGIFFTLFFSVAYFLLHRWRDKIRNSIPLHVLNLSELAAIICLIASFIYLL  88

Query  367  GFFGIGFVQSFLYRANQEGWDG  432
            GFFGI FVQSF+ +++     G
Sbjct  89   GFFGIDFVQSFINKSDDHHHHG  110



>gb|AGF87122.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 [Litchi chinensis]
Length=545

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +1

Query  169  SPKASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalaslia  348
            + KASDALPLPLY TN LFFT+ F+V YFLL RWR+KIR  +PL+V+T SE+AAL  LIA
Sbjct  20   TTKASDALPLPLYRTNSLFFTLFFSVAYFLLHRWRDKIRTGSPLNVLTFSEIAALVCLIA  79

Query  349  sviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQY  456
            SVIYLLGFFGI FVQSF+ R           + EQ+
Sbjct  80   SVIYLLGFFGIDFVQSFISRQTDTTCYVHHQTQEQF  115



>gb|AAA33359.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hevea brasiliensis]
Length=112

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 72/113 (64%), Gaps = 6/113 (5%)
 Frame = +1

Query  64   DVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASD-ALPLPLYLTNGLFFTMXF  240
            +VRRR  K + R +            H    L     K SD +LPL LYL N L F++ F
Sbjct  3    EVRRRPPKHIVRKDHDGEVLNSFSHGHHLPPL-----KPSDYSLPLSLYLANALVFSLFF  57

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSF  399
            +V YFLL RWREKIR STPLH+VT  E+AAL  L+ASVIYLLGFFGIGFV SF
Sbjct  58   SVAYFLLHRWREKIRKSTPLHIVTFPEIAALICLVASVIYLLGFFGIGFVHSF  110



>emb|CBI37717.3| unnamed protein product [Vitis vinifera]
Length=553

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 91/141 (65%), Gaps = 14/141 (10%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSP-KASDALPLPLYLTNGLFFTMX  237
            MDVRRR          GS  A    K   +  + V  P KASDALPLPLYL N +FF + 
Sbjct  1    MDVRRR--------PVGSVEAKPNGKPLVEVDVDVHDPIKASDALPLPLYLANAVFFGVF  52

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F+V+YFLL RWREKIR STPLHVVTLSE+AA+ + + S I+LLGFFGI FVQ F+ R   
Sbjct  53   FSVVYFLLTRWREKIRTSTPLHVVTLSEIAAIVTFMGSCIFLLGFFGIDFVQGFIARPGH  112

Query  418  EG-WDGEDXSNEQYLLEEDSR  477
            +  WD ED      +++ED+R
Sbjct  113  DNEWDAED----DIIVKEDAR  129



>gb|AEW07959.1| hypothetical protein 0_15354_01, partial [Pinus radiata]
 gb|AFG57107.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57108.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57109.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57110.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57111.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57112.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57113.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57114.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57115.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57116.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57117.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57118.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57119.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57120.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57121.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57122.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57123.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
 gb|AFG57124.1| hypothetical protein 0_15354_01, partial [Pinus taeda]
Length=140

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +1

Query  178  ASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasvi  357
            ASDALPLP+ LTN +FF + FT  YFL+ RWREKIR STPLHV++L EL A+ + +AS I
Sbjct  25   ASDALPLPVGLTNKVFFILFFTASYFLMRRWREKIRTSTPLHVLSLGELVAIVAQLASFI  84

Query  358  yllGFFGIGFVQSFLYRANQEGWDGED  438
            YLLGFFGI +VQ+F+   N +    ED
Sbjct  85   YLLGFFGIDYVQNFITGGNDDDDARED  111



>ref|XP_011458109.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Fragaria vesca subsp. vesca]
Length=572

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLPLYLTN +FFT+ F+V YFLL  WREKIR+ TPLHV+ LSE+ ++  L+AS 
Sbjct  24   KASDALPLPLYLTNAVFFTLFFSVAYFLLTSWREKIRSHTPLHVLNLSEIVSILVLVASF  83

Query  355  iyllGFFGIGFVQSFLYRANQE  420
            +YLLGFFGI FVQ+   +  +E
Sbjct  84   VYLLGFFGIDFVQTPSLKDEEE  105



>gb|AEH95323.1| HMG-CoA reductase 3 [Glycyrrhiza uralensis]
Length=475

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDALPLP+ LTN  FF++ F+V YFLL RWREKIR STPLHVVTLSE+AA+ SLIASV
Sbjct  14   KASDALPLPIRLTNAFFFSLFFSVAYFLLHRWREKIRTSTPLHVVTLSEIAAIVSLIASV  73

Query  355  iyllGFFGIGFV  390
            IYL+ FFGIGF+
Sbjct  74   IYLMAFFGIGFI  85



>gb|AAA68966.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Artemisia annua]
Length=560

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 7/120 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MD+RR+L     +P   +     + ++H    +    PKASDALPLPLYLTN  FFT+ F
Sbjct  1    MDLRRKLPP---KPPSSTTTKQPSHRSHSPTPI----PKASDALPLPLYLTNTFFFTLFF  53

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWR+KIR+ TPLHVVTL+EL+A+  LIAS IYLLGFFGI FVQSF+ R N++
Sbjct  54   SVAYYLLHRWRDKIRSGTPLHVVTLTELSAIVLLIASFIYLLGFFGIDFVQSFISRENEQ  113



>gb|AEH58930.1| HMG-CoA reductase [Glycyrrhiza uralensis]
Length=573

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 83/146 (57%), Gaps = 23/146 (16%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDAL--PLPLYLTNGLFFTM  234
            MDVRRR             AA E IKA K       +  +S AL  P+ L LTN +FF +
Sbjct  1    MDVRRRQHP----------AAGERIKAQKLSPTGAGAADSSQALLPPISLCLTNAVFFGV  50

Query  235  XFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRAN  414
             F+V YFLL RWREKIR STPLH VT SE AA+ SL+AS +YLLGFFGI    SF     
Sbjct  51   FFSVAYFLLHRWREKIRTSTPLHAVTASETAAIVSLVASAVYLLGFFGIASRTSF-----  105

Query  415  QEGWDGEDXSNEQYLLEEDSRR-GAC  489
                  +D S+++ L  +DSR  G C
Sbjct  106  -----PDDLSDDEILARDDSRSPGPC  126



>gb|AAD47596.1| HMG-CoA reductase [Artemisia annua]
Length=567

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 7/120 (6%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MD+RR+L     +P   +     + ++H    +    PKASDALPLPLYLTN  FFT+ F
Sbjct  1    MDLRRKLPP---KPPSSTTTKQPSHRSHSPTPI----PKASDALPLPLYLTNTFFFTLFF  53

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWR+KIR+ TPLHVVTL+EL+A+  LIAS IYLLGFFGI FVQSF  R N++
Sbjct  54   SVAYYLLHRWRDKIRSGTPLHVVTLTELSAIVLLIASFIYLLGFFGIDFVQSFTSRENEQ  113



>gb|ADX01170.1| putative 3-hydroxy-3-methyl-glutaryl-CoA reductase [Bacopa monnieri]
Length=563

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 8/106 (8%)
 Frame = +1

Query  175  KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasv  354
            KASDAL      TN +F T+ F+V+Y+LL RWREKIRNSTPLHVVTLSE+AA+ +  AS 
Sbjct  27   KASDALAF----TNAIFITIFFSVVYYLLRRWREKIRNSTPLHVVTLSEIAAVVTFFASF  82

Query  355  iyllGFFGIGFVQSFLY-RANQEGWDGEDXSNEQYLLEEDSRRGAC  489
            IYL+GFFG+ FVQS +  R++ E  D +    +  +L+EDSR   C
Sbjct  83   IYLIGFFGVAFVQSLIIPRSSLEDIDDD---GDLAILKEDSRATPC  125



>gb|ACN40476.1| unknown [Picea sitchensis]
Length=580

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 68/95 (72%), Gaps = 4/95 (4%)
 Frame = +1

Query  178  ASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasvi  357
            ASDALPLP+ LTN +FF + FT  YFL+ RWREKIR STPLHV++L EL A+ + +AS I
Sbjct  48   ASDALPLPVGLTNKVFFILFFTASYFLMRRWREKIRTSTPLHVLSLGELVAIVAQLASFI  107

Query  358  yllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLL  462
            YLLGFFGI +VQ+F+   N    D +D   E  L+
Sbjct  108  YLLGFFGIDYVQNFITGGN----DDDDVREELKLI  138



>gb|AAA68965.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Artemisia annua]
Length=566

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 85/120 (71%), Gaps = 8/120 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTMXF  240
            MD+RR+L      P K    +  T +   + +     PKASDALPLPLYLTN  FFT+ F
Sbjct  1    MDLRRKL------PPK--PPSTTTKQPSHRSHSPTPIPKASDALPLPLYLTNTFFFTLFF  52

Query  241  TVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQE  420
            +V Y+LL RWR+KIR+ TPLHVVTL+EL+A+  LIAS IYLLGFFGI FVQSF+ R N++
Sbjct  53   SVAYYLLHRWRDKIRSGTPLHVVTLTELSAIVLLIASFIYLLGFFGIDFVQSFISRENEQ  112



>ref|XP_001763417.1| predicted protein [Physcomitrella patens]
 gb|EDQ71606.1| predicted protein [Physcomitrella patens]
Length=561

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = +1

Query  178  ASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasvi  357
            ASDALPLP+ LTN +   + F   YFL+  WR+KIRNSTPLH++ L E+  L   +AS I
Sbjct  13   ASDALPLPVGLTNKISIVLFFIASYFLMRSWRDKIRNSTPLHMLNLGEIVVLLIQLASFI  72

Query  358  yllGFFGIGFVQSFLYRANQEGWDGED  438
            YLLGFFGI +VQ+F+ ++N   WD +D
Sbjct  73   YLLGFFGIDYVQNFISKSNDGSWDSDD  99



>gb|ABJ16394.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Ligularia fischeri]
Length=579

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 84/135 (62%), Gaps = 10/135 (7%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAAC--ETIKAHKQQYLLVSSPKASDALPLPLYLTNGLFFTM  234
            MD RRR       P+  S   C  E ++ + Q   ++    A  +LPLP+YLT+ +FFT+
Sbjct  1    MDDRRRR----VIPHYASVHICSSEPLRRYNQDCSVI----APFSLPLPMYLTDAVFFTL  52

Query  235  XFTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRAN  414
             F+VMY+LL RWR+KI  STPLHVV  SE+AA+ + +ASVIYLL F+GIG VQS      
Sbjct  53   LFSVMYYLLHRWRDKISTSTPLHVVNYSEIAAIVAFVASVIYLLRFYGIGLVQSDPDGIG  112

Query  415  QEGWDGEDXSNEQYL  459
             + W+  D S E+ +
Sbjct  113  NDSWERRDESPERSI  127



>ref|XP_010515116.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Camelina sativa]
Length=557

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 75/108 (69%), Gaps = 14/108 (13%)
 Frame = +1

Query  163  VSSP--KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaala  336
            V++P  KASDALPLPLYLTN  F  + F  +YFLL RWREKIRNSTPLHVV LSE++AL 
Sbjct  22   VATPPRKASDALPLPLYLTNTFFLALFFATVYFLLSRWREKIRNSTPLHVVDLSEISALF  81

Query  337  sliasviyllGFFGIGFVQSFLYRANQEGWDGEDXSNEQYLLEEDSRR  480
              +AS IYLLGFFGI      ++R++ +        ++ ++ +ED RR
Sbjct  82   GFVASFIYLLGFFGI----DLIFRSSSD--------DDVWVNDEDLRR  117



>ref|XP_010467508.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Camelina sativa]
Length=559

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = +1

Query  160  LVSSP--KASDALPLPLYLTNGLFFTMXFTVMYFLLVRWREKIRNSTPLHVVTlselaal  333
            + SSP  KASDALPLPLYLTN  F  + F  +YFLL RWREKIRNSTPLHVV LSE++AL
Sbjct  22   VASSPPRKASDALPLPLYLTNTFFLALFFATVYFLLSRWREKIRNSTPLHVVDLSEISAL  81

Query  334  asliasviyllGFFGIGFV  390
               +AS IYLLGFFGI  +
Sbjct  82   FGFVASFIYLLGFFGIDLI  100



>ref|XP_003629056.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 gb|ABY20976.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 5 [Medicago truncatula]
 gb|AET03532.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
Length=583

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 88/145 (61%), Gaps = 16/145 (11%)
 Frame = +1

Query  61   MDVRRRLSKQLCRPNKGSAAACETIKAHKQQYLLVSSPKAS-DALPLPLYLTNGLFFTMX  237
            MD RRRL     R    S A  E +K  K + L  ++   + ++  + L +TN +FF + 
Sbjct  1    MDARRRLKSLPPR----SPAGGENLKTQKLKSLPTTTTGENLNSQTVFLCVTNAVFFGVF  56

Query  238  FTVMYFLLVRWREKIRNSTPLHVVTlselaalasliasviyllGFFGIGFVQSFLYRANQ  417
            F+V YFLL RWREKIR  TPLHVVT+SE AA+ SLIAS +YLLGFFGIG   SF      
Sbjct  57   FSVAYFLLHRWREKIRTETPLHVVTVSETAAIVSLIASAVYLLGFFGIGSRTSF------  110

Query  418  EGWDGEDXSNEQYLLEEDSRR-GAC  489
                 +D S+E+ L +EDSR+ G C
Sbjct  111  ----PDDLSDEEILAKEDSRKPGPC  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370