BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H12

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004247116.1|  PREDICTED: photosystem I reaction center sub...    132   4e-35   Solanum lycopersicum
ref|XP_006350287.1|  PREDICTED: photosystem I reaction center sub...    130   2e-34   Solanum tuberosum [potatoes]
ref|XP_006352721.1|  PREDICTED: photosystem I reaction center sub...    124   3e-32   Solanum tuberosum [potatoes]
ref|XP_011083089.1|  PREDICTED: photosystem I reaction center sub...    124   5e-32   Sesamum indicum [beniseed]
dbj|BAA07667.1|  PSI-E subunit of photosystem I                         121   5e-31   Nicotiana sylvestris
ref|XP_004242379.1|  PREDICTED: photosystem I reaction center sub...    120   6e-31   Solanum lycopersicum
ref|XP_002266424.1|  PREDICTED: photosystem I reaction center sub...    120   1e-30   Vitis vinifera
emb|CDP03826.1|  unnamed protein product                                120   1e-30   Coffea canephora [robusta coffee]
gb|AEC11063.1|  photosystem I reaction center subunit iv b              119   1e-30   Camellia sinensis [black tea]
emb|CBI37232.3|  unnamed protein product                                119   2e-30   Vitis vinifera
ref|XP_004495033.1|  PREDICTED: photosystem I reaction center sub...    119   2e-30   Cicer arietinum [garbanzo]
ref|XP_010684821.1|  PREDICTED: photosystem I reaction center sub...    117   9e-30   Beta vulgaris subsp. vulgaris [field beet]
sp|P12354.1|PSAE_SPIOL  RecName: Full=Photosystem I reaction cent...    117   2e-29   Spinacia oleracea
ref|NP_001289510.1|  photosystem I reaction center subunit IV A, ...    117   2e-29   Nicotiana sylvestris
ref|NP_001289527.1|  photosystem I reaction center subunit IV B, ...    116   3e-29   Nicotiana sylvestris
ref|XP_002301832.1|  Photosystem I reaction center subunit IV A f...    116   3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009622504.1|  PREDICTED: photosystem I reaction center sub...    116   4e-29   Nicotiana tomentosiformis
gb|ABK94240.1|  unknown                                                 114   2e-28   Populus trichocarpa [western balsam poplar]
ref|WP_039311817.1|  Photosystem I reaction center subunit IV           112   2e-28   
ref|XP_011024524.1|  PREDICTED: photosystem I reaction center sub...    114   2e-28   Populus euphratica
gb|ACJ84185.1|  unknown                                                 113   4e-28   Medicago truncatula
ref|XP_003625462.1|  Photosystem I reaction center subunit IV A         113   4e-28   Medicago truncatula
gb|KJB22614.1|  hypothetical protein B456_004G057800                    113   5e-28   Gossypium raimondii
emb|CAD29821.2|  putative photosystem I reaction centre subunit IV      113   6e-28   Populus x canadensis [Canadian poplar]
gb|EYU46372.1|  hypothetical protein MIMGU_mgv1a015998mg                112   8e-28   Erythranthe guttata [common monkey flower]
ref|XP_011080143.1|  PREDICTED: photosystem I reaction center sub...    112   1e-27   Sesamum indicum [beniseed]
ref|XP_008346243.1|  PREDICTED: photosystem I reaction center sub...    111   2e-27   
ref|XP_009370977.1|  PREDICTED: photosystem I reaction center sub...    112   2e-27   Pyrus x bretschneideri [bai li]
dbj|BAF80474.1|  PSI reaction center subunit III                        112   2e-27   Citrus sinensis [apfelsine]
ref|XP_008372420.1|  PREDICTED: photosystem I reaction center sub...    112   2e-27   
gb|AFK44960.1|  unknown                                                 112   2e-27   Medicago truncatula
ref|XP_004493851.1|  PREDICTED: photosystem I reaction center sub...    111   3e-27   Cicer arietinum [garbanzo]
gb|EPS72223.1|  hypothetical protein M569_02531                         110   4e-27   Genlisea aurea
ref|XP_007140691.1|  hypothetical protein PHAVU_008G133700g             110   5e-27   Phaseolus vulgaris [French bean]
gb|KDP26436.1|  hypothetical protein JCGZ_17594                         110   5e-27   Jatropha curcas
ref|XP_006408942.1|  hypothetical protein EUTSA_v10002106mg             111   5e-27   
ref|XP_006298744.1|  hypothetical protein CARUB_v10014843mg             110   5e-27   Capsella rubella
ref|XP_010495919.1|  PREDICTED: photosystem I reaction center sub...    110   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_007201838.1|  hypothetical protein PRUPE_ppa012923mg             110   6e-27   Prunus persica
ref|XP_002885991.1|  hypothetical protein ARALYDRAFT_899838             110   6e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_010263995.1|  PREDICTED: photosystem I reaction center sub...    110   6e-27   Nelumbo nucifera [Indian lotus]
ref|XP_008235545.1|  PREDICTED: photosystem I reaction center sub...    110   7e-27   Prunus mume [ume]
ref|XP_007144431.1|  hypothetical protein PHAVU_007G155500g             110   7e-27   Phaseolus vulgaris [French bean]
ref|XP_009397624.1|  PREDICTED: photosystem I reaction center sub...    110   8e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275778.1|  PSI reaction center subunit III                    110   9e-27   Citrus sinensis [apfelsine]
ref|XP_004290022.1|  PREDICTED: photosystem I reaction center sub...    110   1e-26   Fragaria vesca subsp. vesca
ref|XP_008382669.1|  PREDICTED: photosystem I reaction center sub...    110   1e-26   
ref|XP_010069685.1|  PREDICTED: photosystem I reaction center sub...    109   1e-26   Eucalyptus grandis [rose gum]
gb|ACJ85926.1|  unknown                                                 110   1e-26   Medicago truncatula
ref|XP_010243638.1|  PREDICTED: photosystem I reaction center sub...    109   2e-26   Nelumbo nucifera [Indian lotus]
gb|KHN05901.1|  Photosystem I reaction center subunit IV A, chlor...    108   2e-26   Glycine soja [wild soybean]
gb|KFK40388.1|  hypothetical protein AALP_AA3G367100                    108   2e-26   Arabis alpina [alpine rockcress]
ref|NP_001236993.1|  uncharacterized protein LOC100526993               108   2e-26   Glycine max [soybeans]
ref|NP_001240010.1|  uncharacterized protein LOC100811078               108   2e-26   Glycine max [soybeans]
ref|NP_001236772.1|  uncharacterized protein LOC100500098               108   3e-26   Glycine max [soybeans]
ref|XP_006412915.1|  hypothetical protein EUTSA_v10026332mg             110   3e-26   
ref|NP_001236392.1|  uncharacterized protein LOC100499814               108   3e-26   Glycine max [soybeans]
gb|KHN48968.1|  Photosystem I reaction center subunit IV A, chlor...    108   3e-26   Glycine soja [wild soybean]
ref|XP_010416079.1|  PREDICTED: photosystem I reaction center sub...    108   3e-26   Camelina sativa [gold-of-pleasure]
gb|EYU17960.1|  hypothetical protein MIMGU_mgv1a015996mg                108   3e-26   Erythranthe guttata [common monkey flower]
emb|CDY06874.1|  BnaC01g09730D                                          108   4e-26   
ref|NP_179616.1|  photosystem I subunit E-2                             108   5e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63830.1|  Photosystem I reaction center subunit IV B, chlor...    108   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009386574.1|  PREDICTED: photosystem I reaction center sub...    108   6e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002521161.1|  photosystem I reaction center subunit IV A, ...    107   6e-26   Ricinus communis
pdb|3LW5|E  Chain E, Improved Model Of Plant Photosystem I              105   6e-26   unidentified
gb|KHG12594.1|  Photosystem I reaction center subunit IV, chlorop...    107   7e-26   Gossypium arboreum [tree cotton]
ref|XP_010548721.1|  PREDICTED: photosystem I reaction center sub...    107   7e-26   
gb|KHN48967.1|  Photosystem I reaction center subunit IV A, chlor...    106   8e-26   Glycine soja [wild soybean]
ref|XP_010489072.1|  PREDICTED: photosystem I reaction center sub...    108   9e-26   Camelina sativa [gold-of-pleasure]
gb|KFK29416.1|  hypothetical protein AALP_AA7G131600                    107   9e-26   Arabis alpina [alpine rockcress]
emb|CDX97458.1|  BnaC08g13230D                                          107   9e-26   
ref|XP_006284717.1|  hypothetical protein CARUB_v10005979mg             107   1e-25   Capsella rubella
ref|XP_002867438.1|  hypothetical protein ARALYDRAFT_491882             107   1e-25   
ref|XP_009109070.1|  PREDICTED: photosystem I reaction center sub...    107   1e-25   Brassica rapa
ref|XP_009129307.1|  PREDICTED: photosystem I reaction center sub...    106   2e-25   Brassica rapa
emb|CDY35216.1|  BnaA01g08150D                                          106   2e-25   Brassica napus [oilseed rape]
gb|KHG24461.1|  Photosystem I reaction center subunit IV B, chlor...    107   2e-25   Gossypium arboreum [tree cotton]
gb|ADC53693.1|  photosystem I psaE                                      107   2e-25   Morus alba var. multicaulis
ref|XP_010526478.1|  PREDICTED: photosystem I reaction center sub...    106   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_010433167.1|  PREDICTED: photosystem I reaction center sub...    106   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010438388.1|  PREDICTED: photosystem I reaction center sub...    106   2e-25   Camelina sativa [gold-of-pleasure]
gb|KJB11001.1|  hypothetical protein B456_001G235800                    106   3e-25   Gossypium raimondii
ref|XP_010447920.1|  PREDICTED: photosystem I reaction center sub...    105   4e-25   Camelina sativa [gold-of-pleasure]
pdb|4RKU|E  Chain E, Crystal Structure Of Plant Photosystem I At ...    103   4e-25   Pisum sativum [garden pea]
pdb|2O01|E  Chain E, The Structure Of A Plant Photosystem I Super...    103   5e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAT72503.1|  AT4G28750                                               104   5e-25   Arabidopsis lyrata subsp. petraea
emb|CAK18840.1|  subunit IV of photosystem I (PSI-E) precursor          102   5e-25   Phillyrea latifolia
ref|NP_567818.2|  photosystem I reaction center subunit E               105   8e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAG40045.1|AF324694_1  AT4g28750                                     103   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008441802.1|  PREDICTED: photosystem I reaction center sub...    105   8e-25   Cucumis melo [Oriental melon]
gb|AAG41443.2|AF326861_1  putative photosystem I subunit PSI-E          104   9e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010918840.1|  PREDICTED: photosystem I reaction center sub...    104   9e-25   Elaeis guineensis
gb|AAN41281.1|  putative photosystem I subunit PSI-E protein            104   9e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540940.1|  PREDICTED: photosystem I reaction center sub...    103   2e-24   
ref|XP_004170925.1|  PREDICTED: photosystem I reaction center sub...    103   2e-24   
ref|XP_009398054.1|  PREDICTED: photosystem I reaction center sub...    103   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007030306.1|  Photosystem I subunit E-2-like protein             104   2e-24   
ref|XP_010043318.1|  PREDICTED: photosystem I reaction center sub...    103   2e-24   Eucalyptus grandis [rose gum]
ref|XP_007050077.1|  Photosystem I subunit E-2                          103   3e-24   Theobroma cacao [chocolate]
ref|XP_010091851.1|  Photosystem I reaction center subunit IV A         103   3e-24   Morus notabilis
gb|KGN61314.1|  hypothetical protein Csa_2G079660                       105   4e-24   Cucumis sativus [cucumbers]
gb|ABK26819.1|  unknown                                                 103   4e-24   Picea sitchensis
ref|XP_008777022.1|  PREDICTED: photosystem I reaction center sub...    103   4e-24   Phoenix dactylifera
gb|ACN39945.1|  unknown                                                 103   4e-24   Picea sitchensis
ref|XP_004152807.1|  PREDICTED: photosystem I reaction center sub...    105   5e-24   
ref|XP_004956072.1|  PREDICTED: photosystem I reaction center sub...    103   7e-24   Setaria italica
gb|ABK22383.1|  unknown                                                 102   1e-23   Picea sitchensis
gb|KHG15723.1|  Photosystem I reaction center subunit IV, chlorop...    101   2e-23   Gossypium arboreum [tree cotton]
gb|KJB42415.1|  hypothetical protein B456_007G151500                    101   2e-23   Gossypium raimondii
ref|NP_001149700.1|  photosystem I reaction center subunit IV A         101   2e-23   Zea mays [maize]
tpg|DAA60402.1|  TPA: photosystem I reaction center subunit IV A        101   2e-23   
gb|ACG26704.1|  photosystem I reaction center subunit IV A              101   2e-23   Zea mays [maize]
ref|XP_006854333.1|  hypothetical protein AMTR_s00039p00131500          100   3e-23   Amborella trichopoda
gb|ACG30530.1|  photosystem I reaction center subunit IV A              100   3e-23   Zea mays [maize]
tpg|DAA39735.1|  TPA: hypothetical protein ZEAMMB73_405218              100   3e-23   
sp|P13194.2|PSAE_HORVU  RecName: Full=Photosystem I reaction cent...    100   4e-23   Hordeum vulgare [barley]
ref|NP_001059501.2|  Os07g0435300                                     99.4    4e-23   
ref|XP_003563195.1|  PREDICTED: photosystem I reaction center sub...    100   5e-23   Brachypodium distachyon [annual false brome]
ref|NP_001149459.1|  LOC100283085                                       100   6e-23   Zea mays [maize]
ref|XP_006658507.1|  PREDICTED: photosystem I reaction center sub...  98.6    7e-23   Oryza brachyantha
gb|EAZ03667.1|  hypothetical protein OsI_25804                          100   8e-23   Oryza sativa Indica Group [Indian rice]
dbj|BAC84088.1|  putative Photosystem I reaction center subunit IV      100   8e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007219428.1|  hypothetical protein PRUPE_ppa020566mg           89.4    1e-19   
gb|KJB42413.1|  hypothetical protein B456_007G151500                  89.0    1e-18   Gossypium raimondii
ref|XP_001768221.1|  predicted protein                                82.8    6e-17   
ref|XP_001782561.1|  predicted protein                                82.0    7e-17   
ref|XP_005844456.1|  hypothetical protein CHLNCDRAFT_36926            82.8    8e-17   Chlorella variabilis
ref|XP_002979651.1|  hypothetical protein SELMODRAFT_59774            81.6    1e-16   
ref|XP_001782099.1|  predicted protein                                81.3    1e-16   
ref|YP_008519881.1|  photosystem I subunit IV                         80.9    2e-16   Nannochloropsis limnetica
ref|WP_015165970.1|  Photosystem I reaction center subunit IV         80.5    2e-16   Pseudanabaena sp. PCC 7367
ref|WP_019499312.1|  hypothetical protein                             80.1    3e-16   Pseudanabaena sp. PCC 6802
ref|YP_008520005.1|  photosystem I subunit IV                         79.7    4e-16   Nannochloropsis oceanica
ref|WP_015169998.1|  Photosystem I reaction centre subunit IV / PsaE  79.3    6e-16   Synechococcus sp. PCC 7502
ref|YP_008519632.1|  photosystem I subunit IV                         79.3    7e-16   Nannochloropsis oculata
ref|WP_011143397.1|  photosystem I reaction center subunit IV         79.0    8e-16   Gloeobacter violaceus
ref|YP_007317004.1|  photosystem I reaction center subunit IV         79.0    9e-16   Nannochloropsis gaditana
ref|WP_023171971.1|  photosystem I reaction center subunit IV         78.6    1e-15   Gloeobacter kilaueensis
ref|WP_008312071.1|  Photosystem I reaction centre subunit IV / PsaE  78.6    1e-15   Leptolyngbya sp. PCC 6406
ref|XP_011397149.1|  Photosystem I reaction center subunit IV, ch...  79.7    2e-15   Auxenochlorella protothecoides
ref|WP_009455623.1|  MULTISPECIES: Photosystem I reaction center ...  77.8    3e-15   Fischerella thermalis
ref|WP_009626231.1|  Photosystem I reaction center subunit IV         77.4    3e-15   Pseudanabaena
ref|WP_017721660.1|  hypothetical protein                             79.0    3e-15   Oscillatoria sp. PCC 10802
ref|YP_009029311.1|  photosystem I reaction center subunit IV         77.0    4e-15   Leptocylindrus danicus
ref|XP_007514240.1|  photosystem I reaction center subunit IV         77.4    4e-15   Bathycoccus prasinos
ref|WP_016878433.1|  Photosystem I reaction center subunit IV         77.0    5e-15   Chlorogloeopsis fritschii
ref|WP_026733112.1|  Photosystem I reaction center subunit IV         77.0    5e-15   Fischerella
ref|XP_001416091.1|  Photosystem I reaction center subunit IV, pr...  77.8    6e-15   Ostreococcus lucimarinus CCE9901
ref|XP_003057473.1|  photosystem I subunit IV, chloroplast precursor  77.8    7e-15   Micromonas pusilla CCMP1545
ref|WP_016867325.1|  Photosystem I reaction center subunit IV         76.6    8e-15   Fischerella muscicola
ref|WP_017313689.1|  Photosystem I reaction center subunit IV         76.3    1e-14   Fischerella sp. PCC 9339
ref|XP_002502060.1|  photosystem I reaction center subunit IV, ch...  77.4    1e-14   Micromonas commoda
ref|WP_026072314.1|  Photosystem I reaction center subunit IV         76.3    1e-14   Nodosilinea nodulosa
ref|WP_035991772.1|  Photosystem I reaction center subunit IV         75.9    1e-14   Leptolyngbya sp. KIOST-1
dbj|BAF63505.1|  hypothetical protein                                 75.1    1e-14   Potamogeton distinctus
ref|WP_041036448.1|  Photosystem I reaction center subunit IV         75.9    1e-14   Tolypothrix campylonemoides
ref|XP_003075228.1|  PsaE undefined product (IC)                      76.6    1e-14   Ostreococcus tauri
ref|WP_009555467.1|  Photosystem I reaction centre subunit IV / PsaE  76.3    1e-14   Oscillatoriales cyanobacterium JSC-12
ref|WP_017315377.1|  Photosystem I reaction center subunit IV         75.9    1e-14   Mastigocladopsis repens
gb|ABV70197.1|  photosystem I reaction center subunit IV              75.1    2e-14   Heterosigma akashiwo
ref|WP_026720224.1|  Photosystem I reaction center subunit IV         75.1    3e-14   Hapalosiphonaceae
ref|YP_009093428.1|  photosystem I subunit IV                         74.7    3e-14   Conticribra weissflogii
ref|WP_015178118.1|  Photosystem I reaction center subunit IV         76.3    3e-14   Oscillatoria nigro-viridis
ref|WP_027846034.1|  photosystem I reaction centre subunit IV/PsaE    75.5    3e-14   Mastigocoleus testarum
ref|WP_016858858.1|  Photosystem I reaction center subunit IV         74.7    4e-14   Fischerella muscicola
ref|WP_015210229.1|  Photosystem I reaction centre subunit IV / PsaE  74.3    4e-14   Cylindrospermum stagnale
ref|WP_010998457.1|  photosystem I reaction center subunit IV         74.3    4e-14   Nostocaceae
ref|YP_001293615.1|  photosystem I subunit IV                         73.9    5e-14   Rhodomonas salina
gb|AIR75397.1|  photosystem I subunit IV                              73.9    5e-14   Cyclotella sp. L04_2
ref|YP_009093155.1|  photosystem I subunit IV                         73.9    5e-14   Roundia cardiophora
ref|WP_019509388.1|  Photosystem I reaction center subunit IV         73.9    6e-14   Pleurocapsa sp. PCC 7319
ref|WP_011057407.1|  MULTISPECIES: photosystem I reaction center ...  73.9    6e-14   Thermosynechococcus
pdb|1JB0|E  Chain E, Crystal Structure Of Photosystem I: A Photos...  73.9    7e-14   Synechococcus elongatus
ref|WP_006528812.1|  Photosystem I reaction centre subunit IV / PsaE  73.9    7e-14   Gloeocapsa sp. PCC 73106
ref|XP_005645026.1|  photosystem I reaction centre subunit IV/PsaE    73.9    7e-14   Coccomyxa subellipsoidea C-169
ref|YP_001936450.1|  photosystem I subunit IV                         73.6    8e-14   Heterosigma akashiwo
ref|YP_009092939.1|  photosystem I subunit IV                         73.6    8e-14   Chaetoceros simplex
gb|ABA55572.1|  chloroplast psaEb                                     75.1    8e-14   Pavlova lutheri
ref|WP_039724554.1|  MULTISPECIES: hypothetical protein               73.6    8e-14   Lyngbya confervoides
ref|WP_036005331.1|  photosystem I reaction centre subunit IV/PsaE    75.1    8e-14   [Leptolyngbya] sp. JSC-1
ref|WP_036481067.1|  photosystem I reaction centre subunit IV/PsaE    75.1    9e-14   Myxosarcina sp. GI1
ref|WP_017659509.1|  hypothetical protein                             73.6    9e-14   Cyanobacteria [blue-green bacteria]
ref|YP_009059243.1|  photosystem I reaction center subunit IV         73.6    1e-13   Eunotia naegelii
ref|WP_015111814.1|  Photosystem I reaction center subunit IV         73.2    1e-13   Nostoc sp. PCC 7107
ref|WP_015151402.1|  Photosystem I reaction centre subunit IV / PsaE  74.3    1e-13   Oscillatoria acuminata
ref|WP_011318110.1|  photosystem I reaction center subunit IV         73.2    1e-13   Trichormus variabilis
ref|XP_002297543.1|  PSAE, photosystem I reaction center subunit      72.8    1e-13   Thalassiosira pseudonana CCMP1335
ref|WP_035155751.1|  Photosystem I reaction center subunit IV         73.2    1e-13   Calothrix sp. 336/3
ref|YP_874511.1|  photosystem I reaction center subunit IV            72.8    1e-13   Thalassiosira pseudonana
gb|KIJ80923.1|  Photosystem I reaction center subunit IV              72.8    1e-13   Scytonema tolypothrichoides VB-61278
ref|NP_050803.1|  photosystem I subunit IV                            72.8    1e-13   Guillardia theta
ref|WP_007356982.1|  MULTISPECIES: Photosystem I reaction centre ...  74.3    2e-13   Kamptonema
ref|YP_004376592.1|  photosystem I reaction center subunit IV         72.8    2e-13   Fistulifera solaris
ref|WP_019490505.1|  Photosystem I reaction center subunit IV         72.4    2e-13   Calothrix sp. PCC 7103
ref|WP_023072528.1|  photosystem i reaction center subunit iv         72.0    3e-13   Leptolyngbya sp. Heron Island J
ref|YP_003734583.1|  photosystem I subunit IV                         72.0    3e-13   Kryptoperidinium foliaceum
ref|YP_009029492.1|  photosystem I reaction center subunit IV         72.0    3e-13   Lithodesmium undulatum
ref|YP_009029225.1|  photosystem I reaction center subunit IV         72.0    3e-13   Didymosphenia geminata
ref|WP_017322021.1|  Photosystem I reaction center subunit IV         72.0    3e-13   cyanobacterium PCC 7702
ref|WP_036046459.1|  photosystem I reaction center subunit IV         72.0    4e-13   Leptolyngbya boryana
ref|WP_006635199.1|  Photosystem I reaction center subunit IV         73.2    4e-13   Microcoleus vaginatus
ref|WP_015228833.1|  Photosystem I reaction centre subunit IV / PsaE  72.0    5e-13   Dactylococcopsis salina
gb|ABA55538.1|  chloroplast psaE                                      73.2    5e-13   Karlodinium veneficum
ref|XP_001702611.1|  photosystem I 8.1 kDa reaction center subuni...  72.0    6e-13   Chlamydomonas reinhardtii
dbj|BAA84770.1|  photosystem I subunit PSI-E                          70.5    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|WP_013324281.1|  photosystem I reaction centre subunit IV/PsaE    72.8    6e-13   Cyanothece sp. PCC 7822
gb|KJB22616.1|  hypothetical protein B456_004G057800                  72.4    6e-13   Gossypium raimondii
sp|Q9WWP1.1|PSAE_NOSS8  RecName: Full=Photosystem I reaction cent...  71.2    6e-13   Nostoc sp. PCC 8009
ref|WP_015955589.1|  photosystem I reaction centre subunit IV/PsaE    72.4    7e-13   Cyanothece sp. PCC 7424
ref|YP_009029076.1|  photosystem I reaction center subunit IV         70.9    7e-13   Cylindrotheca closterium
gb|AAW79343.1|  chloroplast photosystem I protein E                   72.4    7e-13   Heterocapsa triquetra
ref|WP_015081105.1|  photosystem I reaction center subunit IV         70.9    8e-13   Anabaena sp. 90
ref|WP_027400975.1|  Photosystem I reaction center subunit IV         70.9    8e-13   Nostocales
ref|WP_015192088.1|  Photosystem I reaction center subunit IV         72.4    8e-13   Stanieria cyanosphaera
gb|KIY93708.1|  Photosystem I reaction center subunit IV              71.6    9e-13   Monoraphidium neglectum
ref|YP_003735019.1|  photosystem I reaction center subunit IV         70.5    1e-12   Durinskia baltica
ref|WP_015224518.1|  photosystem I reaction centre subunit IV/PsaE    70.9    1e-12   Halothece sp. PCC 7418
ref|YP_005089706.1|  psaE gene product                                70.5    1e-12   Ulnaria acus
ref|WP_012410286.1|  photosystem I reaction center subunit IV         70.5    1e-12   Nostoc punctiforme
ref|WP_015186913.1|  Photosystem I reaction center subunit IV         71.6    1e-12   Gloeocapsa sp. PCC 7428
ref|WP_044136425.1|  photosystem I reaction center subunit IV         70.5    1e-12   Trichodesmium erythraeum
gb|KIY99818.1|  Photosystem I reaction center subunit IV              71.2    1e-12   Monoraphidium neglectum
sp|Q117D3.1|PSAE_TRIEI  RecName: Full=Photosystem I reaction cent...  70.1    1e-12   Trichodesmium erythraeum IMS101
ref|WP_006457318.1|  photosystem I reaction center subunit IV         70.1    1e-12   Synechococcus sp. PCC 7335
gb|ADO32969.2|  photosystem I subunit E                               70.1    2e-12   Galdieria sulphuraria
ref|WP_006518066.1|  Photosystem I reaction centre subunit IV / PsaE  69.7    2e-12   Leptolyngbya sp. PCC 7375
ref|YP_009093345.1|  photosystem I subunit IV                         70.1    2e-12   Cerataulina daemon
ref|WP_017653872.1|  Photosystem I reaction center subunit IV         70.1    2e-12   Fortiea contorta
ref|NP_045096.1|  photosystem I subunit IV                            70.1    2e-12   Cyanidium caldarium
ref|NP_043641.1|  photosystem I subunit IV                            70.1    2e-12   Trieres chinensis
ref|WP_028082647.1|  Photosystem I reaction center subunit IV         69.7    2e-12   Dolichospermum circinale
ref|YP_009051041.1|  photosystem I subunit IV                         70.1    2e-12   Galdieria sulphuraria
ref|XP_002948231.1|  photosystem I reaction center subunit IV, ch...  70.5    2e-12   Volvox carteri f. nagariensis
ref|YP_009028715.1|  photosystem I reaction center subunit IV         69.7    2e-12   Asterionellopsis glacialis
ref|WP_040483444.1|  photosystem I reaction centre subunit IV/PsaE    70.5    2e-12   Lyngbya aestuarii
ref|YP_874428.1|  photosystem I reaction center subunit IV            69.7    2e-12   Phaeodactylum tricornutum
gb|EJK48011.1|  PS I subunit IV                                       70.5    2e-12   Thalassiosira oceanica
gb|AAW79344.1|  chloroplast photosystem I protein E                   70.9    3e-12   Isochrysis galbana
gb|KFK40387.1|  hypothetical protein AALP_AA3G367000                  72.4    3e-12   Arabis alpina [alpine rockcress]
ref|WP_009787293.1|  photosystem I reaction center subunit IV         69.3    3e-12   Lyngbya sp. PCC 8106
ref|WP_015117638.1|  Photosystem I reaction centre subunit IV / PsaE  70.5    3e-12   Rivularia sp. PCC 7116
ref|WP_039737176.1|  Photosystem I reaction center subunit IV         68.9    4e-12   Tolypothrix sp. NIES-4075
ref|WP_015157910.1|  Photosystem I reaction centre subunit IV / PsaE  70.1    4e-12   Chamaesiphon minutus
ref|XP_006412914.1|  hypothetical protein EUTSA_v10026332mg           70.9    5e-12   
ref|WP_016950091.1|  Photosystem I reaction center subunit IV         68.9    5e-12   Anabaena sp. PCC 7108
dbj|BAA78581.1|  photosystem I chain IV precursor                     68.6    5e-12   Chlamydomonas sp. HS-5
ref|YP_009028645.1|  photosystem I reaction center subunit IV         68.6    5e-12   Asterionella formosa
ref|WP_017745895.1|  Photosystem I reaction center subunit IV         68.6    6e-12   Scytonema hofmannii
ref|WP_015140455.1|  Photosystem I reaction centre subunit IV / PsaE  68.6    6e-12   Nostoc sp. PCC 7524
ref|YP_008965668.1|  photosystem I reaction center subunit IV         68.2    7e-12   Porphyridium purpureum
ref|WP_009631455.1|  Photosystem I reaction centre subunit IV / PsaE  69.7    7e-12   Synechocystis sp. PCC 7509
sp|P23809.1|PSAE_MICDP  RecName: Full=Photosystem I reaction cent...  68.2    7e-12   Microchaete diplosiphon
gb|ACF24543.1|  photosystem I reaction center subunit IV              69.7    9e-12   Gymnochlora stellata
ref|WP_006194700.1|  photosystem I reaction center subunit IV         67.8    1e-11   Nodularia spumigena
ref|WP_015173414.1|  photosystem I reaction centre subunit IV/PsaE    68.9    1e-11   Geitlerinema sp. PCC 7407
ref|XP_009036075.1|  hypothetical protein AURANDRAFT_18026            67.8    1e-11   Aureococcus anophagefferens
gb|AAP79148.1|  photosystem I protein PsaE                            69.3    1e-11   Bigelowiella natans
ref|WP_015204237.1|  Photosystem I reaction center subunit IV         68.9    1e-11   Crinalium epipsammum
ref|WP_036535769.1|  hypothetical protein                             67.8    1e-11   Neosynechococcus sphagnicola
ref|WP_015154163.1|  MULTISPECIES: photosystem I reaction centre ...  68.9    1e-11   Cyanobacteria [blue-green bacteria]
ref|YP_009028925.1|  photosystem I reaction center subunit IV         67.0    2e-11   Coscinodiscus radiatus
ref|WP_017295640.1|  photosystem I reaction center subunit IV         67.4    2e-11   Geminocystis herdmanii
ref|WP_006275840.1|  Photosystem I reaction centre subunit IV/PsaE    67.0    2e-11   Aphanizomenonaceae
ref|WP_015218119.1|  Photosystem I reaction center subunit IV         67.0    2e-11   Cyanobacterium aponinum
ref|XP_005784629.1|  photosystem I reaction center subunit IV         68.2    2e-11   Emiliania huxleyi CCMP1516
ref|WP_006511355.1|  Photosystem I reaction centre subunit IV / PsaE  67.0    2e-11   Xenococcus sp. PCC 7305
ref|WP_015201001.1|  Photosystem I reaction center subunit IV         67.0    2e-11   Calothrix parietina
ref|WP_009342950.1|  Photosystem I reaction centre subunit IV/PsaE    66.6    3e-11   Aphanizomenonaceae
ref|WP_015183730.1|  Photosystem I reaction centre subunit IV / PsaE  67.8    3e-11   Microcoleus sp. PCC 7113
ref|WP_015213737.1|  Photosystem I reaction center subunit IV         66.2    4e-11   Anabaena cylindrica
ref|WP_015161965.1|  Photosystem I reaction centre subunit IV / PsaE  66.2    4e-11   Chamaesiphon minutus
ref|WP_040938985.1|  hypothetical protein                             66.2    4e-11   
ref|WP_026788198.1|  MULTISPECIES: Photosystem I reaction center ...  66.2    5e-11   Planktothrix
ref|WP_013192086.1|  photosystem I reaction centre subunit IV/PsaE    65.9    5e-11   Trichormus azollae
gb|AIA61172.1|  photosystem I subunit IV (chloroplast)                65.9    5e-11   Cyanidiaceae sp. MX-AZ01
ref|WP_040934979.1|  hypothetical protein                             65.9    5e-11   
ref|WP_017326934.1|  Photosystem I reaction center subunit IV         65.9    5e-11   Synechococcus sp. PCC 7336
gb|AIA21560.1|  photosystem I subunit IV                              65.5    6e-11   Pyropia fucicola
ref|WP_012626743.1|  photosystem I reaction centre subunit IV/PsaE    67.0    6e-11   
ref|WP_026099435.1|  photosystem I reaction center subunit IV         65.5    7e-11   
ref|YP_004072579.1|  photosystem I reaction center subunit IV         65.5    7e-11   
ref|NP_053936.1|  photosystem I subunit IV                            65.5    7e-11   
ref|YP_537008.1|  photosystem I subunit IV                            65.1    7e-11   
ref|YP_009027609.1|  photosystem I subunit IV                         65.1    9e-11   
ref|YP_007947856.1|  photosystem I subunit IV                         65.1    1e-10   
gb|AIA21354.1|  photosystem I subunit IV                              64.7    1e-10   
ref|YP_003289176.1|  Photosystem I reaction center subunit IV         64.7    1e-10   
ref|WP_029634638.1|  Photosystem I reaction center subunit IV [       64.7    1e-10   
ref|WP_044304885.1|  photosystem I reaction center subunit IV         64.7    1e-10   
emb|CCH67922.1|  photosystem I subunit IV (PsaE)                      64.7    1e-10   
ref|WP_015125315.1|  Photosystem I reaction centre subunit IV / PsaE  64.7    1e-10   
ref|WP_006625536.1|  MULTISPECIES: putative photosystem I subunit IV  64.7    2e-10   
ref|WP_018397569.1|  hypothetical protein                             65.1    2e-10   
gb|KIE13125.1|  Photosystem I reaction center subunit IV              63.5    3e-10   
ref|XP_005769464.1|  hypothetical protein EMIHUDRAFT_49896            63.5    4e-10   
ref|WP_012629542.1|  photosystem I reaction center subunit IV         63.5    4e-10   
ref|WP_006616585.1|  photosystem I reaction center subunit IV         63.5    5e-10   
gb|EMS58402.1|  Photosystem I reaction center subunit IV, chlorop...  64.3    5e-10   
gb|AFY36780.1|  Photosystem I reaction center subunit IV              62.8    6e-10   
ref|WP_012162971.1|  photosystem I reaction center subunit IV         63.2    6e-10   
ref|WP_011360226.1|  photosystem I reaction center subunit IV         62.8    6e-10   
ref|WP_015128014.1|  photosystem I reaction centre subunit IV/PsaE    62.8    7e-10   
ref|WP_015221462.1|  photosystem I reaction centre subunit IV/PsaE    62.8    7e-10   
ref|WP_010475711.1|  photosystem I reaction center subunit IV         63.2    7e-10   
ref|WP_017302900.1|  photosystem I reaction center subunit IV         62.8    8e-10   
ref|WP_006100856.1|  photosystem I reaction center subunit IV         62.4    8e-10   
ref|YP_005090126.1|  psaE gene product                                62.4    9e-10   
ref|NP_849039.1|  photosystem I subunit IV                            62.8    9e-10   
gb|AJH65895.1|  photosystem I reaction center subunit IV              61.6    1e-09   
ref|WP_009149180.1|  photosystem I reaction centre subunit IV / PsaE  61.6    2e-09   
ref|WP_012307012.1|  MULTISPECIES: photosystem I reaction center ...  61.2    2e-09   
ref|YP_002327498.1|  PSI subunit IV                                   60.8    2e-09   
pdb|1PSE|A  Chain A, The Three-Dimensional Solution Structure Of ...  61.2    2e-09   
ref|YP_008144817.1|  photosystem I reaction center subunit IV         60.5    3e-09   
ref|YP_007627353.1|  photosystem I subunit IV                         60.5    3e-09   
ref|WP_037223615.1|  hypothetical protein                             60.8    4e-09   
ref|YP_063572.1|  photosystem I subunit IV                            60.1    6e-09   
gb|ACQ78178.1|  photosystem I reaction center subunit IV              60.1    6e-09   
ref|WP_024546215.1|  Photosystem I reaction center subunit IV         59.7    7e-09   
ref|WP_011242545.1|  MULTISPECIES: photosystem I reaction center ...  59.7    1e-08   
ref|WP_007308507.1|  Photosystem I reaction centre subunit IV/PsaE    59.3    1e-08   
ref|WP_038651304.1|  photosystem I reaction center subunit IV         59.3    1e-08   
ref|WP_040054973.1|  photosystem I reaction center subunit IV         59.3    1e-08   
ref|YP_006639119.1|  photosystem I reaction center subunit IV         58.9    1e-08   
gb|AIU44573.1|  photosystem I subunit IV                              58.9    2e-08   
ref|WP_008274888.1|  photosystem I reaction center subunit IV         58.9    2e-08   
ref|WP_012593514.1|  MULTISPECIES: photosystem I reaction centre ...  58.5    2e-08   
gb|AJO68406.1|  photosystem I subunit IV                              58.2    2e-08   
ref|WP_015957034.1|  photosystem I reaction center subunit IV         58.5    2e-08   
ref|NP_043234.1|  photosystem I subunit IV                            58.5    2e-08   
ref|WP_002767446.1|  Photosystem I reaction center subunit IV         58.2    3e-08   
ref|WP_002787200.1|  Photosystem I reaction center subunit IV         58.2    3e-08   
ref|WP_004160927.1|  Photosystem I reaction center subunit IV         58.2    3e-08   
ref|WP_012953705.1|  photosystem I reaction centre subunit IV / PsaE  58.2    3e-08   
ref|WP_015145772.1|  Photosystem I reaction centre subunit IV / PsaE  58.2    4e-08   
ref|WP_011294340.1|  photosystem I reaction center subunit IV         57.8    4e-08   
ref|WP_009543613.1|  MULTISPECIES: Photosystem I reaction center ...  57.8    4e-08   
ref|WP_006854760.1|  MULTISPECIES: photosystem I reaction centre ...  57.8    4e-08   
ref|XP_009391677.1|  PREDICTED: photosystem I reaction center sub...  58.5    4e-08   
gb|ACB53673.1|  photosystem I reaction center subunit IV              57.8    4e-08   
ref|WP_036000115.1|  hypothetical protein                             57.8    4e-08   
ref|WP_002800416.1|  MULTISPECIES: Photosystem I reaction center ...  57.8    5e-08   
ref|WP_010315087.1|  photosystem I reaction center subunit IV         57.0    7e-08   
ref|WP_028953732.1|  photosystem I reaction center subunit IV         57.0    7e-08   
ref|WP_007097064.1|  photosystem I reaction center subunit IV         57.0    7e-08   
ref|WP_010311442.1|  photosystem I reaction center subunit IV         57.0    7e-08   
ref|WP_002760713.1|  Photosystem I reaction center subunit IV         57.0    9e-08   
ref|WP_002797997.1|  Photosystem I reaction center subunit IV         57.0    9e-08   
ref|WP_007100528.1|  photosystem I subunit IV (PsaE)                  56.6    1e-07   
ref|WP_002743487.1|  photosystem I reaction center subunit IV         56.6    1e-07   
ref|WP_006911758.1|  photosystem I reaction center subunit IV         56.6    1e-07   
ref|WP_036901987.1|  photosystem I reaction center subunit IV         56.2    1e-07   
ref|WP_043695166.1|  photosystem I reaction center subunit IV         56.2    1e-07   
dbj|GAL95006.1|  photosystem I subunit IV (PsaE)                      56.2    1e-07   
ref|YP_009019580.1|  photosystem I reaction center subunit IV         56.2    1e-07   
ref|WP_037990914.1|  photosystem I reaction center subunit IV         56.2    1e-07   
ref|WP_038547847.1|  photosystem I reaction center subunit IV         56.2    1e-07   
ref|WP_009789048.1|  photosystem I reaction center subunit IV         56.2    1e-07   
ref|WP_038546933.1|  photosystem I reaction center subunit IV         56.2    1e-07   
ref|WP_011360603.1|  photosystem I reaction center subunit IV         56.2    1e-07   
ref|WP_035834141.1|  photosystem I reaction center subunit IV         56.2    2e-07   
ref|WP_006851563.1|  MULTISPECIES: photosystem I reaction center ...  55.8    2e-07   
ref|WP_012194920.1|  photosystem I reaction center subunit IV         55.8    2e-07   
ref|WP_011932452.1|  photosystem I reaction center subunit IV         55.8    2e-07   
ref|WP_006169947.1|  photosystem I reaction center subunit IV         55.8    2e-07   
ref|WP_036916833.1|  MULTISPECIES: photosystem I reaction center ...  55.5    2e-07   
gb|KGG16588.1|  photosystem I subunit IV (PsaE)                       55.1    3e-07   
ref|WP_015110498.1|  Photosystem I reaction centre subunit IV / PsaE  55.1    3e-07   
ref|WP_002733317.1|  photosystem I reaction center subunit IV         55.1    4e-07   
ref|WP_010873003.1|  photosystem I reaction center subunit IV         55.1    4e-07   
ref|WP_011128818.1|  photosystem I reaction center subunit IV         55.1    4e-07   
pdb|1GXI|E  Chain E, Psae Sub-Unit Of The Photosystem I Of The Cy...  55.1    4e-07   
ref|WP_006042096.1|  photosystem I reaction center subunit IV         54.7    5e-07   
ref|WP_002750913.1|  Photosystem I reaction center subunit IV         54.7    5e-07   
ref|WP_028948093.1|  Photosystem I reaction center subunit IV         54.7    6e-07   
ref|WP_011934869.1|  photosystem I reaction center subunit IV         54.3    7e-07   
ref|WP_025974461.1|  photosystem I reaction center subunit IV         53.9    9e-07   
ref|WP_011124526.1|  MULTISPECIES: photosystem I reaction center ...  53.9    1e-06   
ref|WP_022604081.1|  photosystem I reaction centre subunit IV / PsaE  53.9    1e-06   
ref|XP_006386900.1|  hypothetical protein POPTR_0002s25510g           50.8    1e-06   
ref|WP_025913435.1|  photosystem I reaction center subunit IV         53.5    1e-06   
ref|WP_025953424.1|  photosystem I reaction center subunit IV         53.5    1e-06   
ref|WP_011375896.1|  MULTISPECIES: photosystem I reaction center ...  53.5    1e-06   
ref|WP_011817817.1|  MULTISPECIES: photosystem I reaction center ...  53.5    1e-06   
ref|WP_025961797.1|  photosystem I reaction center subunit IV         53.1    2e-06   
ref|WP_025969004.1|  photosystem I reaction center subunit IV         53.1    2e-06   
ref|YP_007878194.1|  photosystem I subunit IV                         52.8    2e-06   
gb|AAA88629.1|  photosystem I subunit III                             52.8    3e-06   
gb|AAL35975.1|  photosystem I subunit PSI-E                           53.1    3e-06   
ref|WP_011131966.1|  photosystem I reaction center subunit IV         52.4    3e-06   
ref|WP_025981204.1|  photosystem I reaction center subunit IV         52.4    3e-06   
ref|WP_025963535.1|  photosystem I reaction center subunit IV         52.4    3e-06   
ref|WP_025969651.1|  MULTISPECIES: photosystem I reaction center ...  52.4    4e-06   
ref|WP_013324912.1|  photosystem I reaction centre subunit IV/PsaE    52.4    4e-06   
ref|WP_011429119.1|  photosystem I reaction center subunit IV         52.0    5e-06   
ref|WP_032526655.1|  photosystem I reaction center subunit IV         52.0    5e-06   
ref|WP_011432873.1|  photosystem I reaction center subunit IV         52.0    5e-06   
ref|WP_025954379.1|  photosystem I reaction center subunit IV         51.6    7e-06   
ref|WP_025922909.1|  photosystem I reaction center subunit IV         51.2    8e-06   
ref|WP_025972862.1|  photosystem I reaction center subunit IV         50.8    1e-05   
ref|WP_025929780.1|  photosystem I reaction center subunit IV         50.8    1e-05   
gb|AAB26646.1|  photosystem I subunit E, PSI-E                        50.1    3e-05   
ref|WP_012007121.1|  photosystem I reaction center subunit IV         49.3    4e-05   
ref|WP_032521927.1|  photosystem I reaction center subunit IV         49.3    4e-05   
ref|WP_011819678.1|  photosystem I reaction center subunit IV         49.3    4e-05   
dbj|BAH57074.1|  AT4G28750                                            50.1    5e-05   
ref|WP_032514045.1|  photosystem I reaction center subunit IV         49.3    5e-05   
gb|KGG03917.1|  photosystem I subunit IV (PsaE)                       49.3    6e-05   
gb|EEE39757.1|  photosystem I reaction center subunit IV              49.3    6e-05   
gb|KGG05753.1|  photosystem I subunit IV (PsaE)                       49.3    6e-05   
ref|WP_025952362.1|  photosystem I reaction center subunit IV         48.1    1e-04   
ref|WP_025945670.1|  photosystem I reaction center subunit IV         47.0    3e-04   
gb|ACG50086.1|  PsaE                                                  46.6    6e-04   
ref|WP_025781276.1|  photosystem I reaction center subunit IV         46.6    6e-04   
gb|ABM78910.1|  Photosystem I PsaE protein (subunit IV)               46.6    6e-04   
ref|WP_019476218.1|  MULTISPECIES: Photosystem I reaction center ...  46.2    7e-04   
ref|WP_011129566.1|  MULTISPECIES: photosystem I reaction center ...  46.2    8e-04   
gb|ACT34028.1|  PsaE                                                  45.8    8e-04   
gb|KJB22615.1|  hypothetical protein B456_004G057800                  47.0    8e-04   
ref|WP_025943921.1|  photosystem I reaction center subunit IV         45.4    0.001   



>ref|XP_004247116.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic 
[Solanum lycopersicum]
Length=140

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 85/117 (73%), Gaps = 6/117 (5%)
 Frame = +3

Query  129  RTSMLMFSSKNTS--FPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrg  302
            ++SML FSSKNT+   PRLVVRA+EE APPA   T       A         P  G K  
Sbjct  27   KSSMLSFSSKNTTTNIPRLVVRAAEEAAPPAPTATAEGEAPPAKAVKPPPIGPKRGTK--  84

Query  303  akVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
              VRILRKESYWYKG GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDE+EEV
Sbjct  85   --VRILRKESYWYKGTGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEVEEV  139



>ref|XP_006350287.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Solanum tuberosum]
Length=141

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 94/117 (80%), Gaps = 5/117 (4%)
 Frame = +3

Query  129  RTSMLMFSSKN--TSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrg  302
            ++SML FSSKN  T+ PRLVVRA+E       A T      G AP  KAAKPPPIGPKRG
Sbjct  27   KSSMLSFSSKNNTTNIPRLVVRAAE---AAPPAATATATAEGEAPPAKAAKPPPIGPKRG  83

Query  303  akVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
             KVRILRKESYWYKG GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDE+EEV
Sbjct  84   TKVRILRKESYWYKGTGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEVEEV  140



>ref|XP_006352721.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic-like 
[Solanum tuberosum]
Length=138

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 93/117 (79%), Gaps = 5/117 (4%)
 Frame = +3

Query  126  QRTSMLMF-SSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrg  302
             RT+ML F S+K T+ PRLVVRA+ E     AA   A      A   KAAKPPPIGPKRG
Sbjct  26   SRTNMLFFPSNKITTTPRLVVRAAAE----EAAPPGAAATAEPAVETKAAKPPPIGPKRG  81

Query  303  akVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            +KVR+LRKESYWYKG GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  82   SKVRVLRKESYWYKGTGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  138



>ref|XP_011083089.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic 
[Sesamum indicum]
Length=139

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +3

Query  129  RTSMLMFSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrgak  308
            +T+M+ F +KN    RLVVRA EE A   AA  T +P   A  APK     P    +   
Sbjct  27   KTTMVFFPTKNNRCSRLVVRAEEEAAAAPAAAATDSPPAEAPKAPKPPPIGPPRGSK---  83

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIE  467
            VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDE+E
Sbjct  84   VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEVE  136



>dbj|BAA07667.1| PSI-E subunit of photosystem I [Nicotiana sylvestris]
Length=147

 Score =   121 bits (303),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 88/119 (74%), Gaps = 4/119 (3%)
 Frame = +3

Query  129  RTSMLMFSS-KN---TSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpk  296
            RTSML FSS KN   T+FPRLVVRA+EE APPAA  T       A  A      P  G K
Sbjct  28   RTSMLFFSSSKNNTTTNFPRLVVRAAEEAAPPAATATAEGEAPPAKAAKPPPIGPKRGTK  87

Query  297  rgakVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
                VR+LRKESYWYKGVGSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDE+EEV
Sbjct  88   VSTPVRVLRKESYWYKGVGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEV  146



>ref|XP_004242379.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic 
[Solanum lycopersicum]
Length=138

 Score =   120 bits (302),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 92/117 (79%), Gaps = 5/117 (4%)
 Frame = +3

Query  126  QRTSMLMF-SSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrg  302
             RT+ML F S+K T+  RLVVRA+ E     AA   A      A   KAAKPPPIGPKRG
Sbjct  26   SRTNMLFFPSNKITTTQRLVVRAAAE----EAAAPAAAATAEPAVETKAAKPPPIGPKRG  81

Query  303  akVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            +KVR+LRKESYWYKG GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  82   SKVRVLRKESYWYKGTGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  138



>ref|XP_002266424.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Vitis vinifera]
Length=143

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  135  SMLMFSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrgakVR  314
            SM++FS KN    RLVVRASE   PP        P   A       KPPPIGPKRG KV+
Sbjct  30   SMVIFSPKNHRNSRLVVRASEGGPPPPPPPPPPAPAPVAEGGAPPPKPPPIGPKRGTKVK  89

Query  315  ILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            ILRKESYWY G+GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI+EV+
Sbjct  90   ILRKESYWYNGIGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEVI  143



>emb|CDP03826.1| unnamed protein product [Coffea canephora]
Length=144

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 93/133 (70%), Gaps = 5/133 (4%)
 Frame = +3

Query  81   GLvtpnvvtsnnnttQRTSMLMFSSKN--TSFPRLVVRASEETappaaatttatpeggaa  254
            GL    V ++ +   + T + +  SKN  TS  RLVVRASEETAP AAAT  A P     
Sbjct  14   GLTPNAVSSNTSTAHKSTFLFLLPSKNNATSCTRLVVRASEETAPAAAATAPAEPAAPPP  73

Query  255  papkaakpppigpkrgakVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANV  434
             APK     P    +   VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANV
Sbjct  74   QAPKPPPIGPKRGTK---VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANV  130

Query  435  STNNYALDEIEEV  473
            STNNYALDEI+E+
Sbjct  131  STNNYALDEIQEI  143



>gb|AEC11063.1| photosystem I reaction center subunit iv b, partial (chloroplast) 
[Camellia sinensis]
Length=99

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV*VMF  488
            VRILRKESYW+KG+GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  +++
Sbjct  31   VRILRKESYWFKGIGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVKRILY  90

Query  489  *CCNIASCV  515
             C  I S V
Sbjct  91   ICVPILSVV  99



>emb|CBI37232.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +3

Query  138  MLMFSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrgakVRI  317
            M++FS KN    RLVVRASE   PP        P   A       KPPPIGPKRG KV+I
Sbjct  1    MVIFSPKNHRNSRLVVRASEGGPPPPPPPPPPAPAPVAEGGAPPPKPPPIGPKRGTKVKI  60

Query  318  LRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            LRKESYWY G+GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI+EV+
Sbjct  61   LRKESYWYNGIGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEVI  113



>ref|XP_004495033.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic-like 
[Cicer arietinum]
Length=141

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 77/118 (65%), Gaps = 8/118 (7%)
 Frame = +3

Query  126  QRTSMLMFSSKNTSFP--RLVVRASEETappaaatttatpeggaapapkaakpppigpkr  299
             R++MLMF  K+ +    RLVVRAS++ AP  A              P            
Sbjct  30   SRSTMLMFPIKSNTIATSRLVVRASDDAAPATATPPADAEVAAKPKPPPIGPKRGAK---  86

Query  300  gakVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
               V+ILRKESYWYKG GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  87   ---VKILRKESYWYKGTGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  141



>ref|XP_010684821.1| PREDICTED: photosystem I reaction center subunit IV, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=126

 Score =   117 bits (293),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 77/110 (70%), Gaps = 8/110 (7%)
 Frame = +3

Query  147  FSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrgakVRILRK  326
            FS ++T   RLVVRA+E+ A   AA   A     AA  P    P          VRILRK
Sbjct  25   FSPRST---RLVVRAAEDAAAAPAAAAPAGEAPAAAAKPPPVGPKRGSK-----VRILRK  76

Query  327  ESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            ESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI+EV 
Sbjct  77   ESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEVA  126



>sp|P12354.1|PSAE_SPIOL RecName: Full=Photosystem I reaction center subunit IV, chloroplastic; 
Short=PSI-E; Flags: Precursor [Spinacia oleracea]
 emb|CAA32183.1| unnamed protein product [Spinacia oleracea]
Length=125

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 78/114 (68%), Gaps = 8/114 (7%)
 Frame = +3

Query  144  MFSSKNTSFPR---LVVRASEETappaaatttatpeggaapapkaakpppigpkrgakVR  314
            +  +KN S PR   LVVRA+EE A   AA +       AA  P    P          VR
Sbjct  17   VLPNKNFSSPRSTRLVVRAAEEAAAAPAAASPEGEAPKAAAKPPPIGPKRGSK-----VR  71

Query  315  ILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            I+RKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI+EV 
Sbjct  72   IMRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEVA  125



>ref|NP_001289510.1| photosystem I reaction center subunit IV A, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009589108.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q41228.1|PSAEA_NICSY RecName: Full=Photosystem I reaction center subunit IV A, chloroplastic; 
Short=PSI-E A; Contains: RecName: Full=Photosystem 
I reaction center subunit IV A isoform 2; Flags: Precursor 
[Nicotiana sylvestris]
 gb|AAB31704.1| photosystem I subunit PSI-E (chloroplast) [Nicotiana sylvestris]
Length=141

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 86/118 (73%), Gaps = 6/118 (5%)
 Frame = +3

Query  126  QRTSMLMFSSKN--TSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkr  299
             RT+ML FSSKN  ++ PRLVVRA+EE APPAAA T    E     A      P  G K 
Sbjct  27   SRTTMLFFSSKNYGSTAPRLVVRAAEEAAPPAAAATAEPAEAPVKAAKPPPIGPKRGTK-  85

Query  300  gakVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
               VRILRKESYWYKG GSVVA DQDP TRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  86   ---VRILRKESYWYKGTGSVVACDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEV  140



>ref|NP_001289527.1| photosystem I reaction center subunit IV B, chloroplastic [Nicotiana 
sylvestris]
 sp|Q41229.1|PSAEB_NICSY RecName: Full=Photosystem I reaction center subunit IV B, chloroplastic; 
Short=PSI-E B; Contains: RecName: Full=Photosystem 
I reaction center subunit IV B isoform 2; Flags: Precursor 
[Nicotiana sylvestris]
 gb|AAB31705.1| photosystem I subunit PSI-E (chloroplast) [Nicotiana sylvestris]
Length=143

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = +3

Query  129  RTSMLMFSS-KN---TSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpk  296
            RTSML FSS KN   T+FPRLVVRA+EE APPAA  T       A  A      P  G K
Sbjct  28   RTSMLFFSSSKNNTTTNFPRLVVRAAEEAAPPAATATAEGEAPPAKAAKPPPIGPKRGTK  87

Query  297  rgakVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
                VR+LRKESYWYKGVGSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDE+EEV
Sbjct  88   ----VRVLRKESYWYKGVGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEV  142



>ref|XP_002301832.1| Photosystem I reaction center subunit IV A family protein [Populus 
trichocarpa]
 gb|EEE81105.1| Photosystem I reaction center subunit IV A family protein [Populus 
trichocarpa]
Length=140

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 89/118 (75%), Gaps = 7/118 (6%)
 Frame = +3

Query  126  QRTSMLMFSSKNTS--FPRLVVRASEETappaaatttatpeggaapapkaakpppigpkr  299
             + +ML FSSKN +  + RLVVR++EE      A+  A     A       KPPPIGPKR
Sbjct  27   SKPTMLFFSSKNNNKNYSRLVVRSAEE-----GASPPAATTEPAVAEAPKPKPPPIGPKR  81

Query  300  gakVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            G KV+ILRKESYW+ GVGSVVAVDQDP++RYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  82   GTKVKILRKESYWFNGVGSVVAVDQDPRSRYPVVVRFNKVNYANVSTNNYALDEIEEV  139



>ref|XP_009622504.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic 
[Nicotiana tomentosiformis]
Length=145

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 88/120 (73%), Gaps = 9/120 (8%)
 Frame = +3

Query  129  RTSMLMFSS-KN----TSFPRLVVRASEETappaaatttatpeggaapapkaakpppigp  293
            RTSML FSS KN    T+FPRLVVRA+EE APPAA  T       A  A      P  G 
Sbjct  29   RTSMLFFSSSKNNNTTTNFPRLVVRAAEEAAPPAATATAEGEAPPAKAAKPPPIGPKRGT  88

Query  294  krgakVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            K    VR+LRKESYWYKGVGSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDE+EEV
Sbjct  89   K----VRVLRKESYWYKGVGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEEV  144



>gb|ABK94240.1| unknown [Populus trichocarpa]
Length=110

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +3

Query  138  MLMFSSKNTS--FPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrgakV  311
            ML FSSKN +  + RLVVR++EE A P AATT         P P    P          V
Sbjct  1    MLFFSSKNNNKNYSRLVVRSAEEGASPPAATTEPAVAEAPKPKPPPIGPKRGTK-----V  55

Query  312  RILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            +ILRKESYW+ GVGSVVAVDQDP++RYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  56   KILRKESYWFNGVGSVVAVDQDPRSRYPVVVRFNKVNYANVSTNNYALDEIEEV  109



>ref|WP_039311817.1| Photosystem I reaction center subunit IV [Paenibacillus sp. IHB 
B 3415]
 gb|KHL91113.1| Photosystem I reaction center subunit IV [Paenibacillus sp. IHB 
B 3415]
Length=64

 Score =   112 bits (279),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 55/55 (100%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW+KG+GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  9    VRILRKESYWFKGIGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  63



>ref|XP_011024524.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic-like 
[Populus euphratica]
Length=140

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 88/118 (75%), Gaps = 7/118 (6%)
 Frame = +3

Query  126  QRTSMLMFSSKNTS--FPRLVVRASEETappaaatttatpeggaapapkaakpppigpkr  299
             + +ML  SSKN +  + RLVVR++EE      A+  A     A       KPPPIGPKR
Sbjct  27   SKPTMLFLSSKNNNKNYSRLVVRSAEE-----GASPPAATTEPAVAEAPKPKPPPIGPKR  81

Query  300  gakVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            G KV+ILRKESYW+ GVGSVVAVDQDP++RYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  82   GTKVKILRKESYWFNGVGSVVAVDQDPRSRYPVVVRFNKVNYANVSTNNYALDEIEEV  139



>gb|ACJ84185.1| unknown [Medicago truncatula]
 gb|AFK46371.1| unknown [Medicago truncatula]
Length=138

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 75/116 (65%), Gaps = 9/116 (8%)
 Frame = +3

Query  126  QRTSMLMFSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrga  305
             R +M+M+ +   +  RLVVRASEE A        A P+    P                
Sbjct  31   SRMNMVMYPTTRNTNSRLVVRASEEAAATPTVEGEAAPKTKPPPIGPKRGAK--------  82

Query  306  kVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
             V++LRKESYW+ G+GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  83   -VKVLRKESYWFNGIGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEV  137



>ref|XP_003625462.1| Photosystem I reaction center subunit IV A [Medicago truncatula]
 gb|AES81680.1| photosystem I reaction center subunit IV A [Medicago truncatula]
 gb|AFK39271.1| unknown [Medicago truncatula]
Length=138

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 75/116 (65%), Gaps = 9/116 (8%)
 Frame = +3

Query  126  QRTSMLMFSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrga  305
             R +M+M+ +   +  RLVVRASEE A        A P+    P                
Sbjct  31   SRMNMVMYPTTRNTNSRLVVRASEEAAATPTVEGEAAPKTKPPPIGPKRGAK--------  82

Query  306  kVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
             V++LRKESYW+ G+GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  83   -VKVLRKESYWFNGIGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEV  137



>gb|KJB22614.1| hypothetical protein B456_004G057800 [Gossypium raimondii]
Length=147

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = +3

Query  135  SMLMFSSKNTSF--PRLVVRASEETappaaatttatpeggaapapkaakpppigpkrgak  308
            SML   S+N  +   RLVVRA+EE A P A T   T            KPPPIGPKRG K
Sbjct  32   SMLFSPSRNNYYNSSRLVVRAAEEEASPPAPTPATTTAPPEGGEAPKPKPPPIGPKRGTK  91

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR+ESYWY G GSVV VDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  92   VRILRRESYWYNGYGSVVTVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  146



>emb|CAD29821.2| putative photosystem I reaction centre subunit IV [Populus x 
canadensis]
Length=140

 Score =   113 bits (282),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 87/118 (74%), Gaps = 7/118 (6%)
 Frame = +3

Query  126  QRTSMLMFSSKNTS--FPRLVVRASEETappaaatttatpeggaapapkaakpppigpkr  299
             + +ML FSSKN +  + RLVVR++EE      A+  A     A       KPPPIGPKR
Sbjct  27   SKPTMLFFSSKNNNKNYSRLVVRSAEE-----GASPPAATTEPAVAEAPKPKPPPIGPKR  81

Query  300  gakVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            G KV+ILRKESYW+ G GSV AVDQDP++RYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  82   GTKVKILRKESYWFNGFGSVAAVDQDPRSRYPVVVRFNKVNYANVSTNNYALDEIEEV  139



>gb|EYU46372.1| hypothetical protein MIMGU_mgv1a015998mg [Erythranthe guttata]
Length=138

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 81/115 (70%), Gaps = 4/115 (3%)
 Frame = +3

Query  129  RTSMLMFSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrgak  308
            ++SML FSSK     RLVVRA E  AP  AA   A     AA        PP G K    
Sbjct  27   KSSMLFFSSKTNRNSRLVVRAEEAAAPAPAADAPAADAPKAAKPKPPPVGPPRGSK----  82

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDE+E V
Sbjct  83   VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEVELV  137



>ref|XP_011080143.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic 
[Sesamum indicum]
Length=140

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 79/112 (71%), Gaps = 2/112 (2%)
 Frame = +3

Query  138  MLMFSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrgakVRI  317
            ML FS KN  + RLVVRA+EE A PA A  T     G AP      P          VRI
Sbjct  30   MLFFSPKNNRYSRLVVRAAEEAATPAPAAATTEAPAGEAPKVAKPPPIGPPRGSK--VRI  87

Query  318  LRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            LRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDE+E V
Sbjct  88   LRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEVEVV  139



>ref|XP_008346243.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Malus domestica]
Length=106

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYW+KG+GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  51   VKILRKESYWFKGIGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEV  105



>ref|XP_009370977.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic 
[Pyrus x bretschneideri]
Length=145

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYW+KG+GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  90   VKILRKESYWFKGIGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEV  144



>dbj|BAF80474.1| PSI reaction center subunit III [Citrus sinensis]
Length=143

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 83/118 (70%), Gaps = 4/118 (3%)
 Frame = +3

Query  126  QRTSMLMFSSKNTSFP--RLVVRASEETappaaatttatpeggaapapkaakpppigpkr  299
             +++ML F  KN S    RLVVRASE+ A P AA TTA P  G A       P       
Sbjct  27   SKSNMLFFPPKNNSSNSFRLVVRASEDAAAPPAAATTAAPAEGEAAPKPKPPPIGPKRGA  86

Query  300  gakVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
               V+ILR+ESYWY G+GSVVAVDQDPK+RYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  87   K--VKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEV  142



>ref|XP_008372420.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Malus domestica]
 ref|XP_008364331.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Malus domestica]
Length=145

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYW+KG+GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  90   VKILRKESYWFKGIGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEV  144



>gb|AFK44960.1| unknown [Medicago truncatula]
 gb|KEH42426.1| photosystem I reaction center subunit IV A [Medicago truncatula]
Length=148

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            V+ILRKESYWYKG GSVVAVDQDPKTRYPVVVRF KVNYANVSTNNYALDEIEEVV
Sbjct  93   VKILRKESYWYKGTGSVVAVDQDPKTRYPVVVRFQKVNYANVSTNNYALDEIEEVV  148



>ref|XP_004493851.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic-like 
[Cicer arietinum]
Length=140

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V++LRKESYW+ G+GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  85   VKVLRKESYWFNGIGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  139



>gb|EPS72223.1| hypothetical protein M569_02531 [Genlisea aurea]
Length=135

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 75/115 (65%), Gaps = 8/115 (7%)
 Frame = +3

Query  129  RTSMLMFSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrgak  308
            +   L  SS+N   PRLVVRA +E AP    T    P+    P     +           
Sbjct  28   KMGALFLSSRNRRNPRLVVRAEDEAAPATTTTAAEAPKAAKPPPIGPPRGSK--------  79

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWYK VGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDE+E V
Sbjct  80   VRILRKESYWYKNVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEVEAV  134



>ref|XP_007140691.1| hypothetical protein PHAVU_008G133700g [Phaseolus vulgaris]
 gb|ESW12685.1| hypothetical protein PHAVU_008G133700g [Phaseolus vulgaris]
Length=130

 Score =   110 bits (275),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYKG GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  75   VKILRKESYWYKGTGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIVEV  129



>gb|KDP26436.1| hypothetical protein JCGZ_17594 [Jatropha curcas]
Length=141

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G+GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  86   VKILRRESYWYNGIGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  140



>ref|XP_006408942.1| hypothetical protein EUTSA_v10002106mg [Eutrema salsugineum]
 gb|ESQ50395.1| hypothetical protein EUTSA_v10002106mg [Eutrema salsugineum]
Length=173

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVVAVDQDPKTRYPVVVRF+KVNYAN+STNNYALDEIEEV
Sbjct  118  VKILRKESYWYKNVGSVVAVDQDPKTRYPVVVRFSKVNYANISTNNYALDEIEEV  172



>ref|XP_006298744.1| hypothetical protein CARUB_v10014843mg [Capsella rubella]
 gb|EOA31642.1| hypothetical protein CARUB_v10014843mg [Capsella rubella]
Length=148

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVVAVDQDPKTRYPVVVRF+KVNYAN+STNNYALDEIEEV
Sbjct  93   VKILRKESYWYKNVGSVVAVDQDPKTRYPVVVRFSKVNYANISTNNYALDEIEEV  147



>ref|XP_010495919.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic 
[Camelina sativa]
Length=151

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVVAVDQDPKTRYPVVVRF+KVNYAN+STNNYALDEIEEV
Sbjct  96   VKILRKESYWYKNVGSVVAVDQDPKTRYPVVVRFSKVNYANISTNNYALDEIEEV  150



>ref|XP_007201838.1| hypothetical protein PRUPE_ppa012923mg [Prunus persica]
 gb|EMJ03037.1| hypothetical protein PRUPE_ppa012923mg [Prunus persica]
Length=149

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+KG+GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  94   VKILRRESYWFKGIGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEV  148



>ref|XP_002885991.1| hypothetical protein ARALYDRAFT_899838 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62250.1| hypothetical protein ARALYDRAFT_899838 [Arabidopsis lyrata subsp. 
lyrata]
Length=143

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVVAVDQDPKTRYPVVVRF+KVNYAN+STNNYALDE+EEV
Sbjct  88   VKILRKESYWYKNVGSVVAVDQDPKTRYPVVVRFSKVNYANISTNNYALDEVEEV  142



>ref|XP_010263995.1| PREDICTED: photosystem I reaction center subunit IV, chloroplastic 
[Nelumbo nucifera]
Length=133

 Score =   110 bits (275),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            V+ILRKESYWY G+GSVV VDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI+E +
Sbjct  77   VKILRKESYWYNGIGSVVTVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEAI  132



>ref|XP_008235545.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic 
[Prunus mume]
Length=147

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+KG+GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  92   VKILRRESYWFKGIGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEV  146



>ref|XP_007144431.1| hypothetical protein PHAVU_007G155500g [Phaseolus vulgaris]
 gb|ESW16425.1| hypothetical protein PHAVU_007G155500g [Phaseolus vulgaris]
Length=132

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 74/112 (66%), Gaps = 7/112 (6%)
 Frame = +3

Query  138  MLMFSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkrgakVRI  317
            ++MF SKN +  RLVVRAS+E AP  A  T           P               V+I
Sbjct  27   LIMFPSKNNA-SRLVVRASDEAAPAPATATPPPEAEAKPKPPPIGPKRGAK------VKI  79

Query  318  LRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            LRKESYWYKG GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  80   LRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIAEV  131



>ref|XP_009397624.1| PREDICTED: photosystem I reaction center subunit IV, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=137

 Score =   110 bits (274),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYKG+GSVV VDQDPKTRYPVVVRFNKVNYA VSTNNYALDEI+EV
Sbjct  83   VKILRKESYWYKGIGSVVTVDQDPKTRYPVVVRFNKVNYAGVSTNNYALDEIQEV  137



>ref|NP_001275778.1| PSI reaction center subunit III [Citrus sinensis]
 ref|XP_006443686.1| hypothetical protein CICLE_v10022750mg [Citrus clementina]
 dbj|BAF80472.1| PS1 reaction center subunit III [Citrus sinensis]
 dbj|BAF80476.1| PSI reaction center subunit III [Citrus sinensis]
 dbj|BAF80478.1| PSI reaction center subunit III [Citrus sinensis]
 gb|ESR56926.1| hypothetical protein CICLE_v10022750mg [Citrus clementina]
 gb|KDO65795.1| hypothetical protein CISIN_1g032316mg [Citrus sinensis]
Length=143

 Score =   110 bits (274),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G+GSVVAVDQDPK+RYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  88   VKILRRESYWYNGIGSVVAVDQDPKSRYPVVVRFNKVNYANVSTNNYALDEIEEV  142



>ref|XP_004290022.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=141

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+KG+GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  86   VKILRRESYWFKGIGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEV  140



>ref|XP_008382669.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Malus domestica]
 ref|XP_008349005.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Malus domestica]
Length=145

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+KG+GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  90   VKILRRESYWFKGIGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIEEV  144



>ref|XP_010069685.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic 
[Eucalyptus grandis]
 gb|KCW58105.1| hypothetical protein EUGRSUZ_H00828 [Eucalyptus grandis]
Length=136

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWY G+GSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI+E+
Sbjct  82   VKILRKESYWYNGIGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEI  136



>gb|ACJ85926.1| unknown [Medicago truncatula]
Length=148

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            V+ILRKESYWYKG GSVVAVDQDPKTRYPVVVRF KVNY NVSTNNYALDEIEEVV
Sbjct  93   VKILRKESYWYKGTGSVVAVDQDPKTRYPVVVRFQKVNYVNVSTNNYALDEIEEVV  148



>ref|XP_010243638.1| PREDICTED: photosystem I reaction center subunit IV, chloroplastic 
[Nelumbo nucifera]
Length=134

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWY G+GSVV VDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI+EV
Sbjct  79   VKILRKESYWYNGIGSVVTVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEV  133



>gb|KHN05901.1| Photosystem I reaction center subunit IV A, chloroplastic [Glycine 
soja]
Length=119

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYKG GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  64   VKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEV  118



>gb|KFK40388.1| hypothetical protein AALP_AA3G367100 [Arabis alpina]
Length=138

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDEIEEV
Sbjct  83   VKILRKESYWFKTVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEIEEV  137



>ref|NP_001236993.1| uncharacterized protein LOC100526993 [Glycine max]
 gb|ACU16030.1| unknown [Glycine max]
Length=129

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYKG GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  74   VKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEV  128



>ref|NP_001240010.1| uncharacterized protein LOC100811078 [Glycine max]
 gb|ACU19433.1| unknown [Glycine max]
Length=129

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYKG GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  74   VKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEV  128



>ref|NP_001236772.1| uncharacterized protein LOC100500098 [Glycine max]
 gb|ACU14907.1| unknown [Glycine max]
Length=129

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYKG GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  74   VKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEV  128



>ref|XP_006412915.1| hypothetical protein EUTSA_v10026332mg [Eutrema salsugineum]
 gb|ESQ54368.1| hypothetical protein EUTSA_v10026332mg [Eutrema salsugineum]
Length=186

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDEIEEV
Sbjct  130  VKILRKESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEIEEV  184



>ref|NP_001236392.1| uncharacterized protein LOC100499814 [Glycine max]
 gb|ACU13764.1| unknown [Glycine max]
Length=129

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYKG GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  74   VKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEV  128



>gb|KHN48968.1| Photosystem I reaction center subunit IV A, chloroplastic [Glycine 
soja]
Length=131

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYKG GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  76   VKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEV  130



>ref|XP_010416079.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Camelina sativa]
Length=150

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVVAVDQDPK+RYPVVVRF+KVNYAN+STNNYALDEIEEV
Sbjct  95   VKILRKESYWYKNVGSVVAVDQDPKSRYPVVVRFSKVNYANISTNNYALDEIEEV  149



>gb|EYU17960.1| hypothetical protein MIMGU_mgv1a015996mg [Erythranthe guttata]
Length=138

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWYKGVGSVVAVDQD KTRYPVVVRFNKVNYANVSTNNYALDE+E V
Sbjct  83   VRILRKESYWYKGVGSVVAVDQDNKTRYPVVVRFNKVNYANVSTNNYALDEVELV  137



>emb|CDY06874.1| BnaC01g09730D [Brassica napus]
Length=143

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDEIEEV
Sbjct  87   VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEIEEV  141



>ref|NP_179616.1| photosystem I subunit E-2 [Arabidopsis thaliana]
 sp|Q9S714.1|PSAE2_ARATH RecName: Full=Photosystem I reaction center subunit IV B, chloroplastic; 
Short=PSI-E B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD21762.1| putative photosystem I reaction center subunit IV [Arabidopsis 
thaliana]
 emb|CAB52679.1| photosystem I subunit IV precursor [Arabidopsis thaliana]
 gb|AAK68763.1| putative photosystem I reaction center subunit IV [Arabidopsis 
thaliana]
 gb|AAO00900.1| putative photosystem I reaction center subunit IV [Arabidopsis 
thaliana]
 gb|AEC06986.1| photosystem I subunit E-2 [Arabidopsis thaliana]
Length=145

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDE+EEV
Sbjct  90   VKILRKESYWYKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV  144



>gb|AAM63830.1| Photosystem I reaction center subunit IV B, chloroplast precursor 
(PSI-E B) [Arabidopsis thaliana]
Length=143

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDE+EEV
Sbjct  88   VKILRKESYWYKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV  142



>ref|XP_009386574.1| PREDICTED: photosystem I reaction center subunit IV, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=142

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWY G+GSVV VDQDPKTRYPVVVRFNKVNYA VSTNNYALDEI+EV
Sbjct  88   VKILRKESYWYNGIGSVVTVDQDPKTRYPVVVRFNKVNYAGVSTNNYALDEIQEV  142



>ref|XP_002521161.1| photosystem I reaction center subunit IV A, chloroplast precursor 
[Ricinus communis]
 gb|EEF41312.1| photosystem I reaction center subunit IV A, chloroplast precursor 
[Ricinus communis]
Length=141

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G+GSVVAVDQDPKTRYPVVVRF+KVNYANVSTNNYALDEIEEV
Sbjct  86   VKILRRESYWYNGIGSVVAVDQDPKTRYPVVVRFDKVNYANVSTNNYALDEIEEV  140



>pdb|3LW5|E Chain E, Improved Model Of Plant Photosystem I
Length=64

 Score =   105 bits (263),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYKG GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  9    VKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEV  63



>gb|KHG12594.1| Photosystem I reaction center subunit IV, chloroplastic [Gossypium 
arboreum]
Length=147

 Score =   107 bits (268),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G GSVV VDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  92   VKILRRESYWYNGYGSVVTVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  146



>ref|XP_010548721.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic 
[Tarenaya hassleriana]
Length=145

 Score =   107 bits (268),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVVAVDQDPKTRYPVVVRF KVNYANVSTNNYALDE+EEV
Sbjct  90   VKILRKESYWYKNVGSVVAVDQDPKTRYPVVVRFPKVNYANVSTNNYALDEVEEV  144



>gb|KHN48967.1| Photosystem I reaction center subunit IV A, chloroplastic [Glycine 
soja]
Length=95

 Score =   106 bits (264),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYKG GSVVAVDQDP TRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  40   VKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEV  94



>ref|XP_010489072.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Camelina sativa]
Length=180

 Score =   108 bits (270),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVVAVDQDPK++YPVVVRF+KVNYAN+STNNYALDEIEEV
Sbjct  125  VKILRKESYWYKNVGSVVAVDQDPKSQYPVVVRFSKVNYANISTNNYALDEIEEV  179



>gb|KFK29416.1| hypothetical protein AALP_AA7G131600 [Arabis alpina]
Length=143

 Score =   107 bits (268),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDEIEEV
Sbjct  87   VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEIEEV  141



>emb|CDX97458.1| BnaC08g13230D [Brassica napus]
Length=143

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDEIEEV
Sbjct  87   VKILRRESYWFKSVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEIEEV  141



>ref|XP_006284717.1| hypothetical protein CARUB_v10005979mg [Capsella rubella]
 gb|EOA17615.1| hypothetical protein CARUB_v10005979mg [Capsella rubella]
Length=142

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDEIEEV
Sbjct  86   VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEIEEV  140



>ref|XP_002867438.1| hypothetical protein ARALYDRAFT_491882 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43697.1| hypothetical protein ARALYDRAFT_491882 [Arabidopsis lyrata subsp. 
lyrata]
Length=143

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDE+EEV
Sbjct  87   VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV  141



>ref|XP_009109070.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic-like 
[Brassica rapa]
 emb|CDY68271.1| BnaA08g30780D [Brassica napus]
Length=143

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDEIEEV
Sbjct  87   VKILRRESYWFKSVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEIEEV  141



>ref|XP_009129307.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic 
[Brassica rapa]
Length=143

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDEIEE+
Sbjct  87   VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEIEEL  141



>emb|CDY35216.1| BnaA01g08150D [Brassica napus]
Length=143

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDEIEE+
Sbjct  87   VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEIEEL  141



>gb|KHG24461.1| Photosystem I reaction center subunit IV B, chloroplastic -like 
protein [Gossypium arboreum]
Length=145

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = +3

Query  135  SMLMFSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkr-gakV  311
            +M+ F SK  +  RLVVRA++E +PP  + T AT              PP    + G KV
Sbjct  31   NMVFFPSKTNNTSRLVVRAADEASPPPPSPTPATTTAPPEGGEAPKPKPPPIGPKRGTKV  90

Query  312  RILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            +ILR+ESYWY   GSVV VDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  91   KILRRESYWYNSYGSVVTVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  144



>gb|ADC53693.1| photosystem I psaE [Morus alba var. multicaulis]
Length=145

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR+ESYWYK VGSVVAVDQDPK+RYPVVVRFNKVNYA+VSTNNYALDEI EV
Sbjct  90   VRILRRESYWYKDVGSVVAVDQDPKSRYPVVVRFNKVNYASVSTNNYALDEIAEV  144



>ref|XP_010526478.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Tarenaya hassleriana]
Length=147

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVVAVDQDPKTRYPVVVRF KVNYANVSTNNYALDE++EV
Sbjct  92   VKILRKESYWYKNVGSVVAVDQDPKTRYPVVVRFPKVNYANVSTNNYALDEVQEV  146



>ref|XP_010433167.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic 
[Camelina sativa]
Length=144

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPK+RYPVVVRF KVNYAN+STNNYALDEIEEV
Sbjct  88   VKILRRESYWFKTVGSVVAVDQDPKSRYPVVVRFAKVNYANISTNNYALDEIEEV  142



>ref|XP_010438388.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic 
[Camelina sativa]
Length=145

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPK+RYPVVVRF KVNYAN+STNNYALDEIEEV
Sbjct  89   VKILRRESYWFKTVGSVVAVDQDPKSRYPVVVRFAKVNYANISTNNYALDEIEEV  143



>gb|KJB11001.1| hypothetical protein B456_001G235800 [Gossypium raimondii]
Length=148

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 78/116 (67%), Gaps = 3/116 (3%)
 Frame = +3

Query  135  SMLMFSSKNTSFPRLVVRASEETappaaatttatpeggaapapkaakpppigpkr---ga  305
            +M+ F SK  +  RLVVRA++E +PP    +       A P    A  P   P     G 
Sbjct  32   NMVFFPSKTNNTSRLVVRAADEASPPPPPPSPTPATATAPPEGGEAPKPKPPPIGPKRGT  91

Query  306  kVRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            KV+ILR+ESYWY   GSVV VDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  92   KVKILRRESYWYNSYGSVVTVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  147



>ref|XP_010447920.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic-like 
[Camelina sativa]
Length=145

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPK+RYPVVVRF KVNYAN+STNNYALDEIEEV
Sbjct  89   VKILRRESYWFKTVGSVVAVDQDPKSRYPVVVRFAKVNYANISTNNYALDEIEEV  143



>pdb|4RKU|E Chain E, Crystal Structure Of Plant Photosystem I At 3 Angstrom 
Resolution
Length=63

 Score =   103 bits (257),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEE  470
            V+ILR+ESYWYKG GSVV VDQDP TRYPVVVRFNKVNYANVSTNNYALDE+EE
Sbjct  10   VKILRQESYWYKGTGSVVTVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEVEE  63



>pdb|2O01|E Chain E, The Structure Of A Plant Photosystem I Supercomplex 
At 3.4 Angstrom Resolution
Length=62

 Score =   103 bits (256),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDE+EEV
Sbjct  7    VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV  61



>gb|AAT72503.1| AT4G28750 [Arabidopsis lyrata subsp. petraea]
Length=96

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDE+EEV
Sbjct  40   VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV  94



>emb|CAK18840.1| subunit IV of photosystem I (PSI-E) precursor [Phillyrea latifolia]
Length=51

 Score =   102 bits (255),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/50 (98%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +3

Query  324  KESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            KESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI+EV
Sbjct  1    KESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEV  50



>ref|NP_567818.2| photosystem I reaction center subunit E [Arabidopsis thaliana]
 sp|Q9S831.1|PSAE1_ARATH RecName: Full=Photosystem I reaction center subunit IV A, chloroplastic; 
Short=PSI-E A; Flags: Precursor [Arabidopsis thaliana]
 pdb|2WSC|E Chain E, Improved Model Of Plant Photosystem I
 pdb|2WSE|E Chain E, Improved Model Of Plant Photosystem I
 pdb|2WSF|E Chain E, Improved Model Of Plant Photosystem I
 emb|CAA22977.1| photosystem I subunit PSI-E-like protein [Arabidopsis thaliana]
 emb|CAB52678.1| photosystem I subunit IV precursor [Arabidopsis thaliana]
 emb|CAB81463.1| photosystem I subunit PSI-E-like protein [Arabidopsis thaliana]
 gb|AAK68730.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10249.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85537.1| photosystem I reaction center subunit E [Arabidopsis thaliana]
Length=143

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDE+EEV
Sbjct  87   VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV  141



>gb|AAG40045.1|AF324694_1 AT4g28750 [Arabidopsis thaliana]
Length=110

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDE+EEV
Sbjct  54   VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV  108



>ref|XP_008441802.1| PREDICTED: photosystem I reaction center subunit IV, chloroplastic-like 
[Cucumis melo]
Length=146

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVV VDQDP TRYPVVVRFNKVNYA+VSTNNYALDEIEEV
Sbjct  91   VKILRKESYWYKDVGSVVTVDQDPNTRYPVVVRFNKVNYASVSTNNYALDEIEEV  145



>gb|AAG41443.2|AF326861_1 putative photosystem I subunit PSI-E [Arabidopsis thaliana]
Length=115

 Score =   104 bits (259),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDE+EEV
Sbjct  59   VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV  113



>ref|XP_010918840.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Elaeis guineensis]
Length=136

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWY G+GSVV VDQDP+TRYPVVVRFNKVNYA VSTNNYALDEI+EV
Sbjct  81   VKILRKESYWYNGIGSVVTVDQDPRTRYPVVVRFNKVNYAGVSTNNYALDEIKEV  135



>gb|AAN41281.1| putative photosystem I subunit PSI-E protein [Arabidopsis thaliana]
Length=141

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYAN+STNNYALDE+EEV
Sbjct  85   VKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV  139



>ref|XP_010540940.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic 
[Tarenaya hassleriana]
Length=100

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+I RKESYWYK VGSVVAVDQDPKTRYPVVVRF KVNYANVSTNNYALDE++EV
Sbjct  45   VKITRKESYWYKNVGSVVAVDQDPKTRYPVVVRFPKVNYANVSTNNYALDEVQEV  99



>ref|XP_004170925.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic-like 
[Cucumis sativus]
Length=144

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVV VDQDP TRYPVVVRFNKVNYA+VSTNNYALDEI+EV
Sbjct  89   VKILRKESYWYKDVGSVVTVDQDPNTRYPVVVRFNKVNYASVSTNNYALDEIQEV  143



>ref|XP_009398054.1| PREDICTED: photosystem I reaction center subunit IV B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=138

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY GVGSVV VDQDPKTRYPVVVRFNKVNYA VSTNNY LDEI+EV
Sbjct  84   VKILRRESYWYNGVGSVVTVDQDPKTRYPVVVRFNKVNYAGVSTNNYGLDEIQEV  138



>ref|XP_007030306.1| Photosystem I subunit E-2-like protein [Theobroma cacao]
 gb|EOY10808.1| Photosystem I subunit E-2-like protein [Theobroma cacao]
Length=181

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY  VGSVV VDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI+EV
Sbjct  126  VKILRRESYWYNTVGSVVTVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIQEV  180



>ref|XP_010043318.1| PREDICTED: photosystem I reaction center subunit IV, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW85322.1| hypothetical protein EUGRSUZ_B02162 [Eucalyptus grandis]
Length=139

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYW+K VGSVVAVDQDPKTRYPVVVRF KVNYANVSTNNYALDEI EV
Sbjct  85   VKILRRESYWFKDVGSVVAVDQDPKTRYPVVVRFQKVNYANVSTNNYALDEIIEV  139



>ref|XP_007050077.1| Photosystem I subunit E-2 [Theobroma cacao]
 gb|EOX94234.1| Photosystem I subunit E-2 [Theobroma cacao]
Length=141

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY   GSVV VDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  86   VKILRRESYWYNSYGSVVTVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  140



>ref|XP_010091851.1| Photosystem I reaction center subunit IV A [Morus notabilis]
 gb|EXB46059.1| Photosystem I reaction center subunit IV A [Morus notabilis]
Length=145

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR+ESYWYK VGSVVAVDQDPK+RYPVVVRF+KVNYA+VSTNNYALDEI EV
Sbjct  90   VRILRRESYWYKDVGSVVAVDQDPKSRYPVVVRFSKVNYASVSTNNYALDEIVEV  144



>gb|KGN61314.1| hypothetical protein Csa_2G079660 [Cucumis sativus]
Length=220

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVV VDQDP TRYPVVVRFNKVNYA+VSTNNYALDEI+EV
Sbjct  165  VKILRKESYWYKDVGSVVTVDQDPNTRYPVVVRFNKVNYASVSTNNYALDEIQEV  219



>gb|ABK26819.1| unknown [Picea sitchensis]
 gb|ACN40067.1| unknown [Picea sitchensis]
 gb|ACN40424.1| unknown [Picea sitchensis]
 gb|ACN40768.1| unknown [Picea sitchensis]
Length=143

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY GVGSVVAVDQDP +RYPVVVRF+KVNYANVSTNNY+LDEI EV
Sbjct  88   VKILRRESYWYNGVGSVVAVDQDPASRYPVVVRFDKVNYANVSTNNYSLDEILEV  142



>ref|XP_008777022.1| PREDICTED: photosystem I reaction center subunit IV, chloroplastic-like 
[Phoenix dactylifera]
Length=138

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G+GSVV VDQDP+TRYPVVVRFNKVNYA VSTNNYALDEI+EV
Sbjct  83   VKILRRESYWYNGIGSVVTVDQDPRTRYPVVVRFNKVNYAGVSTNNYALDEIQEV  137



>gb|ACN39945.1| unknown [Picea sitchensis]
Length=143

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY GVGSVVAVDQDP +RYPVVVRF+KVNYANVSTNNY+LDEI EV
Sbjct  88   VKILRRESYWYNGVGSVVAVDQDPASRYPVVVRFDKVNYANVSTNNYSLDEILEV  142



>ref|XP_004152807.1| PREDICTED: photosystem I reaction center subunit IV A, chloroplastic-like 
[Cucumis sativus]
Length=232

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWYK VGSVV VDQDP TRYPVVVRFNKVNYA+VSTNNYALDEI+EV
Sbjct  177  VKILRKESYWYKDVGSVVTVDQDPNTRYPVVVRFNKVNYASVSTNNYALDEIQEV  231



>ref|XP_004956072.1| PREDICTED: photosystem I reaction center subunit IV, chloroplastic-like 
[Setaria italica]
Length=177

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G+G+VV VDQDP TRYPVVVRFNKVNYA VSTNNYALDEI+EV
Sbjct  122  VKILRRESYWYNGIGNVVTVDQDPNTRYPVVVRFNKVNYAGVSTNNYALDEIQEV  176



>gb|ABK22383.1| unknown [Picea sitchensis]
Length=143

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY GVGSVVAVDQDP +RYP+VVRF+KVNYANVSTNNY+LDEI EV
Sbjct  88   VKILRRESYWYNGVGSVVAVDQDPASRYPLVVRFDKVNYANVSTNNYSLDEILEV  142



>gb|KHG15723.1| Photosystem I reaction center subunit IV, chloroplastic [Gossypium 
arboreum]
Length=141

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY   GSVV VDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  86   VKILRRESYWYNSFGSVVTVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIAEV  140



>gb|KJB42415.1| hypothetical protein B456_007G151500 [Gossypium raimondii]
Length=141

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY   GSVV VDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  86   VKILRRESYWYNSFGSVVTVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIAEV  140



>ref|NP_001149700.1| photosystem I reaction center subunit IV A [Zea mays]
 gb|ACG36438.1| photosystem I reaction center subunit IV A [Zea mays]
 tpg|DAA39734.1| TPA: photosystem I reaction center subunit IV A [Zea mays]
Length=139

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G+G+VV VDQDP TRYPVVVRFNKVNYA VSTNNYALDEI EV
Sbjct  84   VKILRRESYWYNGIGNVVTVDQDPNTRYPVVVRFNKVNYAGVSTNNYALDEILEV  138



>tpg|DAA60402.1| TPA: photosystem I reaction center subunit IV A [Zea mays]
Length=136

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G+G+VV VDQDP TRYPVVVRFNKVNYA VSTNNYALDE+ EV
Sbjct  81   VKILRRESYWYNGIGNVVTVDQDPNTRYPVVVRFNKVNYAGVSTNNYALDEVSEV  135



>gb|ACG26704.1| photosystem I reaction center subunit IV A [Zea mays]
Length=139

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G+G+VV VDQDP TRYPVVVRFNKVNYA VSTNNYALDEI EV
Sbjct  84   VKILRRESYWYNGIGNVVTVDQDPNTRYPVVVRFNKVNYAGVSTNNYALDEILEV  138



>ref|XP_006854333.1| hypothetical protein AMTR_s00039p00131500 [Amborella trichopoda]
 gb|ERN15800.1| hypothetical protein AMTR_s00039p00131500 [Amborella trichopoda]
Length=135

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWY G+GSVVAVDQD  TRYPV VRF KVNYANVSTNNYALDE++EV
Sbjct  80   VKILRKESYWYNGIGSVVAVDQDLNTRYPVTVRFTKVNYANVSTNNYALDEVQEV  134



>gb|ACG30530.1| photosystem I reaction center subunit IV A [Zea mays]
Length=105

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G+G+VV VDQDP TRYPVVVRFNKVNYA VSTNNYALDE+ EV
Sbjct  50   VKILRRESYWYNGIGNVVTVDQDPNTRYPVVVRFNKVNYAGVSTNNYALDEVLEV  104



>tpg|DAA39735.1| TPA: hypothetical protein ZEAMMB73_405218, partial [Zea mays]
Length=128

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G+G+VV VDQDP TRYPVVVRFNKVNYA VSTNNYALDEI EV
Sbjct  73   VKILRRESYWYNGIGNVVTVDQDPNTRYPVVVRFNKVNYAGVSTNNYALDEILEV  127



>sp|P13194.2|PSAE_HORVU RecName: Full=Photosystem I reaction center subunit IV, chloroplastic; 
Short=PSI-E; AltName: Full=Photosystem I 10.8 kDa 
polypeptide; Flags: Precursor [Hordeum vulgare]
 emb|CAA68782.1| unnamed protein product [Hordeum vulgare]
 dbj|BAJ99180.1| predicted protein [Hordeum vulgare subsp. vulgare]
 prf||1413233A 10.8kD photosystem I protein
Length=147

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            V+ILR+ESYWY G GSVV VDQDP TRYPVVVRF KVNYA VSTNNYALDEI+EV 
Sbjct  91   VKILRRESYWYNGTGSVVTVDQDPNTRYPVVVRFAKVNYAGVSTNNYALDEIKEVA  146



>ref|NP_001059501.2| Os07g0435300 [Oryza sativa Japonica Group]
 dbj|BAF21415.2| Os07g0435300, partial [Oryza sativa Japonica Group]
Length=103

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G GSVV VDQDP TRYPVVVRF KVNYA VSTNNYALDEI+EV
Sbjct  48   VKILRRESYWYNGTGSVVTVDQDPNTRYPVVVRFAKVNYAGVSTNNYALDEIQEV  102



>ref|XP_003563195.1| PREDICTED: photosystem I reaction center subunit IV, chloroplastic-like 
[Brachypodium distachyon]
Length=145

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G GSVV VDQDP TRYPVVVRF KVNYA VSTNNYALDEI+EV
Sbjct  91   VKILRRESYWYNGTGSVVTVDQDPNTRYPVVVRFAKVNYAGVSTNNYALDEIKEV  145



>ref|NP_001149459.1| LOC100283085 [Zea mays]
 gb|ACG35522.1| photosystem I reaction center subunit IV A [Zea mays]
Length=136

 Score =   100 bits (248),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G+G+VV VDQDP TRYPVVVRFNKVNYA VSTNNYALDE+ EV
Sbjct  81   VKILRRESYWYNGIGNVVTVDQDPNTRYPVVVRFNKVNYAGVSTNNYALDEVLEV  135



>ref|XP_006658507.1| PREDICTED: photosystem I reaction center subunit IV, chloroplastic-like, 
partial [Oryza brachyantha]
Length=90

 Score = 98.6 bits (244),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G GSVV VDQDP TRYPVVVRF KVNYA VSTNNYALDEI+EV
Sbjct  35   VKILRRESYWYNGTGSVVTVDQDPNTRYPVVVRFAKVNYAGVSTNNYALDEIQEV  89



>gb|EAZ03667.1| hypothetical protein OsI_25804 [Oryza sativa Indica Group]
Length=148

 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G GSVV VDQDP TRYPVVVRF KVNYA VSTNNYALDEI+EV
Sbjct  93   VKILRRESYWYNGTGSVVTVDQDPNTRYPVVVRFAKVNYAGVSTNNYALDEIQEV  147



>dbj|BAC84088.1| putative Photosystem I reaction center subunit IV [Oryza sativa 
Japonica Group]
 gb|EAZ39598.1| hypothetical protein OsJ_24033 [Oryza sativa Japonica Group]
Length=149

 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY G GSVV VDQDP TRYPVVVRF KVNYA VSTNNYALDEI+EV
Sbjct  94   VKILRRESYWYNGTGSVVTVDQDPNTRYPVVVRFAKVNYAGVSTNNYALDEIQEV  148



>ref|XP_007219428.1| hypothetical protein PRUPE_ppa020566mg [Prunus persica]
 gb|EMJ20627.1| hypothetical protein PRUPE_ppa020566mg [Prunus persica]
Length=72

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYA  452
            V+ILR+ESYW+KG+GSVVAVDQDP T YPVVVRFNKV+YANVSTNNYA
Sbjct  25   VKILRRESYWFKGIGSVVAVDQDPNTCYPVVVRFNKVSYANVSTNNYA  72



>gb|KJB42413.1| hypothetical protein B456_007G151500 [Gossypium raimondii]
Length=138

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 3/55 (5%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR+ESYWY   GSVV VDQ   TRYPVVVRFNKVNYANVSTNNYALDEI EV
Sbjct  86   VKILRRESYWYNSFGSVVTVDQ---TRYPVVVRFNKVNYANVSTNNYALDEIAEV  137



>ref|XP_001768221.1| predicted protein [Physcomitrella patens]
 gb|EDQ66835.1| predicted protein [Physcomitrella patens]
Length=95

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEE  470
            V++LR+ESYW+   G VVAVDQ P  RYPVVVRF+KVNYA VSTNNY+ DE+E+
Sbjct  40   VKVLRRESYWFNDTGKVVAVDQAPGVRYPVVVRFDKVNYAGVSTNNYSPDELEQ  93



>ref|XP_001782561.1| predicted protein [Physcomitrella patens]
 gb|EDQ52636.1| predicted protein, partial [Physcomitrella patens]
Length=78

 Score = 82.0 bits (201),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIE  467
            V++LR+ESYW+   G VVAVDQ P  RYPVVVRF+KVNYA VSTNNY+ DE+E
Sbjct  26   VKVLRRESYWFNDTGKVVAVDQAPGVRYPVVVRFDKVNYAGVSTNNYSPDELE  78



>ref|XP_005844456.1| hypothetical protein CHLNCDRAFT_36926 [Chlorella variabilis]
 gb|EFN52354.1| hypothetical protein CHLNCDRAFT_36926 [Chlorella variabilis]
Length=107

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++  G VV+VDQ    RYPVVVRF+KVNYA VSTNNYALDE+EE+
Sbjct  53   VRILRPESYWFRETGKVVSVDQS-GIRYPVVVRFDKVNYAGVSTNNYALDEVEEM  106



>ref|XP_002979651.1| hypothetical protein SELMODRAFT_59774, partial [Selaginella moellendorffii]
 ref|XP_002985359.1| hypothetical protein SELMODRAFT_49753, partial [Selaginella moellendorffii]
 gb|EFJ13489.1| hypothetical protein SELMODRAFT_49753, partial [Selaginella moellendorffii]
 gb|EFJ19053.1| hypothetical protein SELMODRAFT_59774, partial [Selaginella moellendorffii]
Length=76

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR ESYW++  G VV VDQ P   YPVVVRF KVNYA  STNNYALDE++EV
Sbjct  22   VKILRPESYWFQTTGKVVTVDQTPGVLYPVVVRFEKVNYAGNSTNNYALDEVQEV  76



>ref|XP_001782099.1| predicted protein [Physcomitrella patens]
 gb|EDQ53093.1| predicted protein, partial [Physcomitrella patens]
Length=79

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIE  467
            V++LR+ESYW+   G VVAVDQ P  RYPVVVRF+KVNYA VSTNNY+ DE+E
Sbjct  27   VKVLRRESYWFNDTGKVVAVDQAPGVRYPVVVRFDKVNYAGVSTNNYSPDELE  79



>ref|YP_008519881.1| photosystem I subunit IV (chloroplast) [Nannochloropsis limnetica]
 gb|AGI99235.1| photosystem I subunit IV (chloroplast) [Nannochloropsis limnetica]
Length=67

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            VRILRKESYWY   G+VV VDQ  K RYPV+VRF KVNYA  +TNN+AL+E+EEVV
Sbjct  8    VRILRKESYWYNESGTVVVVDQG-KLRYPVLVRFTKVNYAGTNTNNFALNEVEEVV  62



>ref|WP_015165970.1| Photosystem I reaction center subunit IV [Pseudanabaena sp. PCC 
7367]
 gb|AFY71014.1| Photosystem I reaction center subunit IV [Pseudanabaena sp. PCC 
7367]
Length=63

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY+ VG+V +VD+     YPV+VRF+KVNY+N++TNN+ALDE+EEV
Sbjct  9    VRILRKESYWYRDVGTVASVDK-SGIIYPVIVRFDKVNYSNIATNNFALDELEEV  62



>ref|WP_019499312.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=63

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY+ VG+V +VD+     YPV+VRF+KVNY+NV+TNN+A+DE+EEV
Sbjct  9    VRILRKESYWYRDVGTVASVDKSGII-YPVIVRFDKVNYSNVATNNFAIDEVEEV  62



>ref|YP_008520005.1| photosystem I subunit IV (chloroplast) [Nannochloropsis oceanica]
 gb|AGI98860.1| photosystem I subunit IV (chloroplast) [Nannochloropsis oceanica]
 gb|AGI99359.1| photosystem I subunit IV (chloroplast) [Nannochloropsis oceanica]
 gb|AHX25270.1| photosystem I reaction center subunit IV (chloroplast) (chloroplast) 
[Nannochloropsis oceanica]
Length=67

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            VRILRKESYWY   G+VV VDQ  K RYPV+VRF KVNYA  +TNN+ L+E+EEVV
Sbjct  8    VRILRKESYWYNESGTVVVVDQS-KVRYPVLVRFTKVNYAGTNTNNFGLNEVEEVV  62



>ref|WP_015169998.1| Photosystem I reaction centre subunit IV / PsaE [Synechococcus 
sp. PCC 7502]
 gb|AFY75347.1| Photosystem I reaction centre subunit IV / PsaE [Synechococcus 
sp. PCC 7502]
Length=67

 Score = 79.3 bits (194),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY+ VG+V ++D+     YPV+VRF+KVNY+NV+TNN+A+DE+EEV
Sbjct  9    VRILRKESYWYRDVGTVASIDKS-GIIYPVIVRFDKVNYSNVATNNFAIDEVEEV  62



>ref|YP_008519632.1| photosystem I subunit IV (chloroplast) [Nannochloropsis oculata]
 ref|YP_008519507.1| photosystem I subunit IV (chloroplast) [Nannochloropsis granulata]
 gb|AGI98735.1| photosystem I subunit IV (chloroplast) [Nannochloropsis granulata]
 gb|AGI98986.1| photosystem I subunit IV (chloroplast) [Nannochloropsis oculata]
 gb|AHX25406.1| photosystem I reaction center subunit IV (chloroplast) (chloroplast) 
[Nannochloropsis oculata]
Length=67

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            VRILRKESYWY   G+VV VDQ  K RYPV+VRF KVNYA  +TNN+ L+E+EEVV
Sbjct  8    VRILRKESYWYNESGTVVVVDQG-KLRYPVLVRFTKVNYAGTNTNNFGLNEVEEVV  62



>ref|WP_011143397.1| photosystem I reaction center subunit IV [Gloeobacter violaceus]
 ref|NP_926354.1| photosystem I reaction center subunit IV [Gloeobacter violaceus 
PCC 7421]
 sp|Q7NFW6.1|PSAE_GLOVI RecName: Full=Photosystem I reaction center subunit IV [Gloeobacter 
violaceus PCC 7421]
 dbj|BAC91349.1| photosystem I protein E [Gloeobacter violaceus PCC 7421]
Length=65

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY+ VG+V +VD+  KT YPV VRF KVNY+ ++TNN+ + E+EEV
Sbjct  9    VRILRKESYWYREVGTVASVDKSEKTIYPVTVRFEKVNYSGINTNNFGVSELEEV  63



>ref|YP_007317004.1| photosystem I reaction center subunit IV (chloroplast) [Nannochloropsis 
gaditana]
 ref|YP_008519758.1| photosystem I subunit IV (chloroplast) [Nannochloropsis salina]
 gb|AFZ64312.1| photosystem I reaction center subunit IV (chloroplast) [Nannochloropsis 
gaditana]
 gb|AGI98612.1| photosystem I subunit IV (chloroplast) [Nannochloropsis gaditana]
 gb|AGI99112.1| photosystem I subunit IV (chloroplast) [Nannochloropsis salina]
 gb|AHX25137.1| photosystem I reaction center subunit IV (chloroplast) (chloroplast) 
[Nannochloropsis gaditana]
 gb|AHX25538.1| photosystem I reaction center subunit IV (chloroplast) (chloroplast) 
[Nannochloropsis salina]
Length=67

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            VRILRKESYWY   G+VV VDQ  K RYPV+VRF KVNY   +TNN+AL+E+EEV+
Sbjct  8    VRILRKESYWYNESGTVVVVDQG-KLRYPVLVRFTKVNYTGTNTNNFALNEVEEVI  62



>ref|WP_023171971.1| photosystem I reaction center subunit IV [Gloeobacter kilaueensis]
 gb|AGY56927.1| photosystem I reaction center subunit IV [Gloeobacter kilaueensis 
JS1]
Length=65

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY+ VG+V ++D++ KT YPV VRF KVNY+ ++TNN+ + E+EEV
Sbjct  9    VRILRKESYWYRDVGTVASIDKNEKTIYPVTVRFEKVNYSGLNTNNFGVSELEEV  63



>ref|WP_008312071.1| Photosystem I reaction centre subunit IV / PsaE [Leptolyngbya 
sp. PCC 6406]
Length=71

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW++ VG+V +VDQ    RYPVVVRF+KVNY+ V+TNN+ALDE+ EV
Sbjct  8    VRILRKESYWFQDVGNVASVDQSG-IRYPVVVRFDKVNYSGVNTNNFALDELVEV  61



>ref|XP_011397149.1| Photosystem I reaction center subunit IV, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM24262.1| Photosystem I reaction center subunit IV, chloroplastic [Auxenochlorella 
protothecoides]
Length=127

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRI R ESYW++ VG VV+VDQ    RYPVVVRF +VNYA V+TNNY+LDE+EEV
Sbjct  73   VRIKRPESYWFREVGKVVSVDQS-GIRYPVVVRFERVNYAGVTTNNYSLDEVEEV  126



>ref|WP_009455623.1| MULTISPECIES: Photosystem I reaction center subunit IV [Fischerella]
 gb|EHC18178.1| Photosystem I reaction center subunit IV [Fischerella sp. JSC-11]
Length=72

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VG+V +++Q   +RYPV+VRF+KVNYA V+TNN+A DE+ EV
Sbjct  8    VRILRPESYWFQDVGTVASIEQGGTSRYPVIVRFDKVNYAGVNTNNFAQDELVEV  62



>ref|WP_009626231.1| Photosystem I reaction center subunit IV [Pseudanabaena biceps]
 gb|ELS33612.1| Photosystem I reaction center subunit IV [Pseudanabaena biceps 
PCC 7429]
Length=63

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY+ VG+V +VD+     YPV+VRF+ VNY+N++TNN+A+DE+EEV
Sbjct  9    VRILRKESYWYREVGTVASVDKSGII-YPVIVRFDSVNYSNIATNNFAIDEVEEV  62



>ref|WP_017721660.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=124

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            VRILRKESYWYK VG+V +VDQ    +YPV+VRF+KVNY+ ++TNN+AL E+ EV 
Sbjct  8    VRILRKESYWYKDVGTVASVDQS-GIKYPVIVRFDKVNYSGINTNNFALSEVVEVA  62



>ref|YP_009029311.1| photosystem I reaction center subunit IV (chloroplast) [Leptocylindrus 
danicus]
 gb|AGH28842.1| photosystem I reaction center subunit IV (chloroplast) (chloroplast) 
[Leptocylindrus danicus]
Length=64

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VG+V AVDQ    RYP +VRF KVNY+ V+TNN+ALDE++EV
Sbjct  8    VRILRPESYWFQEVGTVTAVDQS-GVRYPAIVRFEKVNYSGVNTNNFALDELQEV  61



>ref|XP_007514240.1| photosystem I reaction center subunit IV [Bathycoccus prasinos]
 emb|CCO15677.1| photosystem I reaction center subunit IV [Bathycoccus prasinos]
Length=83

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIE  467
            V+ILR ESYW+   G V++VDQ    RYPVVVRF KVNYA VSTNNYALDEIE
Sbjct  31   VKILRPESYWFNDYGKVISVDQS-GVRYPVVVRFEKVNYAGVSTNNYALDEIE  82



>ref|WP_016878433.1| Photosystem I reaction center subunit IV [Chlorogloeopsis fritschii]
Length=71

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VG+V +++Q   +RYPV+VRF KVNYA V+TNN+A DE+ EV
Sbjct  8    VRILRPESYWFQDVGTVASIEQGGTSRYPVIVRFEKVNYAGVNTNNFAQDELVEV  62



>ref|WP_026733112.1| Photosystem I reaction center subunit IV [Fischerella sp. PCC 
9605]
Length=72

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VG+V +++Q   +RYPV+VRF KVNYA V+TNN+A DE+ EV
Sbjct  8    VRILRPESYWFQDVGTVASIEQGGTSRYPVIVRFEKVNYAGVNTNNFAQDELVEV  62



>ref|XP_001416091.1| Photosystem I reaction center subunit IV, probable [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO94383.1| Photosystem I reaction center subunit IV, probable [Ostreococcus 
lucimarinus CCE9901]
Length=107

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIE  467
            V+ILR ESYW+   G V++VDQ    RYPVVVRF KVNYA VSTNNYALDEIE
Sbjct  55   VKILRPESYWFNDYGKVISVDQS-GVRYPVVVRFEKVNYAGVSTNNYALDEIE  106



>ref|XP_003057473.1| photosystem I subunit IV, chloroplast precursor [Micromonas pusilla 
CCMP1545]
 gb|EEH59118.1| photosystem I subunit IV, chloroplast precursor [Micromonas pusilla 
CCMP1545]
Length=115

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIE  467
            V+ILR ESYW+   G V++VDQ    RYPVVVRF KVNYA VSTNNYALDEIE
Sbjct  63   VKILRPESYWFNDYGKVISVDQS-GVRYPVVVRFEKVNYAGVSTNNYALDEIE  114



>ref|WP_016867325.1| Photosystem I reaction center subunit IV [Fischerella muscicola]
Length=72

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VG+V +++Q   +RYPV+VRF KVNYA V+TNN+A DE+ EV
Sbjct  8    VRILRPESYWFQDVGTVASIEQGGTSRYPVIVRFEKVNYAGVNTNNFAEDELVEV  62



>ref|WP_017313689.1| Photosystem I reaction center subunit IV [Fischerella sp. PCC 
9339]
Length=72

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VR+LR ESYW++ VG+V +V+Q    RYPV+VRF+KVNYA V+TNN+A DE+ E+
Sbjct  8    VRVLRPESYWFQDVGTVASVEQSSNIRYPVIVRFDKVNYAGVNTNNFAQDELVEI  62



>ref|XP_002502060.1| photosystem I reaction center subunit IV, chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO63318.1| photosystem I reaction center subunit IV, chloroplast precursor 
[Micromonas sp. RCC299]
Length=114

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIE  467
            V+ILR ESYW+   G V++VDQ    RYPVVVRF KVNYA VSTNNYALDEIE
Sbjct  62   VKILRPESYWFNDYGKVISVDQS-GVRYPVVVRFEKVNYAGVSTNNYALDEIE  113



>ref|WP_026072314.1| Photosystem I reaction center subunit IV [Nodosilinea nodulosa]
Length=72

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRI+RKESYWY+ VG+V  +DQ    +YP VVRF+KVNYA ++TNN+AL E++EV
Sbjct  8    VRIMRKESYWYREVGTVATIDQSG-IKYPAVVRFDKVNYAGINTNNFALSELQEV  61



>ref|WP_035991772.1| Photosystem I reaction center subunit IV [Leptolyngbya sp. KIOST-1]
Length=70

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY+ VG+V  +DQ    +YP VVRF++VNYA ++TNN+AL E++EV
Sbjct  8    VRILRKESYWYREVGTVATIDQSG-IKYPAVVRFDQVNYAGINTNNFALSELQEV  61



>dbj|BAF63505.1| hypothetical protein [Potamogeton distinctus]
Length=45

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  342  KGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
             GVGSVVAVDQDP +RYPVVVRF+KVNY N+STNNYALDEI+ V
Sbjct  1    NGVGSVVAVDQDPCSRYPVVVRFSKVNYNNLSTNNYALDEIQVV  44



>ref|WP_041036448.1| Photosystem I reaction center subunit IV [Tolypothrix campylonemoides]
 gb|KIJ76040.1| Photosystem I reaction center subunit IV [Tolypothrix campylonemoides 
VB511288]
Length=70

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR+ESYWY+ VG+V ++DQ    +YPV+VRFN VNYA V+TNNY L+E+ EV
Sbjct  8    VRILRRESYWYQDVGTVASIDQSG-IKYPVIVRFNNVNYAGVNTNNYGLEELIEV  61



>ref|XP_003075228.1| PsaE undefined product (IC) [Ostreococcus tauri]
 emb|CAL52500.2| Photosystem I PsaE, reaction centre subunit IV [Ostreococcus 
tauri]
Length=101

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIE  467
            V+ILR ESYW+   G V++VDQ    RYPVVVRF KVNYA VSTNNYALDE+E
Sbjct  49   VKILRPESYWFNDYGKVISVDQT-GVRYPVVVRFEKVNYAGVSTNNYALDEVE  100



>ref|WP_009555467.1| Photosystem I reaction centre subunit IV / PsaE [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ70900.1| Photosystem I reaction centre subunit IV / PsaE [Oscillatoriales 
cyanobacterium JSC-12]
Length=82

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 7/62 (11%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNY-------ANVSTNNYALDEIE  467
            VRILRKESYWY+ VG+V ++DQ+P  +YPV+VRF++VNY         ++TNN+AL+E+ 
Sbjct  8    VRILRKESYWYQDVGTVASIDQNPSIKYPVIVRFDRVNYTGFSGNAGGINTNNFALNELV  67

Query  468  EV  473
            EV
Sbjct  68   EV  69



>ref|WP_017315377.1| Photosystem I reaction center subunit IV [Mastigocladopsis repens]
Length=70

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR+ESYWY+ +G+V ++DQ    +YPV+VRFNKVNYA V+TNN+ L+E+ EV
Sbjct  8    VRILRRESYWYQDLGTVASIDQS-GIKYPVIVRFNKVNYAGVNTNNFGLEELIEV  61



>gb|ABV70197.1| photosystem I reaction center subunit IV [Heterosigma akashiwo]
Length=63

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY  +GSV  VDQ    RYPVVVRF+ VNY+  +TNN++LDEI EV
Sbjct  8    VRILRKESYWYNKIGSVATVDQ-SGIRYPVVVRFDSVNYSGTNTNNFSLDEIIEV  61



>ref|WP_026720224.1| Photosystem I reaction center subunit IV [Fischerella sp. PCC 
9431]
Length=72

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VR+LR ESYW++ VG+V +V+Q+   RYPV+VRF +VNYA V+TNN+A DE+ E+
Sbjct  8    VRVLRPESYWFQDVGTVASVEQNSAIRYPVIVRFERVNYAGVNTNNFAQDELVEI  62



>ref|YP_009093428.1| photosystem I subunit IV (chloroplast) [Thalassiosira weissflogii]
 gb|AIR76101.1| photosystem I subunit IV (chloroplast) [Thalassiosira weissflogii]
Length=65

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW+  VG+V  VDQ    RYPVVVRF  VNYA  +TNN+ALDE+ EV
Sbjct  8    VRILRKESYWFNQVGTVATVDQ-SGIRYPVVVRFESVNYAGTNTNNFALDELVEV  61



>ref|WP_015178118.1| Photosystem I reaction center subunit IV [Oscillatoria nigro-viridis]
 gb|AFZ08878.1| Photosystem I reaction center subunit IV [Oscillatoria nigro-viridis 
PCC 7112]
Length=124

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            VRILRKESYWY+ VG+V  VDQ    +YPV+VRFN VNYA V+TNN+A  E+ EV 
Sbjct  8    VRILRKESYWYQEVGTVATVDQS-GIKYPVIVRFNSVNYAGVNTNNFAQSELVEVA  62



>ref|WP_027846034.1| photosystem I reaction centre subunit IV/PsaE [Mastigocoleus 
testarum]
Length=107

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR+ESYWY+ VG+V  +D+    +YP +VRFNKVNY+ ++TNN+ALDE+ EV
Sbjct  8    VRILRRESYWYQDVGTVATIDKS-GIKYPAIVRFNKVNYSGINTNNFALDELLEV  61



>ref|WP_016858858.1| Photosystem I reaction center subunit IV [Fischerella muscicola]
Length=72

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VR+LR ESYW++ VG+V +V+Q    +YPV+VRF KVNYA V+TNN+A DE+ E+
Sbjct  8    VRVLRPESYWFQDVGTVASVEQSSAIKYPVIVRFEKVNYAGVNTNNFAQDELVEI  62



>ref|WP_015210229.1| Photosystem I reaction centre subunit IV / PsaE [Cylindrospermum 
stagnale]
 gb|AFZ26992.1| Photosystem I reaction centre subunit IV / PsaE [Cylindrospermum 
stagnale PCC 7417]
Length=70

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ +G+V  +DQ    +YPV+VRF+KVNYA ++TNN+ALDE+ EV
Sbjct  8    VRILRPESYWFQDLGTVATIDQS-GIKYPVIVRFDKVNYAGINTNNFALDELVEV  61



>ref|WP_010998457.1| photosystem I reaction center subunit IV [Nostoc sp. PCC 7120]
 sp|P58575.1|PSAE_NOSS1 RecName: Full=Photosystem I reaction center subunit IV [Nostoc 
sp. PCC 7120]
 dbj|BAB76018.1| photosystem I protein E [Nostoc sp. PCC 7120]
Length=70

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VG+V +VDQ    +YPV+VRF+KVNYA ++TNN+A+DE+ EV
Sbjct  8    VRILRPESYWFQDVGTVASVDQS-GIKYPVIVRFDKVNYAGINTNNFAVDELIEV  61



>ref|YP_001293615.1| photosystem I subunit IV [Rhodomonas salina]
 gb|ABO70797.1| photosystem I subunit IV [Rhodomonas salina]
Length=64

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            VRILRKESYWY+ +G+V  +D     RYPVVVRF KV+Y+ V+TNN++LDE+ EVV
Sbjct  8    VRILRKESYWYQDIGTVATIDTSG-IRYPVVVRFEKVSYSGVNTNNFSLDEVVEVV  62



>gb|AIR75397.1| photosystem I subunit IV (chloroplast) [Cyclotella sp. L04_2]
 gb|AIR75538.1| photosystem I subunit IV (chloroplast) [Cyclotella sp. WC03_2]
Length=65

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYW+  VG+V  VDQ    RYPVVVRF+ VNYA  +TNN+ALDE+ EV
Sbjct  8    VKILRKESYWFNQVGTVATVDQ-SGIRYPVVVRFDSVNYAGTNTNNFALDELVEV  61



>ref|YP_009093155.1| photosystem I subunit IV (chloroplast) [Roundia cardiophora]
 gb|AIR75828.1| photosystem I subunit IV (chloroplast) [Roundia cardiophora]
Length=65

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW+  VG+V  VDQ    RYPVVVRF  VNYA  +TNN+ALDE+ E+
Sbjct  8    VRILRKESYWFNQVGTVATVDQ-SGIRYPVVVRFESVNYAGTNTNNFALDELIEI  61



>ref|WP_019509388.1| Photosystem I reaction center subunit IV [Pleurocapsa sp. PCC 
7319]
Length=62

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYWY  VGSV +VD     RYPVVVRFNKVNYA V+TNN+A  E++EV
Sbjct  8    VRILRPESYWYNEVGSVASVDTS-GIRYPVVVRFNKVNYAGVNTNNFAESEVKEV  61



>ref|WP_011057407.1| MULTISPECIES: photosystem I reaction center subunit IV [Thermosynechococcus]
 ref|NP_682357.1| photosystem I reaction center subunit IV [Thermosynechococcus 
elongatus BP-1]
 sp|P0A423.2|PSAE_THEEB RecName: Full=Photosystem I reaction center subunit IV; AltName: 
Full=Photosystem I 8.1 kDa protein; AltName: Full=p30 protein 
[Thermosynechococcus elongatus BP-1]
 sp|P0A424.2|PSAE_SYNEL RecName: Full=Photosystem I reaction center subunit IV; AltName: 
Full=Photosystem I 8.1 kDa protein; AltName: Full=p30 protein 
[Synechococcus elongatus]
 pir||S22203 photosystem I chain IV - Synechococcus sp
 emb|CAA45302.1| photosystem I subunit IV [Synechococcus sp.]
 emb|CAA71332.1| psaE [Synechococcus elongatus]
 dbj|BAC09119.1| photosystem I subunit IV [Thermosynechococcus elongatus BP-1]
 gb|AHB88219.1| photosystem I reaction center subunit IV PsaE [Thermosynechococcus 
sp. NK55a]
Length=76

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 7/62 (11%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNY-------ANVSTNNYALDEIE  467
            V+ILR ESYWY  VG+V +VDQ P  +YPV+VRF+KVNY       + V+TNN+AL E++
Sbjct  8    VKILRPESYWYNEVGTVASVDQTPGVKYPVIVRFDKVNYTGYSGSASGVNTNNFALHEVQ  67

Query  468  EV  473
            EV
Sbjct  68   EV  69



>pdb|1JB0|E Chain E, Crystal Structure Of Photosystem I: A Photosynthetic 
Reaction Center And Core Antenna System From Cyanobacteria
 pdb|3PCQ|E Chain E, Femtosecond X-Ray Protein Nanocrystallography
 pdb|4FE1|E Chain E, Improving The Accuracy Of Macromolecular Structure Refinement 
At 7 A Resolution
Length=75

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 7/62 (11%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNY-------ANVSTNNYALDEIE  467
            V+ILR ESYWY  VG+V +VDQ P  +YPV+VRF+KVNY       + V+TNN+AL E++
Sbjct  7    VKILRPESYWYNEVGTVASVDQTPGVKYPVIVRFDKVNYTGYSGSASGVNTNNFALHEVQ  66

Query  468  EV  473
            EV
Sbjct  67   EV  68



>ref|WP_006528812.1| Photosystem I reaction centre subunit IV / PsaE [Gloeocapsa sp. 
PCC 73106]
 gb|ELR98353.1| Photosystem I reaction centre subunit IV / PsaE [Gloeocapsa sp. 
PCC 73106]
Length=69

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 8/62 (13%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNY-------ANVSTNNYALDEIE  467
            VRILRKESYW++ VG+V ++DQ    RYPV+VRF+KVNY         V+TNN+A+DE+E
Sbjct  9    VRILRKESYWHRDVGTVASIDQ-SGIRYPVIVRFDKVNYTGFSGSPGGVNTNNFAIDELE  67

Query  468  EV  473
            EV
Sbjct  68   EV  69



>ref|XP_005645026.1| photosystem I reaction centre subunit IV/PsaE [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20482.1| photosystem I reaction centre subunit IV/PsaE [Coccomyxa subellipsoidea 
C-169]
Length=71

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V++LR ESYW+  VG VV+VDQ    RYPVVVRF  VNYA VSTNNY+L+E++EV
Sbjct  18   VKVLRPESYWFNEVGKVVSVDQS-GIRYPVVVRFPTVNYAGVSTNNYSLEEVQEV  71



>ref|YP_001936450.1| photosystem I subunit IV [Heterosigma akashiwo]
 gb|ABV66056.1| photosystem I reaction center subunit IV [Heterosigma akashiwo]
Length=63

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWY  +GSV  VDQ    RYPVVVRF+ VNY+  +TNN++LDEI EV
Sbjct  8    VQILRKESYWYNKIGSVATVDQ-SGIRYPVVVRFDSVNYSGTNTNNFSLDEIIEV  61



>ref|YP_009092939.1| photosystem I subunit IV (chloroplast) [Chaetoceros simplex]
 gb|AIR75330.1| photosystem I subunit IV (chloroplast) [Chaetoceros simplex]
Length=67

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            VRILRKESYW+  VG+V  +DQ    RYP +VRF  VNYA  ++NN+ALDE++EVV
Sbjct  8    VRILRKESYWFNQVGTVATIDQ-SGIRYPALVRFESVNYAGTNSNNFALDELKEVV  62



>gb|ABA55572.1| chloroplast psaEb [Pavlova lutheri]
Length=118

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+++R ESYWY+ VGSV  VD     RYPVVVRF KVNYA V+TNN+A+DE+ EV
Sbjct  48   VKVMRPESYWYQEVGSVATVDTS-GIRYPVVVRFEKVNYAGVNTNNFAIDELVEV  101



>ref|WP_039724554.1| MULTISPECIES: hypothetical protein [Oscillatoriophycideae]
 gb|KIF20570.1| hypothetical protein QP59_19860 [Aphanocapsa montana BDHKU210001]
 gb|KIF42217.1| hypothetical protein QQ91_10910 [Lyngbya confervoides BDU141951]
Length=68

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++  G V ++DQ    RYP VVRF+KVNYA V+TNN+ALDE+ EV
Sbjct  8    VRILRPESYWFQETGKVASIDQS-GIRYPAVVRFDKVNYAGVNTNNFALDELVEV  61



>ref|WP_036005331.1| photosystem I reaction centre subunit IV/PsaE [Leptolyngbya sp. 
JSC-1]
Length=124

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            V++LRKESYWY+  G V +VDQ    +YPVVVRFNKV+Y+ ++TNN+A+ E+EEV 
Sbjct  8    VKVLRKESYWYQDTGVVASVDQS-GIKYPVVVRFNKVSYSGINTNNFAMSELEEVA  62



>ref|WP_036481067.1| photosystem I reaction centre subunit IV/PsaE [Myxosarcina sp. 
GI1]
Length=125

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYWYK VG+V  VD+    RYPV+VRF KVNYA V+TNN+A  E+EE+
Sbjct  8    VRILRPESYWYKDVGTVATVDKS-GIRYPVIVRFEKVNYAGVNTNNFAEAELEEI  61



>ref|WP_017659509.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=76

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 8/62 (13%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNY-------ANVSTNNYALDEIE  467
            VRILRKESYWY+ VGSV  +DQ    RYPV+VRF+KVNY         V+TNN+ALDE+ 
Sbjct  8    VRILRKESYWYQDVGSVATIDQSG-IRYPVIVRFDKVNYTGFSGASGGVNTNNFALDELV  66

Query  468  EV  473
            EV
Sbjct  67   EV  68



>ref|YP_009059243.1| photosystem I reaction center subunit IV (chloroplast) [Eunotia 
naegelii]
 gb|AHI51190.1| photosystem I reaction center subunit IV (chloroplast) [Eunotia 
naegelii]
Length=69

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW+  +G+V  VDQ    RYPVVVRF  VNY+  +TNN+ALDE+ EV
Sbjct  8    VRILRKESYWFNQIGTVATVDQSG-IRYPVVVRFENVNYSGTNTNNFALDELVEV  61



>ref|WP_015111814.1| Photosystem I reaction center subunit IV [Nostoc sp. PCC 7107]
 gb|AFY41575.1| Photosystem I reaction center subunit IV [Nostoc sp. PCC 7107]
Length=70

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEE  470
            VRILR ESYW++ VG+V ++DQ    +YPV+VRF+KVNY+ ++TNN+ALDE+ E
Sbjct  8    VRILRPESYWFQDVGTVASIDQS-GIKYPVIVRFDKVNYSGINTNNFALDELVE  60



>ref|WP_015151402.1| Photosystem I reaction centre subunit IV / PsaE [Oscillatoria 
acuminata]
 gb|AFY84790.1| Photosystem I reaction centre subunit IV / PsaE [Oscillatoria 
acuminata PCC 6304]
Length=118

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW++ VG+V  VDQ   T YPV+VRF+KVNYA V+TNN+ + E+ EV
Sbjct  8    VRILRKESYWFQEVGTVATVDQSGIT-YPVIVRFDKVNYAGVNTNNFGMSEVVEV  61



>ref|WP_011318110.1| photosystem I reaction center subunit IV [Anabaena variabilis]
 sp|P31090.3|PSAE_ANAVT RecName: Full=Photosystem I reaction center subunit IV [Anabaena 
variabilis ATCC 29413]
 gb|ABA20894.1| Photosystem I reaction centre subunit IV/PsaE [Anabaena variabilis 
ATCC 29413]
Length=71

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VG+V +VDQ    +YPV+VRF+KVNY+ ++TNN+A+DE+ EV
Sbjct  8    VRILRPESYWFQDVGTVASVDQS-GIKYPVIVRFDKVNYSGINTNNFAVDELIEV  61



>ref|XP_002297543.1| PSAE, photosystem I reaction center subunit [Thalassiosira pseudonana 
CCMP1335]
 gb|EED86183.1| PSAE, photosystem I reaction center subunit, partial [Thalassiosira 
pseudonana CCMP1335]
Length=63

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW+  +G+V  VDQ    RYP VVRF  VNYA  +TNN+ALDE+ EV
Sbjct  8    VRILRKESYWFNQIGTVATVDQ-SGIRYPAVVRFESVNYAGTNTNNFALDELVEV  61



>ref|WP_035155751.1| Photosystem I reaction center subunit IV [Calothrix sp. 336/3]
 gb|KFB84979.1| Photosystem I reaction center subunit IV [Calothrix sp. 336/3]
Length=70

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VG+V +VDQ    +YPV+VRF+KVNY+ ++TNN+A+DE+ EV
Sbjct  8    VRILRPESYWFQDVGTVASVDQS-GIKYPVIVRFDKVNYSGINTNNFAVDELFEV  61



>ref|YP_874511.1| photosystem I reaction center subunit IV [Thalassiosira pseudonana]
 gb|ABK20734.1| photosystem I reaction center subunit IV [Thalassiosira pseudonana]
Length=65

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW+  +G+V  VDQ    RYP VVRF  VNYA  +TNN+ALDE+ EV
Sbjct  8    VRILRKESYWFNQIGTVATVDQSG-IRYPAVVRFESVNYAGTNTNNFALDELVEV  61



>gb|KIJ80923.1| Photosystem I reaction center subunit IV [Scytonema tolypothrichoides 
VB-61278]
Length=70

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR+ESYWY+ VG+V +VDQ    +YPV+VRF+KVNYA ++TNN+A  E+ EV
Sbjct  8    VRILRRESYWYQDVGTVASVDQSG-IKYPVIVRFDKVNYAGINTNNFAQAELLEV  61



>ref|NP_050803.1| photosystem I subunit IV (chloroplast) [Guillardia theta]
 sp|O78515.1|PSAE_GUITH RecName: Full=Photosystem I reaction center subunit IV; Short=PSI-E 
(chloroplast) [Guillardia theta]
 gb|AAC35737.1| PSI subunit IV (chloroplast) [Guillardia theta]
Length=64

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY+ VG+V  VD     RYPVVVRF KV+Y+ V+TNN++LDE+ EV
Sbjct  8    VRILRKESYWYQEVGTVATVDTSG-IRYPVVVRFEKVSYSGVNTNNFSLDEVIEV  61



>ref|WP_007356982.1| MULTISPECIES: Photosystem I reaction centre subunit IV/PsaE [Kamptonema]
 emb|CBN57790.1| Photosystem I reaction centre subunit IV/PsaE [ [[Oscillatoria] 
sp. PCC 6506]
Length=124

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW++ +G+V ++DQ    +YPV+VRFN VNYA V+TNN+A  E+ EV
Sbjct  8    VRILRKESYWFQELGTVASIDQS-GIKYPVIVRFNTVNYAGVNTNNFATGEVVEV  61



>ref|YP_004376592.1| photosystem I reaction center subunit IV (chloroplast) [Fistulifera 
solaris]
 dbj|BAK18958.1| photosystem I reaction center subunit IV (chloroplast) [Fistulifera 
solaris]
Length=64

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW+  VG+V  VDQ    RYPVVVRF KVNY+  +TNN+ALDE+ EV
Sbjct  8    VRILRPESYWFNDVGTVATVDQ-SGIRYPVVVRFEKVNYSGTNTNNFALDELVEV  61



>ref|WP_019490505.1| Photosystem I reaction center subunit IV [Calothrix sp. PCC 7103]
Length=74

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEE  470
            VRILR ESYWY+ VG+V ++DQ    +YPV+VRF KVNYA ++TNN+A DE+ E
Sbjct  8    VRILRPESYWYQDVGTVASIDQS-GIKYPVIVRFEKVNYAGINTNNFATDELIE  60



>ref|WP_023072528.1| photosystem i reaction center subunit iv [Leptolyngbya sp. Heron 
Island J]
 gb|ESA36700.1| photosystem i reaction center subunit iv [Leptolyngbya sp. Heron 
Island J]
Length=61

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRK+SYW++ +G+V +VDQ    +YPVVVRF+K+NYA V+TNN+A  E++E+
Sbjct  8    VRILRKDSYWFQDIGTVASVDQ-SGIKYPVVVRFDKINYAGVNTNNFAESEVKEL  61



>ref|YP_003734583.1| photosystem I subunit IV [Kryptoperidinium foliaceum]
 gb|ADI40368.1| photosystem I subunit IV [Kryptoperidinium foliaceum]
Length=65

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW+   G+V  VDQ    RYPVVVRF  VNY+  +TNN+ALDE+ EV
Sbjct  8    VRILRKESYWFNQTGTVATVDQ-SGIRYPVVVRFENVNYSGTNTNNFALDELVEV  61



>ref|YP_009029492.1| photosystem I reaction center subunit IV (chloroplast) [Lithodesmium 
undulatum]
 ref|YP_009029548.1| photosystem I reaction center subunit IV (chloroplast) [Lithodesmium 
undulatum]
 gb|AGH29023.1| photosystem I reaction center subunit IV (chloroplast) (chloroplast) 
[Lithodesmium undulatum]
 gb|AGH29079.1| photosystem I reaction center subunit IV (chloroplast) (chloroplast) 
[Lithodesmium undulatum]
Length=63

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY   G V  VDQ    RYPVVVRF  VNY+  +TNN+ALDE+ EV
Sbjct  8    VRILRKESYWYNQTGKVATVDQ-SGIRYPVVVRFENVNYSGTNTNNFALDELVEV  61



>ref|YP_009029225.1| photosystem I reaction center subunit IV (chloroplast) [Didymosphenia 
geminata]
 gb|AGH28756.1| photosystem I reaction center subunit IV (chloroplast) (chloroplast) 
[Didymosphenia geminata]
Length=64

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI  464
            VRILRKESYW+   G+V  VDQ    RYPVVVRF+KVNY+  +TNN+A+DE+
Sbjct  8    VRILRKESYWFNSTGTVATVDQ-SGIRYPVVVRFDKVNYSGTNTNNFAIDEL  58



>ref|WP_017322021.1| Photosystem I reaction center subunit IV [cyanobacterium PCC 
7702]
 sp|Q9ZFU3.1|PSAE_MASLA RecName: Full=Photosystem I reaction center subunit IV [Mastigocladus 
laminosus]
 gb|AAC83370.1| photosystem I subunit IV [Mastigocladus laminosus]
Length=71

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ +G+V +++Q    RYPV+VRF+KVNYA V+TNN+A  E+ EV
Sbjct  8    VRILRPESYWFQDIGTVASIEQGGTIRYPVIVRFDKVNYAGVNTNNFAEYELVEV  62



>ref|WP_036046459.1| photosystem I reaction center subunit IV [Leptolyngbya boryana]
Length=81

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 8/62 (13%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNY-------ANVSTNNYALDEIE  467
            VRILRKESYWY+ +G+V ++DQ    +YPV+VRF+KVNY       + V+TNN+AL E+E
Sbjct  9    VRILRKESYWYRDIGTVASIDQ-SGIKYPVIVRFDKVNYTGYSGTASGVNTNNFALSELE  67

Query  468  EV  473
            EV
Sbjct  68   EV  69



>ref|WP_006635199.1| Photosystem I reaction center subunit IV [Microcoleus vaginatus]
 gb|EGK84719.1| Photosystem I reaction center subunit IV [Microcoleus vaginatus 
FGP-2]
Length=127

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            VRILRKESYWY+ VG V  VD+    +YPV+VRFN VNYA V+TNNYA  E+ EV 
Sbjct  8    VRILRKESYWYQEVGIVATVDKS-GIKYPVIVRFNNVNYAGVNTNNYAESELVEVA  62



>ref|WP_015228833.1| Photosystem I reaction centre subunit IV / PsaE [Dactylococcopsis 
salina]
 gb|AFZ49824.1| Photosystem I reaction centre subunit IV / PsaE [Dactylococcopsis 
salina PCC 8305]
Length=79

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY  VG+V  VD+     YP++VRF+KVNY+ V+TNN+ LDE+E V
Sbjct  10   VRILRKESYWYGDVGTVATVDK-SGIIYPIIVRFDKVNYSGVNTNNFGLDEVEVV  63



>gb|ABA55538.1| chloroplast psaE [Karlodinium veneficum]
Length=143

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRI+R ESYW+K VG+V AV +    RYPV VRF K N+A ++TNNYA+DE+ EV
Sbjct  70   VRIMRPESYWFKDVGTVAAVSKG-DDRYPVTVRFEKCNFAGITTNNYAMDELIEV  123



>ref|XP_001702611.1| photosystem I 8.1 kDa reaction center subunit IV [Chlamydomonas 
reinhardtii]
 sp|P12352.1|PSAE_CHLRE RecName: Full=Photosystem I reaction center subunit IV, chloroplastic; 
Short=PSI-E; AltName: Full=P30 protein; AltName: Full=Photosystem 
I 8.1 kDa protein; Flags: Precursor [Chlamydomonas 
reinhardtii]
 emb|CAA31850.1| P30 precursor protein [Chlamydomonas reinhardtii]
 gb|EDP06390.1| photosystem I 8.1 kDa reaction center subunit IV [Chlamydomonas 
reinhardtii]
 prf||1611462B photosystem I protein P30
Length=97

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEI  464
            V+ILR ESYW+  VG VV+VDQ    RYPVVVRF   NYA V+TNNYALDE+
Sbjct  43   VKILRPESYWFNQVGKVVSVDQS-GVRYPVVVRFENQNYAGVTTNNYALDEV  93



>dbj|BAA84770.1| photosystem I subunit PSI-E [Arabidopsis thaliana]
Length=38

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  369  DQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            DQDPKTRYPVVVRF KVNYAN+STNNYALDE+EEV
Sbjct  2    DQDPKTRYPVVVRFAKVNYANISTNNYALDEVEEV  36



>ref|WP_013324281.1| photosystem I reaction centre subunit IV/PsaE [Cyanothece sp. 
PCC 7822]
 gb|ADN16218.1| photosystem I reaction centre subunit IV/PsaE [Cyanothece sp. 
PCC 7822]
Length=129

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY  +G V ++D+     YPV+VRF+KVNYA ++TNN+ ++E+EEV
Sbjct  8    VRILRKESYWYNDIGVVASIDKS-GILYPVIVRFDKVNYAGITTNNFGVNEVEEV  61



>gb|KJB22616.1| hypothetical protein B456_004G057800 [Gossypium raimondii]
Length=125

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  372  QDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            +DPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV
Sbjct  91   KDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  124



>sp|Q9WWP1.1|PSAE_NOSS8 RecName: Full=Photosystem I reaction center subunit IV [Nostoc 
sp. PCC 8009]
 pdb|1QP2|A Chain A, Solution Structure Of Photosystem I Accessory Protein 
E From The Cyanobacterium Nostoc Sp. Strain Pcc 8009
 pdb|1QP3|A Chain A, Solution Structure Of Photosystem I Accessory Protein 
E From The Cyanobacterium Nostoc Sp. Strain Pcc 8009
 gb|AAD38024.1|AF148219_2 photosystem I protein E [Nostoc sp. PCC 8009]
Length=70

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VG+V +VDQ    +YPV+VRF KVNY+ ++TNN+A DE+ EV
Sbjct  8    VRILRPESYWFQDVGTVASVDQS-GIKYPVIVRFEKVNYSGINTNNFAEDELVEV  61



>ref|WP_015955589.1| photosystem I reaction centre subunit IV/PsaE [Cyanothece sp. 
PCC 7424]
 gb|ACK71996.1| photosystem I reaction centre subunit IV/PsaE [Cyanothece sp. 
PCC 7424]
Length=123

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY  +G V +VD+     YPV+VRF+KVNYA V+TNN+   E+EEV
Sbjct  8    VRILRKESYWYNDIGVVASVDKS-GILYPVIVRFDKVNYAGVTTNNFGTHEVEEV  61



>ref|YP_009029076.1| photosystem I reaction center subunit IV (chloroplast) [Cylindrotheca 
closterium]
 gb|AGH28612.1| photosystem I reaction center subunit IV (chloroplast) (chloroplast) 
[Cylindrotheca closterium]
Length=66

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW+  VG+V  VDQ    RYPVVVRF  VNY+  +TNN+AL+E+ E+
Sbjct  8    VRILRKESYWFNQVGTVATVDQSG-IRYPVVVRFENVNYSGTNTNNFALNELIEI  61



>gb|AAW79343.1| chloroplast photosystem I protein E [Heterocapsa triquetra]
Length=120

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR ESYW++  G+VV V+Q  + +YPV V+F+ VNYANV+TN YAL E+EEV
Sbjct  66   VKILRPESYWFQQKGTVVNVNQKAEVKYPVTVKFDAVNYANVNTNGYALWEVEEV  120



>ref|WP_015081105.1| photosystem I reaction center subunit IV [Anabaena sp. 90]
 gb|AFW95962.1| photosystem I reaction center subunit IV [Anabaena sp. 90]
Length=71

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ +G+VV+VD+    +YPV+VRF KVNY++++TNN+A+DE+ EV
Sbjct  8    VRILRPESYWFQDLGTVVSVDKT-AIKYPVIVRFEKVNYSDLNTNNFAVDELIEV  61



>ref|WP_027400975.1| Photosystem I reaction center subunit IV [Aphanizomenon flos-aquae]
 gb|KHG39060.1| Photosystem I reaction center subunit IV [Aphanizomenon flos-aquae 
2012/KM1/D3]
Length=71

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VR+LR ESYW++ +G+VV+VD+    +YPV+VRF+KVNY++++TNN+A+DE+ EV
Sbjct  8    VRVLRPESYWFQDLGTVVSVDKS-GIKYPVIVRFDKVNYSDLNTNNFAVDELIEV  61



>ref|WP_015192088.1| Photosystem I reaction center subunit IV [Stanieria cyanosphaera]
 gb|AFZ34415.1| Photosystem I reaction center subunit IV [Stanieria cyanosphaera 
PCC 7437]
Length=126

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            V+ILRKESYWY+  G+V +VD+    RYPV+VRFNKV Y  V+TNN+A  E+EEV 
Sbjct  8    VKILRKESYWYQDFGTVASVDKS-GIRYPVIVRFNKVAYHGVNTNNFAEHELEEVT  62



>gb|KIY93708.1| Photosystem I reaction center subunit IV [Monoraphidium neglectum]
Length=103

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIE  467
            V+ILR ESYWY   G VV+VDQ    +YPVVVRF   NYA V+TNN+ALDE+E
Sbjct  48   VKILRPESYWYNQTGKVVSVDQS-GIKYPVVVRFETQNYAGVTTNNFALDEVE  99



>ref|YP_003735019.1| photosystem I reaction center subunit IV [Durinskia baltica]
 gb|ADI40234.1| photosystem I reaction center subunit IV [Durinskia baltica]
Length=65

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYW+   G+V  VDQ    RYPVVVRF  VNY+  +TNN+ALDE+ EV
Sbjct  8    VKILRKESYWFNQTGTVATVDQ-SGIRYPVVVRFENVNYSGTNTNNFALDELVEV  61



>ref|WP_015224518.1| photosystem I reaction centre subunit IV/PsaE [Halothece sp. 
PCC 7418]
 gb|AFZ42640.1| photosystem I reaction centre subunit IV/PsaE [Halothece sp. 
PCC 7418]
Length=77

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYWY  VG+V +VD+     YPV+VRF+KVNY+ V+TNN+ L+E+E V
Sbjct  10   VRILRKESYWYGDVGTVASVDK-SGIIYPVIVRFDKVNYSGVNTNNFGLEEVEVV  63



>ref|YP_005089706.1| psaE gene product (chloroplast) [Ulnaria acus]
 gb|AEX37831.1| photosystem I subunit IV (chloroplast) [Ulnaria acus]
Length=64

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYWY  +G+V  VDQ    RYP VVRF  VNY+  +TNN+ALDE+ EV
Sbjct  8    VRILRPESYWYNEIGTVATVDQS-GIRYPAVVRFESVNYSGTNTNNFALDELVEV  61



>ref|WP_012410286.1| photosystem I reaction center subunit IV [Nostoc punctiforme]
 sp|B2J5G1.1|PSAE_NOSP7 RecName: Full=Photosystem I reaction center subunit IV [Nostoc 
punctiforme PCC 73102]
 gb|ACC82318.1| photosystem I reaction centre subunit IV/PsaE [Nostoc punctiforme 
PCC 73102]
Length=71

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ +G+V ++DQ    +YPV+VRF KVNY+ ++TNN+A DE+ EV
Sbjct  8    VRILRPESYWFQDLGTVASIDQS-GIKYPVIVRFEKVNYSGINTNNFAQDELVEV  61



>ref|WP_015186913.1| Photosystem I reaction center subunit IV [Gloeocapsa sp. PCC 
7428]
 gb|AFZ29036.1| Photosystem I reaction center subunit IV [Gloeocapsa sp. PCC 
7428]
Length=126

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW++ VG V +VD+    RYPV+VRF+KVNYA V+TNN+A  E+ E+
Sbjct  8    VRILRKESYWFQDVGVVASVDKS-GIRYPVIVRFDKVNYAGVNTNNFAETELVEI  61



>ref|WP_044136425.1| photosystem I reaction center subunit IV [Trichodesmium erythraeum]
Length=70

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 8/62 (13%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYA-------NVSTNNYALDEIE  467
            VRILRKESYWY+ VG+V +VD+    +YPV+VRF+KVNYA        V+TNN+A+DE+ 
Sbjct  9    VRILRKESYWYQDVGTVASVDKS-GIKYPVIVRFDKVNYAGSSGSPTGVNTNNFAIDEVV  67

Query  468  EV  473
            E+
Sbjct  68   EI  69



>gb|KIY99818.1| Photosystem I reaction center subunit IV [Monoraphidium neglectum]
Length=101

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIE  467
            V+ILR ESYWY   G VV+VDQ    +YPVVVRF   NYA V+TNN+ALDE+E
Sbjct  46   VKILRPESYWYNQTGKVVSVDQS-GIKYPVVVRFETQNYAGVTTNNFALDEVE  97



>sp|Q117D3.1|PSAE_TRIEI RecName: Full=Photosystem I reaction center subunit IV [Trichodesmium 
erythraeum IMS101]
 gb|ABG50391.1| photosystem I reaction centre subunit IV/PsaE [Trichodesmium 
erythraeum IMS101]
Length=69

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 8/62 (13%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYA-------NVSTNNYALDEIE  467
            VRILRKESYWY+ VG+V +VD+    +YPV+VRF+KVNYA        V+TNN+A+DE+ 
Sbjct  8    VRILRKESYWYQDVGTVASVDKS-GIKYPVIVRFDKVNYAGSSGSPTGVNTNNFAIDEVV  66

Query  468  EV  473
            E+
Sbjct  67   EI  68



>ref|WP_006457318.1| photosystem I reaction center subunit IV [Synechococcus sp. PCC 
7335]
 gb|EDX87500.1| photosystem I reaction center subunit IV [Synechococcus sp. PCC 
7335]
Length=71

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VGSV +VDQ    +YPVVVRF+KVNYA V+TNN++  E+ EV
Sbjct  8    VRILRPESYWFREVGSVASVDQS-GIKYPVVVRFSKVNYAGVNTNNFSEAELVEV  61



>gb|ADO32969.2| photosystem I subunit E [Galdieria sulphuraria]
Length=75

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWY+ +G+VV V++    +YP++VRF+KVNYA V+TNN+A +E+ E+
Sbjct  8    VKILRKESYWYQEIGNVVTVEKSG-IKYPIIVRFDKVNYAGVNTNNFASEEVIEI  61



>ref|WP_006518066.1| Photosystem I reaction centre subunit IV / PsaE [Leptolyngbya 
sp. PCC 7375]
 gb|EKV03706.1| Photosystem I reaction centre subunit IV / PsaE [Leptolyngbya 
sp. PCC 7375]
Length=62

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW++ +G+V +VD+    +YPVVVRF+K+NYA V+TNN+   E++EV
Sbjct  8    VRILRKESYWFQDIGTVASVDKSG-IKYPVVVRFDKINYAGVNTNNFGEFELKEV  61



>ref|YP_009093345.1| photosystem I subunit IV (chloroplast) [Cerataulina daemon]
 gb|AIR76018.1| photosystem I subunit IV (chloroplast) [Cerataulina daemon]
Length=68

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYW+  +G+VV +DQ    RYPV+VRF  VNY+  +TNN+AL+E+ E+
Sbjct  8    VKILRKESYWFNQIGTVVTIDQSG-IRYPVLVRFENVNYSGTNTNNFALNELAEL  61



>ref|WP_017653872.1| Photosystem I reaction center subunit IV [Microchaete sp. PCC 
7126]
Length=70

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYWYK +G+V ++DQ    +Y V+VRF+KVNY+ ++TNN+A +E++EV
Sbjct  8    VRILRPESYWYKDLGTVASIDQS-GIKYSVIVRFDKVNYSGINTNNFAPEELQEV  61



>ref|NP_045096.1| photosystem I subunit IV [Cyanidium caldarium]
 sp|O19924.1|PSAE_CYACA RecName: Full=Photosystem I reaction center subunit IV; Short=PSI-E 
(chloroplast) [Cyanidium caldarium]
 gb|AAB82665.1| unknown [Cyanidium caldarium]
Length=69

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW+  +G+V  VDQ    RYPV+VRF+KVNY+ ++TNN+A++E+ E+
Sbjct  8    VRILRPESYWHNEIGTVATVDQS-GIRYPVIVRFDKVNYSGINTNNFAVNELVEI  61



>ref|NP_043641.1| photosystem I subunit IV [Odontella sinensis]
 sp|P49482.1|PSAE_ODOSI RecName: Full=Photosystem I reaction center subunit IV; Short=PSI-E 
(chloroplast) [Odontella sinensis]
 emb|CAA91673.1| PSI, subunit IV [Odontella sinensis]
Length=71

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW+  VG++  +DQ    RYP VVRF  VNY+  +TNN+AL+E+ EV
Sbjct  8    VRILRKESYWFNQVGTIATIDQSG-IRYPAVVRFENVNYSGTNTNNFALEELIEV  61



>ref|WP_028082647.1| Photosystem I reaction center subunit IV [Dolichospermum circinale]
Length=69

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VG+V ++++    +YPV+VRF+KVNY+ V+TNN+A+DE+ EV
Sbjct  8    VRILRPESYWFQEVGTVASIEKS-AIKYPVIVRFDKVNYSGVNTNNFAVDELLEV  61



>ref|YP_009051041.1| photosystem I subunit IV [Galdieria sulphuraria]
 gb|AIG92643.1| photosystem I subunit IV [Galdieria sulphuraria]
Length=75

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILRKESYWY+ +G+VV V++    +YP++VRF+KVNYA V+TNN+A +E+ E+
Sbjct  8    VKILRKESYWYQEIGNVVTVEKSG-IKYPIIVRFDKVNYAGVNTNNFASEEVIEI  61



>ref|XP_002948231.1| photosystem I reaction center subunit IV, chloroplast precursor 
[Volvox carteri f. nagariensis]
 gb|EFJ50638.1| photosystem I reaction center subunit IV, chloroplast precursor 
[Volvox carteri f. nagariensis]
Length=101

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            V+ILR ESYW+  VG VV VDQ    RYPV+VRF  +NYA V+TN+YALDEI  V
Sbjct  47   VKILRPESYWFNQVGKVVTVDQG-AVRYPVLVRFENLNYAGVNTNSYALDEIAPV  100



>ref|YP_009028715.1| photosystem I reaction center subunit IV (chloroplast) [Asterionellopsis 
glacialis]
 gb|AGH28264.1| photosystem I reaction center subunit IV (chloroplast) (chloroplast) 
[Asterionellopsis glacialis]
Length=66

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            VRILR ESYW+   G+V AVDQ   +RYPV+VRF  VNY+  ++NN+AL+E+ EV+
Sbjct  8    VRILRPESYWFNETGTVAAVDQS-GSRYPVIVRFESVNYSGTNSNNFALNELVEVI  62



>ref|WP_040483444.1| photosystem I reaction centre subunit IV/PsaE [Lyngbya aestuarii]
Length=101

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW++ VG+V +VD+    +YPV+VRF+KVNY+ ++TNN+A  E+ EV
Sbjct  8    VRILRKESYWFQEVGTVASVDKS-GIKYPVIVRFDKVNYSGINTNNFAESEVVEV  61



>ref|YP_874428.1| photosystem I reaction center subunit IV [Phaeodactylum tricornutum]
 sp|A0T0F3.1|PSAE_PHATC RecName: Full=Photosystem I reaction center subunit IV; Short=PSI-E 
(chloroplast) [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ABK20651.1| photosystem I reaction center subunit IV [Phaeodactylum tricornutum]
Length=69

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR+ESYW+  VG+V  VDQ    RYP VVRF KVNY+  +TNN+AL E+ EV
Sbjct  8    VRILREESYWFNEVGTVATVDQS-GIRYPAVVRFEKVNYSGTNTNNFALSELVEV  61



>gb|EJK48011.1| PS I subunit IV [Thalassiosira oceanica]
 gb|EJK53814.1| PS I subunit IV [Thalassiosira oceanica]
Length=98

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRI R ESYWY  VG+V A  ++   RYPV+VRF+ VNYA  ++NN++ +EIEEV
Sbjct  43   VRIKRPESYWYNKVGTVAAAAKEGSERYPVIVRFDSVNYAGTNSNNFSYEEIEEV  97



>gb|AAW79344.1| chloroplast photosystem I protein E, partial [Isochrysis galbana]
Length=123

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VR++R ESYW++  GSV  + +    RYPVVVRF KVNYA V+TNN+A+DE+ EV
Sbjct  46   VRVMRPESYWFQECGSVATIAKG-GDRYPVVVRFEKVNYAGVATNNFAMDELVEV  99



>gb|KFK40387.1| hypothetical protein AALP_AA3G367000 [Arabis alpina]
Length=259

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKV  419
            V+ILRKESYW+K VGSVVAVDQDPKTRYPVVVRF K+
Sbjct  83   VKILRKESYWFKTVGSVVAVDQDPKTRYPVVVRFAKI  119



>ref|WP_009787293.1| photosystem I reaction center subunit IV [Lyngbya sp. PCC 8106]
 gb|EAW34115.1| photosystem I reaction center subunit IV [Lyngbya sp. PCC 8106]
Length=62

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW++ VG+V +VD+    +YPV+VRF KVNY+ ++TNN+A  E+ EV
Sbjct  8    VRILRKESYWFQEVGTVASVDKSG-IKYPVIVRFEKVNYSGINTNNFAESEVVEV  61



>ref|WP_015117638.1| Photosystem I reaction centre subunit IV / PsaE [Rivularia sp. 
PCC 7116]
 gb|AFY54062.1| Photosystem I reaction centre subunit IV / PsaE [Rivularia sp. 
PCC 7116]
Length=118

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VR+LR+ESYWY+ VG+V  VD+     YPV+VRF+KVNY+ ++TNN+A DE+ EV
Sbjct  8    VRVLRRESYWYQDVGTVATVDKS-GIIYPVIVRFDKVNYSGINTNNFAQDELVEV  61



>ref|WP_039737176.1| Photosystem I reaction center subunit IV [Hassallia byssoidea]
 gb|KIF37611.1| Photosystem I reaction center subunit IV [Hassallia byssoidea 
VB512170]
Length=70

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILRKESYW++ VG+V ++D     +Y V+VRFNKVNY+ ++TNN+A DE+ E+
Sbjct  8    VRILRKESYWFQDVGTVASIDPGG-IKYSVIVRFNKVNYSGINTNNFAEDELLEI  61



>ref|WP_015157910.1| Photosystem I reaction centre subunit IV / PsaE [Chamaesiphon 
minutus]
 gb|AFY91716.1| Photosystem I reaction centre subunit IV / PsaE [Chamaesiphon 
minutus PCC 6605]
Length=124

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEVV  476
            VRILR+ESYWY+  G V A+D+    +YPV+VRF KVNYA V+TNN+ L E++E  
Sbjct  8    VRILRQESYWYREEGIVAAMDKS-GIKYPVIVRFEKVNYAGVNTNNFGLHELQETA  62



>ref|XP_006412914.1| hypothetical protein EUTSA_v10026332mg [Eutrema salsugineum]
 gb|ESQ54367.1| hypothetical protein EUTSA_v10026332mg [Eutrema salsugineum]
Length=164

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  369  DQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
             +DPKTRYPVVVRF KVNYAN+STNNYALDEIEEV
Sbjct  128  SKDPKTRYPVVVRFAKVNYANISTNNYALDEIEEV  162



>ref|WP_016950091.1| Photosystem I reaction center subunit IV [Anabaena sp. PCC 7108]
Length=71

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VR+LR ESYW++ VG+V  VDQ    +Y V+VRF+KVNY+ ++TNN+A+DE+ EV
Sbjct  8    VRVLRPESYWFQDVGTVATVDQ-SGIKYSVIVRFDKVNYSGINTNNFAVDELLEV  61



>dbj|BAA78581.1| photosystem I chain IV precursor [Chlamydomonas sp. HS-5]
Length=56

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIE  467
            V++LR ESYWY  VG VV+VDQ    RYPVVVR    NYA V+TNNYAL E+E
Sbjct  2    VKVLRPESYWYNQVGKVVSVDQS-GIRYPVVVRLENQNYAGVTTNNYALTEVE  53



>ref|YP_009028645.1| photosystem I reaction center subunit IV (chloroplast) [Asterionella 
formosa]
 gb|AGH28196.1| photosystem I reaction center subunit IV (chloroplast) (chloroplast) 
[Asterionella formosa]
Length=66

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW   VG+V  VDQ    RYPVVVRF  VNY+  +TNN+ALDE+ EV
Sbjct  8    VRILRPESYWVNEVGTVAVVDQS-GIRYPVVVRFESVNYSGTNTNNFALDELIEV  61



>ref|WP_017745895.1| Photosystem I reaction center subunit IV [Scytonema hofmanni]
Length=70

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYWY+  G+V ++DQ    +YPV+VRFN VNY+ ++TNN+A +E+ EV
Sbjct  8    VRILRPESYWYQDTGTVASIDQS-GIKYPVIVRFNNVNYSGINTNNFADEELIEV  61



>ref|WP_015140455.1| Photosystem I reaction centre subunit IV / PsaE [Nostoc sp. PCC 
7524]
 gb|AFY50042.1| Photosystem I reaction centre subunit IV / PsaE [Nostoc sp. PCC 
7524]
Length=70

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  VRILRKESYWYKGVGSVVAVDQDPKTRYPVVVRFNKVNYANVSTNNYALDEIEEV  473
            VRILR ESYW++ VG+V +VDQ    +Y V+VRF+KVNY+ ++TNN+A DE+ EV
Sbjct  8    VRILRPESYWFQDVGTVASVDQS-GIKYSVIVRFDKVNYSGINTNNFAPDELLEV  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220