BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H11

Length=489
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354634.1|  PREDICTED: probable purine permease 11-like        116   1e-27   Solanum tuberosum [potatoes]
ref|XP_009604158.1|  PREDICTED: probable purine permease 11 isofo...    115   2e-27   Nicotiana tomentosiformis
ref|XP_009766627.1|  PREDICTED: probable purine permease 11 isofo...    115   2e-27   Nicotiana sylvestris
ref|XP_009604157.1|  PREDICTED: probable purine permease 11 isofo...    115   2e-27   Nicotiana tomentosiformis
ref|XP_009766626.1|  PREDICTED: probable purine permease 11 isofo...    115   2e-27   Nicotiana sylvestris
ref|XP_004229705.1|  PREDICTED: probable purine permease 11             111   5e-26   Solanum lycopersicum
emb|CDP09375.1|  unnamed protein product                                108   5e-25   Coffea canephora [robusta coffee]
gb|KJB49302.1|  hypothetical protein B456_008G111600                    104   1e-23   Gossypium raimondii
ref|XP_008460053.1|  PREDICTED: probable purine permease 11             103   5e-23   Cucumis melo [Oriental melon]
gb|KGN46286.1|  hypothetical protein Csa_6G079800                       102   8e-23   Cucumis sativus [cucumbers]
ref|XP_007052417.1|  Purine permease 11 isoform 1                       101   2e-22   
gb|EPS72169.1|  hypothetical protein M569_02583                         100   4e-22   Genlisea aurea
gb|ADN34099.1|  purine transmembrane transporter                        100   4e-22   Cucumis melo subsp. melo
ref|XP_004145022.1|  PREDICTED: probable purine permease 11-like      99.8    8e-22   
ref|XP_004160684.1|  PREDICTED: probable purine permease 11-like      99.8    9e-22   
ref|XP_010557496.1|  PREDICTED: probable purine permease 11           98.2    2e-21   Tarenaya hassleriana [spider flower]
ref|XP_011031685.1|  PREDICTED: probable purine permease 11           98.2    3e-21   Populus euphratica
ref|XP_002320858.2|  purine permease family protein                   97.8    4e-21   
ref|XP_006445484.1|  hypothetical protein CICLE_v10020615mg           97.4    6e-21   Citrus clementina [clementine]
gb|KHG26799.1|  putative purine permease 11 -like protein             94.7    2e-20   Gossypium arboreum [tree cotton]
gb|KDP28910.1|  hypothetical protein JCGZ_14681                       95.9    2e-20   Jatropha curcas
gb|KJB40941.1|  hypothetical protein B456_007G084100                  95.9    2e-20   Gossypium raimondii
ref|XP_006464373.1|  PREDICTED: probable purine permease 11-like ...  95.5    2e-20   
ref|XP_008232299.1|  PREDICTED: probable purine permease 11 isofo...  95.1    3e-20   Prunus mume [ume]
ref|XP_011085324.1|  PREDICTED: probable purine permease 11 isofo...  94.7    4e-20   Sesamum indicum [beniseed]
ref|XP_008232298.1|  PREDICTED: probable purine permease 11 isofo...  94.7    5e-20   Prunus mume [ume]
ref|XP_008355645.1|  PREDICTED: probable purine permease 11           94.7    5e-20   
gb|EYU40318.1|  hypothetical protein MIMGU_mgv1a008679mg              94.0    7e-20   Erythranthe guttata [common monkey flower]
ref|XP_011093479.1|  PREDICTED: probable purine permease 11           94.4    8e-20   Sesamum indicum [beniseed]
emb|CBI16723.3|  unnamed protein product                              93.6    8e-20   Vitis vinifera
ref|XP_002266773.1|  PREDICTED: probable purine permease 11 isofo...  93.6    1e-19   Vitis vinifera
ref|NP_001241384.1|  uncharacterized protein LOC100819409             93.2    1e-19   Glycine max [soybeans]
ref|XP_008364779.1|  PREDICTED: probable purine permease 11 isofo...  93.2    1e-19   
ref|XP_009339630.1|  PREDICTED: probable purine permease 11 isofo...  93.2    2e-19   Pyrus x bretschneideri [bai li]
gb|KDO85409.1|  hypothetical protein CISIN_1g0170172mg                92.8    2e-19   Citrus sinensis [apfelsine]
ref|XP_010092275.1|  hypothetical protein L484_021136                 92.8    2e-19   
ref|XP_010661433.1|  PREDICTED: probable purine permease 11 isofo...  92.8    2e-19   Vitis vinifera
ref|XP_011085333.1|  PREDICTED: probable purine permease 11 isofo...  92.4    3e-19   Sesamum indicum [beniseed]
ref|XP_008364778.1|  PREDICTED: probable purine permease 11 isofo...  92.4    3e-19   
ref|XP_009339629.1|  PREDICTED: probable purine permease 11 isofo...  92.4    4e-19   
emb|CAN78594.1|  hypothetical protein VITISV_020513                   92.8    7e-19   Vitis vinifera
ref|XP_007052418.1|  Purine permease 11 isoform 2                     90.9    8e-19   
ref|XP_007218138.1|  hypothetical protein PRUPE_ppa007245mg           90.9    1e-18   Prunus persica
gb|KJB51291.1|  hypothetical protein B456_008G210300                  90.5    1e-18   Gossypium raimondii
ref|XP_007218139.1|  hypothetical protein PRUPE_ppa007245mg           90.5    1e-18   Prunus persica
ref|XP_006602851.1|  PREDICTED: probable purine permease 11-like ...  90.1    2e-18   Glycine max [soybeans]
gb|KDP20127.1|  hypothetical protein JCGZ_05896                       90.1    3e-18   Jatropha curcas
ref|XP_006464375.1|  PREDICTED: probable purine permease 11-like ...  89.4    4e-18   Citrus sinensis [apfelsine]
ref|XP_007139692.1|  hypothetical protein PHAVU_008G051100g           89.4    5e-18   Phaseolus vulgaris [French bean]
ref|XP_003624233.1|  hypothetical protein MTR_7g080750                87.4    1e-17   
ref|XP_003551696.2|  PREDICTED: probable purine permease 11-like ...  87.4    2e-17   Glycine max [soybeans]
ref|XP_002526505.1|  ATPUP11, putative                                87.0    3e-17   Ricinus communis
gb|AFK45074.1|  unknown                                               85.1    1e-16   Lotus japonicus
ref|XP_011469542.1|  PREDICTED: probable purine permease 11 isofo...  84.3    3e-16   Fragaria vesca subsp. vesca
ref|XP_011469543.1|  PREDICTED: probable purine permease 11 isofo...  83.6    4e-16   Fragaria vesca subsp. vesca
ref|XP_006305130.1|  hypothetical protein CARUB_v10009499mg           83.6    4e-16   Capsella rubella
gb|KDO85410.1|  hypothetical protein CISIN_1g0170172mg                82.4    7e-16   Citrus sinensis [apfelsine]
ref|XP_006445485.1|  hypothetical protein CICLE_v10020615mg           82.4    7e-16   
ref|XP_006445483.1|  hypothetical protein CICLE_v10020615mg           82.8    7e-16   Citrus clementina [clementine]
emb|CDY54350.1|  BnaA09g53790D                                        82.4    7e-16   Brassica napus [oilseed rape]
ref|NP_567339.1|  putative purine permease 13                         82.8    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010056477.1|  PREDICTED: probable purine permease 11 isofo...  82.8    1e-15   Eucalyptus grandis [rose gum]
ref|XP_010056475.1|  PREDICTED: probable purine permease 11 isofo...  82.8    1e-15   
ref|XP_009113499.1|  PREDICTED: probable purine permease 13           82.0    3e-15   Brassica rapa
ref|XP_004492882.1|  PREDICTED: probable purine permease 11-like ...  81.3    3e-15   
emb|CDX75141.1|  BnaC09g25410D                                        80.9    3e-15   
ref|XP_004492883.1|  PREDICTED: probable purine permease 11-like ...  80.5    6e-15   Cicer arietinum [garbanzo]
ref|XP_010056479.1|  PREDICTED: probable purine permease 11 isofo...  78.6    3e-14   
ref|XP_006287993.1|  hypothetical protein CARUB_v10001226mg           77.8    5e-14   Capsella rubella
ref|XP_009400212.1|  PREDICTED: probable purine permease 11           77.8    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006397268.1|  hypothetical protein EUTSA_v10028661mg           78.6    6e-14   
ref|XP_006393716.1|  hypothetical protein EUTSA_v10011581mg           77.0    1e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010680002.1|  PREDICTED: probable purine permease 11           77.0    1e-13   
emb|CAB77995.1|  putative protein                                     77.0    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32117.1|  hypothetical protein AALP_AA6G200500                  76.3    2e-13   Arabis alpina [alpine rockcress]
ref|XP_009775648.1|  PREDICTED: probable purine permease 8 isofor...  75.5    2e-13   Nicotiana sylvestris
ref|XP_002874549.1|  hypothetical protein ARALYDRAFT_351979           74.3    3e-13   
ref|XP_009775647.1|  PREDICTED: probable purine permease 9 isofor...  76.3    3e-13   Nicotiana sylvestris
ref|XP_010674209.1|  PREDICTED: probable purine permease 11 isofo...  75.1    5e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006358606.1|  PREDICTED: probable purine permease 11-like      75.1    6e-13   
gb|KDO38041.1|  hypothetical protein CISIN_1g0167861mg                73.9    7e-13   Citrus sinensis [apfelsine]
ref|XP_009421222.1|  PREDICTED: probable purine permease 11           75.1    7e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_973972.1|  purine permease 11                                  74.7    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247689.1|  PREDICTED: probable purine permease 11           74.7    9e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009123059.1|  PREDICTED: probable purine permease 11           74.3    1e-12   Brassica rapa
ref|XP_002519731.1|  purine transporter, putative                     74.3    1e-12   Ricinus communis
gb|KFK36200.1|  hypothetical protein AALP_AA4G090800                  73.9    2e-12   Arabis alpina [alpine rockcress]
ref|XP_008677756.1|  PREDICTED: uncharacterized protein LOC100502...  73.9    2e-12   
gb|KDO38040.1|  hypothetical protein CISIN_1g0167861mg                73.9    2e-12   Citrus sinensis [apfelsine]
ref|NP_175096.1|  purine permease 11                                  73.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461445.1|  PREDICTED: probable purine permease 11           73.6    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010500152.1|  PREDICTED: probable purine permease 11           73.6    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010479053.1|  PREDICTED: probable purine permease 11           73.6    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006647707.1|  PREDICTED: probable purine permease 11-like      73.6    2e-12   Oryza brachyantha
gb|KJB66914.1|  hypothetical protein B456_010G164800                  73.2    2e-12   Gossypium raimondii
gb|KHG13240.1|  putative purine permease 9 -like protein              73.2    3e-12   Gossypium arboreum [tree cotton]
gb|AFK38153.1|  unknown                                               73.2    3e-12   Lotus japonicus
ref|XP_008677755.1|  PREDICTED: uncharacterized protein LOC100502...  73.6    3e-12   
emb|CDP13405.1|  unnamed protein product                              73.2    3e-12   Coffea canephora [robusta coffee]
gb|EMT19164.1|  hypothetical protein F775_05921                       73.2    4e-12   
ref|XP_006662363.1|  PREDICTED: probable purine permease 11-like      72.8    4e-12   Oryza brachyantha
dbj|BAJ95311.1|  predicted protein                                    72.8    4e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_198932.1|  putative purine permease 12                         72.4    4e-12   
gb|KDO41083.1|  hypothetical protein CISIN_1g043307mg                 70.5    6e-12   Citrus sinensis [apfelsine]
ref|XP_008450060.1|  PREDICTED: probable purine permease 10 isofo...  71.6    6e-12   
ref|XP_004245857.1|  PREDICTED: probable purine permease 11           72.0    6e-12   
ref|XP_002454455.1|  hypothetical protein SORBIDRAFT_04g031400        72.4    7e-12   
ref|XP_008450056.1|  PREDICTED: probable purine permease 10 isofo...  72.0    8e-12   Cucumis melo [Oriental melon]
ref|XP_010052099.1|  PREDICTED: probable purine permease 9            72.0    9e-12   Eucalyptus grandis [rose gum]
ref|XP_010674210.1|  PREDICTED: probable purine permease 11 isofo...  71.6    9e-12   
gb|KGN66057.1|  hypothetical protein Csa_1G569340                     71.6    1e-11   Cucumis sativus [cucumbers]
ref|XP_010110511.1|  hypothetical protein L484_023343                 71.6    1e-11   
ref|XP_008450620.1|  PREDICTED: probable purine permease 11 isofo...  71.2    1e-11   Cucumis melo [Oriental melon]
gb|KEH31564.1|  purine permease                                       71.6    1e-11   Medicago truncatula
ref|XP_004233086.1|  PREDICTED: probable purine permease 10           71.2    1e-11   
emb|CDY14989.1|  BnaA10g08670D                                        71.6    1e-11   Brassica napus [oilseed rape]
ref|XP_009597998.1|  PREDICTED: probable purine permease 9            71.2    2e-11   Nicotiana tomentosiformis
ref|XP_004246178.1|  PREDICTED: probable purine permease 11           70.9    2e-11   Solanum lycopersicum
ref|XP_004295379.2|  PREDICTED: probable purine permease 9            70.9    2e-11   Fragaria vesca subsp. vesca
gb|KDP45955.1|  hypothetical protein JCGZ_11858                       70.9    2e-11   Jatropha curcas
ref|XP_007025157.1|  Purine permease 10, putative                     70.9    2e-11   
ref|XP_006436828.1|  hypothetical protein CICLE_v10031810mg           70.9    2e-11   Citrus clementina [clementine]
ref|XP_010100972.1|  hypothetical protein L484_010627                 67.4    2e-11   
gb|KJB37689.1|  hypothetical protein B456_006G215500                  70.9    2e-11   Gossypium raimondii
ref|XP_002874546.1|  ATPUP13                                          70.1    3e-11   
ref|XP_006358633.1|  PREDICTED: probable purine permease 11-like      70.1    4e-11   Solanum tuberosum [potatoes]
ref|XP_004953494.1|  PREDICTED: probable purine permease 11-like      70.1    4e-11   Setaria italica
ref|XP_010052098.1|  PREDICTED: probable purine permease 9            69.7    6e-11   Eucalyptus grandis [rose gum]
gb|KCW75957.1|  hypothetical protein EUGRSUZ_D00325                   69.7    6e-11   Eucalyptus grandis [rose gum]
ref|XP_008225352.1|  PREDICTED: probable purine permease 10           69.3    6e-11   Prunus mume [ume]
emb|CDX71327.1|  BnaC07g06060D                                        69.7    6e-11   
ref|XP_003551463.1|  PREDICTED: probable purine permease 9-like i...  69.3    8e-11   Glycine max [soybeans]
ref|XP_004293485.1|  PREDICTED: probable purine permease 9            69.3    8e-11   Fragaria vesca subsp. vesca
ref|XP_010091778.1|  hypothetical protein L484_003838                 68.6    8e-11   
ref|XP_010055380.1|  PREDICTED: probable purine permease 11           68.9    8e-11   Eucalyptus grandis [rose gum]
ref|XP_008784692.1|  PREDICTED: probable purine permease 11           68.9    9e-11   Phoenix dactylifera
gb|ACU17999.1|  unknown                                               68.9    9e-11   Glycine max [soybeans]
ref|XP_003532171.1|  PREDICTED: probable purine permease 9-like       68.9    9e-11   
ref|XP_004516108.1|  PREDICTED: probable purine permease 9-like       68.9    1e-10   Cicer arietinum [garbanzo]
ref|XP_008364183.1|  PREDICTED: probable purine permease 9            68.6    1e-10   
ref|XP_007146626.1|  hypothetical protein PHAVU_006G056100g           68.6    1e-10   Phaseolus vulgaris [French bean]
ref|XP_010436374.1|  PREDICTED: probable purine permease 13           68.6    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009614172.1|  PREDICTED: probable purine permease 10           68.6    1e-10   Nicotiana tomentosiformis
ref|XP_011018648.1|  PREDICTED: probable purine permease 11 isofo...  68.6    1e-10   Populus euphratica
ref|XP_011018650.1|  PREDICTED: probable purine permease 11 isofo...  68.6    1e-10   Populus euphratica
ref|XP_003570128.1|  PREDICTED: probable purine permease 11 isofo...  68.2    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_010235835.1|  PREDICTED: probable purine permease 11 isofo...  68.2    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_007146627.1|  hypothetical protein PHAVU_006G056200g           68.2    2e-10   Phaseolus vulgaris [French bean]
ref|XP_009608565.1|  PREDICTED: probable purine permease 9 isofor...  67.8    2e-10   Nicotiana tomentosiformis
ref|XP_006355610.1|  PREDICTED: probable purine permease 9-like       67.8    2e-10   Solanum tuberosum [potatoes]
ref|XP_009782918.1|  PREDICTED: probable purine permease 10           67.8    2e-10   Nicotiana sylvestris
ref|XP_004295378.1|  PREDICTED: probable purine permease 10           67.8    2e-10   Fragaria vesca subsp. vesca
ref|XP_004233087.1|  PREDICTED: probable purine permease 10           67.8    2e-10   Solanum lycopersicum
gb|KJB57288.1|  hypothetical protein B456_009G157000                  67.4    3e-10   Gossypium raimondii
gb|AFK38479.1|  unknown                                               64.3    3e-10   Medicago truncatula
ref|XP_006602140.1|  PREDICTED: probable purine permease 9-like i...  67.4    3e-10   Glycine max [soybeans]
ref|XP_006602139.1|  PREDICTED: probable purine permease 9-like i...  67.4    3e-10   Glycine max [soybeans]
gb|KHN31656.1|  Putative purine permease 9                            67.4    3e-10   Glycine soja [wild soybean]
ref|XP_008226761.1|  PREDICTED: probable purine permease 10           67.4    4e-10   Prunus mume [ume]
gb|KJB34975.1|  hypothetical protein B456_006G093600                  66.6    4e-10   Gossypium raimondii
gb|EPS68820.1|  hypothetical protein M569_05947                       66.6    4e-10   Genlisea aurea
ref|XP_009608566.1|  PREDICTED: probable purine permease 10 isofo...  67.0    4e-10   Nicotiana tomentosiformis
ref|XP_004166556.1|  PREDICTED: LOW QUALITY PROTEIN: probable pur...  67.0    5e-10   
ref|XP_004233088.1|  PREDICTED: probable purine permease 10           66.6    5e-10   Solanum lycopersicum
ref|XP_007025152.1|  Purine permease 10 isoform 1                     66.6    5e-10   
ref|XP_011007505.1|  PREDICTED: probable purine permease 9 isofor...  66.6    5e-10   Populus euphratica
ref|XP_004233085.1|  PREDICTED: probable purine permease 10           66.6    6e-10   Solanum lycopersicum
ref|XP_008225422.1|  PREDICTED: probable purine permease 9            66.6    7e-10   Prunus mume [ume]
emb|CDP06315.1|  unnamed protein product                              66.2    7e-10   Coffea canephora [robusta coffee]
dbj|BAD07671.1|  putative purine permease                             66.2    8e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AFK34280.1|  unknown                                               66.2    8e-10   Medicago truncatula
ref|NP_001047783.1|  Os02g0689200                                     66.2    8e-10   
gb|EAZ24234.1|  hypothetical protein OsJ_07985                        66.2    9e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006355608.1|  PREDICTED: probable purine permease 6-like i...  66.2    9e-10   Solanum tuberosum [potatoes]
ref|XP_006355607.1|  PREDICTED: probable purine permease 6-like i...  65.9    9e-10   
ref|XP_010096958.1|  hypothetical protein L484_017773                 65.9    1e-09   
ref|XP_007039598.1|  Drug/metabolite transporter superfamily protein  65.5    1e-09   
ref|XP_007211409.1|  hypothetical protein PRUPE_ppa006967mg           65.9    1e-09   Prunus persica
ref|XP_010538524.1|  PREDICTED: probable purine permease 10           65.9    1e-09   Tarenaya hassleriana [spider flower]
ref|XP_008225353.1|  PREDICTED: probable purine permease 9            65.9    1e-09   Prunus mume [ume]
ref|XP_011007507.1|  PREDICTED: probable purine permease 10           65.5    1e-09   Populus euphratica
ref|XP_002272204.1|  PREDICTED: probable purine permease 10 isofo...  65.5    1e-09   Vitis vinifera
ref|XP_002298513.2|  hypothetical protein POPTR_0001s34550g           65.5    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006368464.1|  hypothetical protein POPTR_0001s03050g           65.5    1e-09   
gb|KEH34049.1|  purine permease                                       65.5    1e-09   Medicago truncatula
emb|CAN64869.1|  hypothetical protein VITISV_041328                   65.5    1e-09   Vitis vinifera
gb|KCW75963.1|  hypothetical protein EUGRSUZ_D00332                   65.5    2e-09   Eucalyptus grandis [rose gum]
ref|XP_010100975.1|  hypothetical protein L484_010630                 66.2    2e-09   
ref|XP_010054270.1|  PREDICTED: LOW QUALITY PROTEIN: probable pur...  65.1    2e-09   
ref|XP_006449638.1|  hypothetical protein CICLE_v10018046mg           64.3    2e-09   
ref|XP_008383566.1|  PREDICTED: probable purine permease 9            65.1    2e-09   
ref|XP_009782581.1|  PREDICTED: probable purine permease 10 isofo...  64.7    2e-09   Nicotiana sylvestris
ref|XP_002298512.2|  hypothetical protein POPTR_0001s34540g           64.7    2e-09   
dbj|BAG93087.1|  unnamed protein product                              64.7    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010091777.1|  hypothetical protein L484_003837                 64.7    2e-09   Morus notabilis
ref|XP_007025175.1|  Uncharacterized protein TCM_029556               63.5    3e-09   
ref|XP_004498216.1|  PREDICTED: probable purine permease 9-like       64.7    3e-09   
gb|KDO78105.1|  hypothetical protein CISIN_1g041591mg                 63.9    3e-09   Citrus sinensis [apfelsine]
ref|XP_006467516.1|  PREDICTED: probable purine permease 10-like      64.7    3e-09   Citrus sinensis [apfelsine]
ref|XP_010247691.1|  PREDICTED: probable purine permease 11 isofo...  64.7    3e-09   Nelumbo nucifera [Indian lotus]
ref|XP_009782582.1|  PREDICTED: probable purine permease 10 isofo...  64.7    3e-09   Nicotiana sylvestris
ref|XP_009123729.1|  PREDICTED: probable purine permease 9 isofor...  64.7    3e-09   Brassica rapa
gb|KDO78104.1|  hypothetical protein CISIN_1g016119mg                 64.7    3e-09   Citrus sinensis [apfelsine]
ref|XP_009123730.1|  PREDICTED: probable purine permease 9 isofor...  64.3    3e-09   Brassica rapa
ref|XP_008229522.1|  PREDICTED: probable purine permease 11           64.3    3e-09   Prunus mume [ume]
ref|XP_009131523.1|  PREDICTED: probable purine permease 10           64.3    3e-09   Brassica rapa
ref|XP_007025158.1|  Purine permease 10                               64.3    4e-09   
ref|XP_006449637.1|  hypothetical protein CICLE_v10015513mg           64.3    4e-09   
emb|CDX78835.1|  BnaA01g09020D                                        64.3    4e-09   
ref|XP_008383506.1|  PREDICTED: probable purine permease 9            64.3    4e-09   
gb|KHN21034.1|  Putative purine permease 9                            64.3    4e-09   Glycine soja [wild soybean]
ref|XP_002274345.2|  PREDICTED: probable purine permease 10           64.3    4e-09   Vitis vinifera
emb|CBI30830.3|  unnamed protein product                              64.7    4e-09   Vitis vinifera
ref|XP_006355609.1|  PREDICTED: probable purine permease 10-like      63.9    4e-09   
emb|CDX76538.1|  BnaA08g08620D                                        63.9    4e-09   
ref|XP_008444229.1|  PREDICTED: probable purine permease 10 isofo...  63.9    5e-09   Cucumis melo [Oriental melon]
ref|XP_010655638.1|  PREDICTED: probable purine permease 10 isofo...  63.5    5e-09   Vitis vinifera
ref|XP_011007506.1|  PREDICTED: probable purine permease 9 isofor...  63.5    5e-09   Populus euphratica
ref|XP_010434560.1|  PREDICTED: probable purine permease 10           63.9    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010439888.1|  PREDICTED: probable purine permease 10           63.9    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010663907.1|  PREDICTED: probable purine permease 11           63.9    5e-09   Vitis vinifera
ref|XP_010677220.1|  PREDICTED: probable purine permease 11           63.9    5e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC73811.1|  hypothetical protein OsI_08525                        63.9    5e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010517571.1|  PREDICTED: probable purine permease 10           63.9    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_007149374.1|  hypothetical protein PHAVU_005G064800g           63.5    6e-09   Phaseolus vulgaris [French bean]
ref|XP_003550935.1|  PREDICTED: probable purine permease 11-like      63.5    6e-09   Glycine max [soybeans]
dbj|BAD42937.1|  unknown protein                                      61.2    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009608564.1|  PREDICTED: probable purine permease 10           63.5    6e-09   Nicotiana tomentosiformis
ref|XP_010531551.1|  PREDICTED: probable purine permease 10           62.8    7e-09   
ref|XP_002870061.1|  ATPUP10                                          63.5    7e-09   
ref|XP_010100974.1|  hypothetical protein L484_010629                 63.5    7e-09   
ref|XP_009360854.1|  PREDICTED: probable purine permease 9 isofor...  63.5    8e-09   Pyrus x bretschneideri [bai li]
emb|CBI30831.3|  unnamed protein product                              62.8    8e-09   Vitis vinifera
ref|XP_009360858.1|  PREDICTED: probable purine permease 9 isofor...  63.2    9e-09   Pyrus x bretschneideri [bai li]
ref|XP_004976625.1|  PREDICTED: probable purine permease 11-like      63.2    9e-09   
ref|XP_002870060.1|  purine permease family protein                   62.8    9e-09   
ref|XP_009782583.1|  PREDICTED: probable purine permease 9            62.8    1e-08   Nicotiana sylvestris
ref|XP_010517569.1|  PREDICTED: probable purine permease 9            63.2    1e-08   Camelina sativa [gold-of-pleasure]
emb|CDX99493.1|  BnaC01g10590D                                        62.8    1e-08   
ref|XP_007214484.1|  hypothetical protein PRUPE_ppa020615mg           62.4    1e-08   
ref|XP_009353821.1|  PREDICTED: probable purine permease 9            62.8    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_010054266.1|  PREDICTED: probable purine permease 9            62.8    1e-08   Eucalyptus grandis [rose gum]
ref|XP_004147439.1|  PREDICTED: probable purine permease 9-like       62.8    1e-08   
gb|KCW75960.1|  hypothetical protein EUGRSUZ_D00328                   62.4    1e-08   Eucalyptus grandis [rose gum]
ref|XP_010677221.1|  PREDICTED: probable purine permease 11 isofo...  62.8    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010052097.1|  PREDICTED: probable purine permease 9            62.4    1e-08   Eucalyptus grandis [rose gum]
gb|KGN65548.1|  hypothetical protein Csa_1G445360                     62.8    1e-08   Cucumis sativus [cucumbers]
ref|XP_008444266.1|  PREDICTED: probable purine permease 10           62.4    1e-08   Cucumis melo [Oriental melon]
ref|XP_004508992.1|  PREDICTED: probable purine permease 10-like      62.8    2e-08   Cicer arietinum [garbanzo]
ref|XP_002447004.1|  hypothetical protein SORBIDRAFT_06g026770        62.4    2e-08   Sorghum bicolor [broomcorn]
ref|XP_009762884.1|  PREDICTED: probable purine permease 9            62.4    2e-08   Nicotiana sylvestris
emb|CDP06323.1|  unnamed protein product                              62.4    2e-08   Coffea canephora [robusta coffee]
ref|XP_006285294.1|  hypothetical protein CARUB_v10006671mg           62.4    2e-08   
emb|CDY08897.1|  BnaC08g11270D                                        62.4    2e-08   Brassica napus [oilseed rape]
ref|XP_009353822.1|  PREDICTED: probable purine permease 10           62.0    2e-08   
ref|XP_006282809.1|  hypothetical protein CARUB_v10006525mg           62.0    2e-08   
ref|XP_009354030.1|  PREDICTED: probable purine permease 9            62.0    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_010941200.1|  PREDICTED: probable purine permease 11           62.0    2e-08   Elaeis guineensis
ref|XP_009360855.1|  PREDICTED: probable purine permease 9 isofor...  62.0    2e-08   Pyrus x bretschneideri [bai li]
dbj|BAK08195.1|  predicted protein                                    62.0    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010240325.1|  PREDICTED: probable purine permease 11           61.6    3e-08   Brachypodium distachyon [annual false brome]
sp|O49726.2|PUP9_ARATH  RecName: Full=Probable purine permease 9;...  61.6    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010100973.1|  hypothetical protein L484_010628                 61.6    3e-08   Morus notabilis
ref|XP_010439889.1|  PREDICTED: probable purine permease 9            61.6    3e-08   Camelina sativa [gold-of-pleasure]
emb|CBI20092.3|  unnamed protein product                              61.6    3e-08   Vitis vinifera
emb|CAN73056.1|  hypothetical protein VITISV_007596                   61.6    3e-08   Vitis vinifera
ref|XP_002285650.3|  PREDICTED: probable purine permease 11           61.6    3e-08   Vitis vinifera
ref|XP_004151103.1|  PREDICTED: probable purine permease 9-like i...  61.6    3e-08   Cucumis sativus [cucumbers]
ref|XP_009360857.1|  PREDICTED: probable purine permease 9 isofor...  61.2    4e-08   
ref|XP_004151104.1|  PREDICTED: probable purine permease 9-like i...  61.2    4e-08   
ref|NP_193555.3|  purine permease 10                                  61.2    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414134.1|  hypothetical protein EUTSA_v10025416mg           61.2    4e-08   Eutrema salsugineum [saltwater cress]
ref|XP_007022081.1|  Purine permease 11, putative                     61.2    4e-08   
ref|XP_010919838.1|  PREDICTED: probable purine permease 11           61.2    4e-08   Elaeis guineensis
ref|XP_002870064.1|  predicted protein                                61.2    4e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_010666510.1|  PREDICTED: probable purine permease 9            61.6    4e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008371579.1|  PREDICTED: probable purine permease 10           61.2    4e-08   
ref|XP_011096513.1|  PREDICTED: probable purine permease 9            61.2    4e-08   Sesamum indicum [beniseed]
ref|XP_010091784.1|  hypothetical protein L484_003844                 61.2    5e-08   
emb|CDY08899.1|  BnaC08g11290D                                        60.8    5e-08   
ref|XP_007213551.1|  hypothetical protein PRUPE_ppa018140mg           60.5    6e-08   
ref|XP_007212398.1|  hypothetical protein PRUPE_ppa016371mg           60.5    6e-08   
emb|CDX76537.1|  BnaA08g08630D                                        60.8    6e-08   
ref|XP_008663458.1|  PREDICTED: probable purine permease 11           60.5    6e-08   
ref|XP_009775721.1|  PREDICTED: probable purine permease 11           60.5    7e-08   
ref|XP_007155747.1|  hypothetical protein PHAVU_003G228300g           60.5    7e-08   
ref|XP_006467517.1|  PREDICTED: probable purine permease 9-like       60.1    9e-08   
ref|XP_010434561.1|  PREDICTED: probable purine permease 9            60.1    9e-08   
ref|XP_003580442.1|  PREDICTED: probable purine permease 11           59.7    1e-07   
ref|XP_006449636.1|  hypothetical protein CICLE_v10015531mg           59.7    1e-07   
emb|CAE04314.3|  OSJNBb0016D16.5                                      60.1    1e-07   
ref|XP_007025156.1|  Purine permease 10, putative                     59.3    2e-07   
ref|XP_004976629.1|  PREDICTED: probable purine permease 11-like ...  59.3    2e-07   
emb|CDP06322.1|  unnamed protein product                              58.9    2e-07   
ref|XP_004976628.1|  PREDICTED: probable purine permease 11-like ...  59.3    2e-07   
ref|XP_010677223.1|  PREDICTED: probable purine permease 11           58.9    2e-07   
ref|NP_193556.1|  putative purine permease 9                          58.9    2e-07   
ref|XP_011096514.1|  PREDICTED: probable purine permease 9            58.9    2e-07   
ref|XP_008383504.1|  PREDICTED: probable purine permease 9 isofor...  58.5    3e-07   
ref|XP_008383505.1|  PREDICTED: probable purine permease 9 isofor...  58.5    3e-07   
ref|XP_009607832.1|  PREDICTED: probable purine permease 9            58.5    3e-07   
emb|CDX76536.1|  BnaA08g08640D                                        58.2    3e-07   
ref|XP_008663459.1|  PREDICTED: probable purine permease 11           58.5    3e-07   
emb|CDY08900.1|  BnaC08g11300D                                        58.2    3e-07   
gb|KFK22513.1|  hypothetical protein AALP_AAs55566U000200             58.5    4e-07   
gb|KGN65546.1|  hypothetical protein Csa_1G444350                     58.5    4e-07   
gb|EEC77872.1|  hypothetical protein OsI_17156                        58.2    4e-07   
ref|NP_001053690.1|  Os04g0587300                                     58.2    4e-07   
dbj|BAJ85920.1|  predicted protein                                    58.2    4e-07   
ref|XP_010529149.1|  PREDICTED: probable purine permease 6            57.8    5e-07   
ref|XP_006285158.1|  hypothetical protein CARUB_v10006502mg           57.8    5e-07   
ref|XP_006414138.1|  hypothetical protein EUTSA_v10025436mg           57.8    5e-07   
ref|XP_009108355.1|  PREDICTED: probable purine permease 9            57.8    5e-07   
dbj|BAJ88177.1|  predicted protein                                    58.2    6e-07   
gb|EEE70162.1|  hypothetical protein OsJ_30232                        57.4    6e-07   
gb|EAZ09979.1|  hypothetical protein OsI_32283                        57.4    6e-07   
ref|XP_008444206.1|  PREDICTED: probable purine permease 10 isofo...  57.4    7e-07   
ref|XP_008444215.1|  PREDICTED: probable purine permease 10 isofo...  57.4    8e-07   
ref|XP_006414137.1|  hypothetical protein EUTSA_v10027089mg           57.4    8e-07   
gb|KFK28497.1|  hypothetical protein AALP_AA7G003500                  57.4    8e-07   
ref|XP_009591151.1|  PREDICTED: probable purine permease 11           57.4    8e-07   
gb|EYU28179.1|  hypothetical protein MIMGU_mgv1a007969mg              57.4    8e-07   
ref|XP_010517570.1|  PREDICTED: probable purine permease 8            57.4    9e-07   
ref|XP_010666509.1|  PREDICTED: probable purine permease 9            57.0    9e-07   
gb|EMT31477.1|  hypothetical protein F775_19802                       57.0    1e-06   
ref|XP_002447006.1|  hypothetical protein SORBIDRAFT_06g026780        57.0    1e-06   
gb|KDP37934.1|  hypothetical protein JCGZ_04577                       57.0    1e-06   
ref|XP_004233091.1|  PREDICTED: probable purine permease 9 isofor...  56.6    1e-06   
ref|XP_006286268.1|  hypothetical protein CARUB_v10007843mg           56.6    1e-06   
ref|XP_010316909.1|  PREDICTED: probable purine permease 10 isofo...  56.6    1e-06   
ref|NP_001053691.1|  Os04g0587400                                     56.6    1e-06   
gb|ABR16480.1|  unknown                                               56.6    1e-06   
gb|EPS62038.1|  hypothetical protein M569_12755                       56.2    1e-06   
ref|XP_006414136.1|  hypothetical protein EUTSA_v10025391mg           56.6    2e-06   
ref|XP_004976626.1|  PREDICTED: probable purine permease 11-like ...  56.2    2e-06   
emb|CDX99494.1|  BnaC01g10580D                                        56.6    2e-06   
emb|CAE04316.1|  OSJNBb0016D16.7                                      55.8    2e-06   
gb|EMT31478.1|  hypothetical protein F775_19803                       55.8    2e-06   
ref|XP_006414135.1|  hypothetical protein EUTSA_v10025476mg           55.8    3e-06   
ref|XP_007025155.1|  Drug/metabolite transporter superfamily prot...  55.5    3e-06   
dbj|BAG87378.1|  unnamed protein product                              55.5    3e-06   
ref|XP_010439890.1|  PREDICTED: probable purine permease 8            55.5    3e-06   
ref|XP_006355612.1|  PREDICTED: probable purine permease 9-like       55.5    3e-06   
emb|CDY08895.1|  BnaC08g11250D                                        55.5    3e-06   
emb|CDX76540.1|  BnaA08g08600D                                        55.5    3e-06   
ref|XP_010439892.1|  PREDICTED: probable purine permease 6            55.1    4e-06   
ref|XP_009762883.1|  PREDICTED: probable purine permease 9            55.1    5e-06   
ref|NP_001031663.1|  purine permease 7                                55.1    5e-06   
ref|XP_009131482.1|  PREDICTED: probable purine permease 21           54.7    5e-06   
ref|XP_009131493.1|  PREDICTED: probable purine permease 6            54.7    5e-06   
emb|CAA16792.1|  putative protein                                     55.5    5e-06   
gb|KCW67627.1|  hypothetical protein EUGRSUZ_F01376                   51.6    6e-06   
emb|CDX78833.1|  BnaA01g09000D                                        54.7    6e-06   
ref|XP_009123731.1|  PREDICTED: probable purine permease 8            54.7    6e-06   
ref|NP_001031662.1|  purine permease 8                                54.7    6e-06   
ref|NP_193553.2|  purine permease 6                                   54.3    7e-06   
gb|KHN39749.1|  Putative purine permease 11                           53.9    7e-06   
gb|AFG50737.1|  hypothetical protein CL1286Contig1_06                 50.8    7e-06   
gb|KJB69778.1|  hypothetical protein B456_011G041900                  53.5    8e-06   
dbj|BAK08301.1|  predicted protein                                    54.3    8e-06   
ref|XP_002870063.1|  predicted protein                                53.9    9e-06   
ref|XP_002447964.1|  hypothetical protein SORBIDRAFT_06g018980        53.9    9e-06   
ref|XP_010434564.1|  PREDICTED: probable purine permease 6            53.9    1e-05   
ref|XP_010439887.1|  PREDICTED: probable purine permease 21           53.9    1e-05   
ref|XP_002870062.1|  predicted protein                                53.9    1e-05   
gb|EPS68883.1|  hypothetical protein M569_05883                       53.5    1e-05   
ref|XP_003541802.2|  PREDICTED: probable purine permease 11-like      53.5    1e-05   
gb|KHN47451.1|  Putative purine permease 11                           53.5    2e-05   
ref|XP_004233090.1|  PREDICTED: probable purine permease 9            53.1    2e-05   
gb|AAN60265.1|  unknown                                               52.4    2e-05   
ref|XP_010449494.1|  PREDICTED: probable purine permease 6            53.1    2e-05   
ref|NP_001031664.1|  nucleotide-sugar transporter family protein      52.8    3e-05   
ref|XP_010941192.1|  PREDICTED: probable purine permease 11           52.8    3e-05   
ref|XP_010449493.1|  PREDICTED: probable purine permease 6            52.4    3e-05   
ref|XP_010439891.1|  PREDICTED: probable purine permease 6            52.4    3e-05   
gb|KCW75961.1|  hypothetical protein EUGRSUZ_D00330                   52.4    3e-05   
gb|KFK28499.1|  hypothetical protein AALP_AA7G003900                  52.4    4e-05   
ref|XP_007155746.1|  hypothetical protein PHAVU_003G228200g           52.0    4e-05   
ref|XP_010559253.1|  PREDICTED: probable purine permease 8            52.4    4e-05   
ref|XP_003593723.1|  hypothetical protein MTR_2g015470                52.0    4e-05   
ref|XP_008656754.1|  PREDICTED: probable purine permease 4            52.0    5e-05   
gb|EYU43290.1|  hypothetical protein MIMGU_mgv1a008106mg              52.0    5e-05   
ref|XP_011085269.1|  PREDICTED: probable purine permease 10           51.6    5e-05   
gb|KFK28500.1|  hypothetical protein AALP_AA7G004000                  52.0    5e-05   
gb|KDP37933.1|  hypothetical protein JCGZ_04576                       51.6    6e-05   
ref|XP_008799578.1|  PREDICTED: LOW QUALITY PROTEIN: probable pur...  51.6    6e-05   
gb|KCW75959.1|  hypothetical protein EUGRSUZ_D00327                   51.2    9e-05   
gb|KCW75962.1|  hypothetical protein EUGRSUZ_D00331                   50.8    1e-04   
gb|KFK28498.1|  hypothetical protein AALP_AA7G003700                  50.8    1e-04   
ref|XP_010240326.1|  PREDICTED: probable purine permease 11 isofo...  50.8    1e-04   
emb|CDY01525.1|  BnaC07g35150D                                        50.8    1e-04   
ref|XP_003581578.2|  PREDICTED: probable purine permease 11 isofo...  50.8    1e-04   
gb|KFK31475.1|  hypothetical protein AALP_AA6G116900                  50.4    1e-04   
ref|XP_010054269.1|  PREDICTED: probable purine permease 9            50.4    1e-04   
ref|XP_010412989.1|  PREDICTED: probable purine permease 21           50.4    1e-04   
ref|XP_009392542.1|  PREDICTED: probable purine permease 4            50.4    1e-04   
ref|XP_006661507.1|  PREDICTED: probable purine permease 11-like      50.4    2e-04   
ref|XP_010434559.1|  PREDICTED: probable purine permease 6            50.4    2e-04   
ref|XP_002456148.1|  hypothetical protein SORBIDRAFT_03g031210        50.1    2e-04   
ref|XP_003525599.1|  PREDICTED: probable purine permease 10-like      49.7    2e-04   
ref|XP_010459653.1|  PREDICTED: probable purine permease 14           49.7    2e-04   
gb|EPS59911.1|  hypothetical protein M569_14894                       49.3    3e-04   
ref|XP_003602861.1|  Purine permease                                  49.3    3e-04   
emb|CAA16793.1|  putative protein                                     48.9    4e-04   
ref|XP_008671258.1|  PREDICTED: probable purine permease 11           48.9    5e-04   
ref|XP_010924628.1|  PREDICTED: probable purine permease 4            48.9    5e-04   
ref|XP_009782584.1|  PREDICTED: probable purine permease 10 isofo...  48.9    5e-04   
tpg|DAA37453.1|  TPA: hypothetical protein ZEAMMB73_016243            48.9    5e-04   
ref|XP_008811388.1|  PREDICTED: probable purine permease 11           48.9    6e-04   
ref|XP_006644522.1|  PREDICTED: probable purine permease 4-like       48.5    6e-04   
ref|XP_006859063.1|  hypothetical protein AMTR_s00068p00197770        48.5    7e-04   
ref|XP_010918723.1|  PREDICTED: probable purine permease 4            48.5    7e-04   
ref|XP_006284920.1|  hypothetical protein CARUB_v10006219mg           48.1    8e-04   



>ref|XP_006354634.1| PREDICTED: probable purine permease 11-like [Solanum tuberosum]
Length=364

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 7/110 (6%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            MA+N+ PIL K+D    Q+PL KL R  FWLL+ALN+ FLLVGQAAA+ILGR YY+KGGN
Sbjct  1    MADNQQPILQKDD---AQHPLAKLNRLHFWLLVALNIVFLLVGQAAAVILGRFYYEKGGN  57

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+AT+VQTA FP+L IPY  I SP+  S++SN+    PSII V+ +YF
Sbjct  58   SKWMATVVQTAAFPLLFIPYLFISSPQTHSEASNR----PSIITVSVVYF  103



>ref|XP_009604158.1| PREDICTED: probable purine permease 11 isoform X2 [Nicotiana 
tomentosiformis]
Length=367

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 4/110 (4%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +N+ PIL K+  S+ Q+PL KL R  FWLLLALN+ FLL GQAAA+ILGR YYDKGGN
Sbjct  1    MTDNQQPILGKDGASNGQHPLAKLNRLHFWLLLALNIIFLLAGQAAAVILGRFYYDKGGN  60

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+ATLVQTA FP+L IPY  I SP+  S+ SN+     S I V+ +YF
Sbjct  61   SKWMATLVQTAAFPVLFIPYLFITSPQNDSEGSNR----ASFITVSVVYF  106



>ref|XP_009766627.1| PREDICTED: probable purine permease 11 isoform X2 [Nicotiana 
sylvestris]
Length=367

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 4/110 (4%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +N+ PIL K+  S+ Q+PL KL R  FWLLLALN+ FLL GQAAA+ILGR YYDKGGN
Sbjct  1    MTDNQQPILGKDGASNGQHPLAKLNRLHFWLLLALNIIFLLAGQAAAVILGRFYYDKGGN  60

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+ATLVQTA FP+L IPY  I SP+  S+ SN+     S I V+ +YF
Sbjct  61   SKWMATLVQTAAFPVLFIPYLFITSPQNDSEGSNR----ASFITVSVVYF  106



>ref|XP_009604157.1| PREDICTED: probable purine permease 11 isoform X1 [Nicotiana 
tomentosiformis]
Length=368

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 80/109 (73%), Gaps = 4/109 (4%)
 Frame = +3

Query  159  AENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNS  338
            A+N+ PIL K+  S+ Q+PL KL R  FWLLLALN+ FLL GQAAA+ILGR YYDKGGNS
Sbjct  3    ADNQQPILGKDGASNGQHPLAKLNRLHFWLLLALNIIFLLAGQAAAVILGRFYYDKGGNS  62

Query  339  TWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
             W+ATLVQTA FP+L IPY  I SP+  S+ SN+     S I V+ +YF
Sbjct  63   KWMATLVQTAAFPVLFIPYLFITSPQNDSEGSNR----ASFITVSVVYF  107



>ref|XP_009766626.1| PREDICTED: probable purine permease 11 isoform X1 [Nicotiana 
sylvestris]
Length=368

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 80/109 (73%), Gaps = 4/109 (4%)
 Frame = +3

Query  159  AENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNS  338
            A+N+ PIL K+  S+ Q+PL KL R  FWLLLALN+ FLL GQAAA+ILGR YYDKGGNS
Sbjct  3    ADNQQPILGKDGASNGQHPLAKLNRLHFWLLLALNIIFLLAGQAAAVILGRFYYDKGGNS  62

Query  339  TWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
             W+ATLVQTA FP+L IPY  I SP+  S+ SN+     S I V+ +YF
Sbjct  63   KWMATLVQTAAFPVLFIPYLFITSPQNDSEGSNR----ASFITVSVVYF  107



>ref|XP_004229705.1| PREDICTED: probable purine permease 11 [Solanum lycopersicum]
Length=364

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 7/110 (6%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            MA+N+ PIL K+D    Q+P+ KL R  FWLL+ALN+ FLLVGQA A+ILGR YY+KGGN
Sbjct  1    MADNQQPILQKDD---AQHPMAKLNRLHFWLLVALNIVFLLVGQATAVILGRFYYEKGGN  57

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+AT+VQTA FP+L IPY +I SP+  S++SN+    PSII V+ +Y 
Sbjct  58   SKWMATVVQTAAFPLLFIPYLVISSPQTHSEASNR----PSIITVSVVYL  103



>emb|CDP09375.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 80/110 (73%), Gaps = 5/110 (5%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M  NE PIL+K+       P  +LKR+ +WLL+ALN+ FLLVGQAA+++LGR YYDKGGN
Sbjct  1    MPVNEEPILIKDSTLIDMLPFFRLKRWQWWLLVALNIVFLLVGQAASVLLGRFYYDKGGN  60

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            STWLATL+QTAGFPIL IPY  I S    SDS+N     PS+I+V  IYF
Sbjct  61   STWLATLLQTAGFPILFIPYIFIGSSWTPSDSAN-----PSLIRVCLIYF  105



>gb|KJB49302.1| hypothetical protein B456_008G111600 [Gossypium raimondii]
Length=364

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 81/110 (74%), Gaps = 4/110 (4%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +N+  I+ KE++   ++P +KL+R+ +WLL+A+N+ FL+ GQAAA++LGR YYDKGGN
Sbjct  1    MTDNQESIVNKEENLMDESPFLKLQRWQWWLLVAINIFFLIAGQAAAVLLGRFYYDKGGN  60

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+ATLVQTAGFP+L IPYFL+   +E S SS      PSI  +  +YF
Sbjct  61   SKWMATLVQTAGFPVLCIPYFLLHPSREASTSSTS----PSIKTLALLYF  106



>ref|XP_008460053.1| PREDICTED: probable purine permease 11 [Cucumis melo]
Length=367

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 4/110 (4%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +N+ PIL KE  S  + PL  LKR+ +W L+ALN+ FL+VGQAAA++LGR YYDKGGN
Sbjct  1    MTDNQQPILDKEVTSVDELPLANLKRWQWWFLVALNILFLVVGQAAAVLLGRFYYDKGGN  60

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+AT+VQTA FPIL IP FL  S K+ S S+N     PSI+ +  IYF
Sbjct  61   SKWMATVVQTAAFPILFIPLFLFRSTKDTSTSTNP----PSILFLLLIYF  106



>gb|KGN46286.1| hypothetical protein Csa_6G079800 [Cucumis sativus]
Length=367

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 79/110 (72%), Gaps = 4/110 (4%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +N+ PIL KE  S  + PL  LKR+ +W L++LN+ FL+VGQAAA++LGR YYDKGGN
Sbjct  1    MTDNQQPILDKEVASVDELPLANLKRWQWWFLVSLNIIFLVVGQAAAVLLGRFYYDKGGN  60

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+AT+VQTA FP+L IP FL  S K+ S S+N     PSI+ +  IYF
Sbjct  61   SKWMATVVQTAAFPVLFIPLFLFRSTKDTSTSTNP----PSILFLLLIYF  106



>ref|XP_007052417.1| Purine permease 11 isoform 1 [Theobroma cacao]
 gb|EOX96574.1| Purine permease 11 isoform 1 [Theobroma cacao]
Length=366

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 78/110 (71%), Gaps = 4/110 (4%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +N+ PIL K++    Q P +KLKR+ +WLL+A+N+ FL+ GQAAA++LGR YYD+GG 
Sbjct  1    MTDNQEPILNKDETLMDQTPFLKLKRWQWWLLVAMNIFFLIAGQAAAVLLGRFYYDQGGK  60

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+ATLVQTAGFPIL  P+FL+   +E S S+      PSI  +  +YF
Sbjct  61   SKWMATLVQTAGFPILCFPFFLLRPSRESSASTTS----PSIKTLALLYF  106



>gb|EPS72169.1| hypothetical protein M569_02583, partial [Genlisea aurea]
Length=340

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 6/96 (6%)
 Frame = +3

Query  207  QNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILL  386
            ++PL KLKR  +W+L+ L + FL+VGQAAA++LGR+YYDKGGNS W+ATLVQT  FPIL 
Sbjct  2    KHPLAKLKRSHWWILVGLTIFFLIVGQAAAVLLGRLYYDKGGNSKWMATLVQTVAFPILF  61

Query  387  IPYFLIPSPKEQS---DSSNQPPPLPSIIKVTXIYF  485
            IPY+L+PSP+ +S    SSN+P   PSI  V  +Y 
Sbjct  62   IPYYLVPSPENKSSHPSSSNKP---PSICVVAAVYL  94



>gb|ADN34099.1| purine transmembrane transporter [Cucumis melo subsp. melo]
Length=378

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 77/107 (72%), Gaps = 4/107 (4%)
 Frame = +3

Query  165  NETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTW  344
            N+ PIL KE  S  + PL  LKR+ +W L+ALN+ FL+VGQAAA++LGR YYDKGGNS W
Sbjct  15   NQQPILDKEVTSVDELPLANLKRWQWWFLVALNILFLVVGQAAAVLLGRFYYDKGGNSKW  74

Query  345  LATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            +AT+VQTA FPIL IP FL  S K+ S S+N     PSI+ +  IYF
Sbjct  75   MATVVQTAAFPILFIPLFLFRSTKDTSTSTNP----PSILFLLLIYF  117



>ref|XP_004145022.1| PREDICTED: probable purine permease 11-like [Cucumis sativus]
 ref|XP_004154140.1| PREDICTED: probable purine permease 11-like [Cucumis sativus]
Length=378

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 4/107 (4%)
 Frame = +3

Query  165  NETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTW  344
            N+ PIL KE  S  + PL  LKR+ +W L++LN+ FL+VGQAAA++LGR YYDKGGNS W
Sbjct  15   NQQPILDKEVASVDELPLANLKRWQWWFLVSLNIIFLVVGQAAAVLLGRFYYDKGGNSKW  74

Query  345  LATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            +AT+VQTA FP+L IP FL  S K+ S S+N     PSI+ +  IYF
Sbjct  75   MATVVQTAAFPVLFIPLFLFRSTKDTSTSTNP----PSILFLLLIYF  117



>ref|XP_004160684.1| PREDICTED: probable purine permease 11-like [Cucumis sativus]
Length=378

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 4/107 (4%)
 Frame = +3

Query  165  NETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTW  344
            N+ PIL KE  S  + PL  LKR+ +W L++LN+ FL+VGQAAA++LGR YYDKGGNS W
Sbjct  15   NQQPILDKEVASVDELPLANLKRWQWWFLVSLNIIFLVVGQAAAVLLGRFYYDKGGNSKW  74

Query  345  LATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            +AT+VQTA FP+L IP FL  S K+ S S+N     PSI+ +  IYF
Sbjct  75   MATVVQTAAFPVLFIPLFLFRSTKDTSTSTNP----PSILFLLLIYF  117



>ref|XP_010557496.1| PREDICTED: probable purine permease 11 [Tarenaya hassleriana]
 ref|XP_010557498.1| PREDICTED: probable purine permease 11 [Tarenaya hassleriana]
 ref|XP_010557499.1| PREDICTED: probable purine permease 11 [Tarenaya hassleriana]
 ref|XP_010557500.1| PREDICTED: probable purine permease 11 [Tarenaya hassleriana]
Length=363

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +3

Query  156  MAENETPILVKEDD-SDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            M +N+ PIL K++       PL+KLKR+ +WLL+ +N+ FL+ GQAAA++LGR YYD+GG
Sbjct  1    MTDNQEPILAKDEHLGSIPAPLIKLKRWQWWLLVVVNIFFLIGGQAAAVLLGRFYYDQGG  60

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSN  437
            NS W+ATLVQTA FPIL +P FLIPS K+ S  S+
Sbjct  61   NSKWMATLVQTAAFPILCLPLFLIPSAKDSSRDSD  95



>ref|XP_011031685.1| PREDICTED: probable purine permease 11 [Populus euphratica]
Length=370

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = +3

Query  156  MAENETPILVK-EDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            + +NE PIL K ED    Q+ L KL+R+ +WLL+A+NV FL+ GQ+AA++LGR YYD+GG
Sbjct  3    VTDNEEPILNKVEDTVALQSLLFKLQRWQWWLLVAINVFFLVAGQSAAVLLGRFYYDQGG  62

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKV  470
            NS W+AT+VQTAGFPIL IP FL+PS KE   S    P + ++  +
Sbjct  63   NSKWIATVVQTAGFPILFIPLFLLPSDKEPLASYTSSPSVRTLASI  108



>ref|XP_002320858.2| purine permease family protein [Populus trichocarpa]
 gb|EEE99173.2| purine permease family protein [Populus trichocarpa]
Length=368

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = +3

Query  156  MAENETPILVK-EDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            M +NE PIL K E+    Q+ L KL+R+ +WLL+A+N+ FL+ GQ+AA++LGR YYD+GG
Sbjct  1    MEDNEEPILNKVENTVALQSLLFKLQRWQWWLLVAINIFFLVAGQSAAVLLGRFYYDQGG  60

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKV  470
            NS W+AT++QTAGFPIL IP FL+PS KE   S    P + ++  +
Sbjct  61   NSKWIATVIQTAGFPILFIPLFLLPSDKEPLSSYTSSPSVRTLASI  106



>ref|XP_006445484.1| hypothetical protein CICLE_v10020615mg [Citrus clementina]
 ref|XP_006464374.1| PREDICTED: probable purine permease 11-like isoform X2 [Citrus 
sinensis]
 gb|ESR58724.1| hypothetical protein CICLE_v10020615mg [Citrus clementina]
Length=379

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQNPLM-KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKG  329
             MA+NE P+++ +  ++ Q+PL  KLK + +W+L+ +N+ FL+ GQAAA+ILGR YYD+G
Sbjct  16   SMADNEEPMIIDKYLTN-QSPLFRKLKSWQWWVLVVVNIFFLIAGQAAAVILGRYYYDQG  74

Query  330  GNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
            GNS WLATLVQTA FPIL IP FL+P+ +E S SS  P 
Sbjct  75   GNSKWLATLVQTAAFPILYIPLFLLPASQEVSSSSRYPS  113



>gb|KHG26799.1| putative purine permease 11 -like protein [Gossypium arboreum]
Length=232

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = +3

Query  207  QNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILL  386
            ++P +KLKRF +WLL+A+N+ FL+ GQAAA++LGR YYDKGGNS W+ATLVQTAGFP+L 
Sbjct  3    ESPFLKLKRFQWWLLVAINIFFLIAGQAAAVLLGRFYYDKGGNSQWMATLVQTAGFPVLC  62

Query  387  IPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            IP+FL+   +E S  S      PSI  +  +YF
Sbjct  63   IPWFLLRPSREASTFSTS----PSIKTLALLYF  91



>gb|KDP28910.1| hypothetical protein JCGZ_14681 [Jatropha curcas]
Length=366

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 81/111 (73%), Gaps = 4/111 (4%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            MA+N+ PIL K+ ++   + L+KLK + +WL++A+N+ FL+VGQ+AA++LGR+YYDKGGN
Sbjct  1    MADNQEPILNKDVNTTANSLLLKLKNWQWWLVVAINIFFLVVGQSAAVLLGRLYYDKGGN  60

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            S W+ATLVQT  FPIL IP FL+ S +E S        LPSI  +  IYFF
Sbjct  61   SKWMATLVQTVAFPILYIPLFLLSSSQESS----TSATLPSIRTLALIYFF  107



>gb|KJB40941.1| hypothetical protein B456_007G084100 [Gossypium raimondii]
Length=371

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 82/111 (74%), Gaps = 4/111 (4%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +N   +L+++++   ++P +KL+R+ +WLL+A+N+ FL+ GQAAA++LGR YYD+GGN
Sbjct  1    MNDNLEQMLIQDENLTDRSPFLKLRRWQWWLLVAINILFLIAGQAAAVLLGRFYYDQGGN  60

Query  336  STWLATLVQTAGFPILLIPY-FLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            STW+AT VQTAGFPIL IP  FL PS K ++ +S+     PSI  V  +YF
Sbjct  61   STWMATFVQTAGFPILCIPLIFLHPSQKLETSTSS---TYPSIKIVALLYF  108



>ref|XP_006464373.1| PREDICTED: probable purine permease 11-like isoform X1 [Citrus 
sinensis]
Length=381

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQNPLM-KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKG  329
             +A+NE P+++ +  ++ Q+PL  KLK + +W+L+ +N+ FL+ GQAAA+ILGR YYD+G
Sbjct  18   AVADNEEPMIIDKYLTN-QSPLFRKLKSWQWWVLVVVNIFFLIAGQAAAVILGRYYYDQG  76

Query  330  GNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
            GNS WLATLVQTA FPIL IP FL+P+ +E S SS  P 
Sbjct  77   GNSKWLATLVQTAAFPILYIPLFLLPASQEVSSSSRYPS  115



>ref|XP_008232299.1| PREDICTED: probable purine permease 11 isoform X2 [Prunus mume]
Length=368

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
             M +++  IL K++    Q   +KL R  +W ++ALN+ FL+VGQAAA++LGR YYD+GG
Sbjct  2    AMPDSQESILAKDETVIEQTQFVKLGRCQWWFMVALNIFFLIVGQAAAVLLGRFYYDQGG  61

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            NS W+ATLVQTA FP+LLIP + IPS K+ S SS   P  PSI  +  IYF
Sbjct  62   NSKWMATLVQTAAFPVLLIPLYFIPSSKDPSTSS--AP--PSIKVLALIYF  108



>ref|XP_011085324.1| PREDICTED: probable purine permease 11 isoform X1 [Sesamum indicum]
Length=357

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            MA+   PIL K+  S  Q+PL +LKR  +W+L+ LN+ FL+VGQAAA++LG  YY+KGGN
Sbjct  1    MADIREPILAKDGPSTYQHPLCRLKRSQWWILVVLNIIFLIVGQAAAVLLGWFYYNKGGN  60

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            S W+ATLVQ+AGFPILL+PYF +  P ++S       P P I+ ++ IY
Sbjct  61   SKWMATLVQSAGFPILLVPYFFL-HPSDES----HGLPTPPILTLSAIY  104



>ref|XP_008232298.1| PREDICTED: probable purine permease 11 isoform X1 [Prunus mume]
Length=376

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 8/119 (7%)
 Frame = +3

Query  141  TLHPPMAE----NETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILG  308
            +LH   +E    ++  IL K++    Q   +KL R  +W ++ALN+ FL+VGQAAA++LG
Sbjct  2    SLHKAESEWWRDSQESILAKDETVIEQTQFVKLGRCQWWFMVALNIFFLIVGQAAAVLLG  61

Query  309  RIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            R YYD+GGNS W+ATLVQTA FP+LLIP + IPS K+ S SS   P  PSI  +  IYF
Sbjct  62   RFYYDQGGNSKWMATLVQTAAFPVLLIPLYFIPSSKDPSTSS--AP--PSIKVLALIYF  116



>ref|XP_008355645.1| PREDICTED: probable purine permease 11 [Malus domestica]
Length=368

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
             M +++  IL KE+    Q   +KL R+ +W L+ LNV FL+VGQ AA++LGR YYD+GG
Sbjct  2    AMPDSQESILPKEETVIEQTLFVKLGRWQWWFLVVLNVFFLIVGQTAAVLLGRFYYDQGG  61

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            NS WLATLVQTA FP+LLIP + +PS K+ + +SN P      IKV  + +F
Sbjct  62   NSKWLATLVQTAAFPVLLIPLYFLPSSKDHATTSNPPS-----IKVLALVYF  108



>gb|EYU40318.1| hypothetical protein MIMGU_mgv1a008679mg [Erythranthe guttata]
Length=365

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  183  VKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQ  362
            V E D   Q+PL KLKR  +W+L+ LN+ FL+VGQAAA++LGR YYDKGGNS WLATLVQ
Sbjct  8    VMEKDGLYQHPLHKLKRTHWWILVVLNITFLIVGQAAAVLLGRFYYDKGGNSKWLATLVQ  67

Query  363  TAGFPILLIPYFLIPSPKE  419
            TA FPILLIPYF + S  E
Sbjct  68   TAAFPILLIPYFFLRSKNE  86



>ref|XP_011093479.1| PREDICTED: probable purine permease 11 [Sesamum indicum]
Length=400

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 4/115 (3%)
 Frame = +3

Query  141  TLHPPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYY  320
            T  P M +N+ P+  ++  S     L KLKR  +WLL+ LNV FLLVGQAAA++LGR YY
Sbjct  29   TYAPAMPDNQIPVPARDGPSTHLRTLWKLKRLHWWLLVVLNVFFLLVGQAAAVLLGRFYY  88

Query  321  DKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            DKGGNSTW+ATLVQTA FPILL+PY  +   +  +DS     P  S++ +  IYF
Sbjct  89   DKGGNSTWMATLVQTAAFPILLVPYSFL---RSSNDSPGLSAP-SSVLVLCSIYF  139



>emb|CBI16723.3| unnamed protein product [Vitis vinifera]
Length=294

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +3

Query  159  AENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNS  338
            A +  PIL K++    Q+  + LK + +WLL+ALN+ FL+ GQAAA++LGR YYDKGGNS
Sbjct  113  AVSAEPILSKDETLTRQSSFIGLKCWQWWLLVALNIFFLVAGQAAAVLLGRFYYDKGGNS  172

Query  339  TWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
             W+AT VQTA FPILLIP FLIPS KE S ++  PP
Sbjct  173  KWMATFVQTAAFPILLIPLFLIPSSKEPSTTT--PP  206



>ref|XP_002266773.1| PREDICTED: probable purine permease 11 isoform X1 [Vitis vinifera]
Length=374

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = +3

Query  159  AENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNS  338
            A +  PIL K++    Q+  + LK + +WLL+ALN+ FL+ GQAAA++LGR YYDKGGNS
Sbjct  9    AVSAEPILSKDETLTRQSSFIGLKCWQWWLLVALNIFFLVAGQAAAVLLGRFYYDKGGNS  68

Query  339  TWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
             W+AT VQTA FPILLIP FLIPS KE S ++  PP
Sbjct  69   KWMATFVQTAAFPILLIPLFLIPSSKEPSTTT--PP  102



>ref|NP_001241384.1| uncharacterized protein LOC100819409 [Glycine max]
 gb|ACU23620.1| unknown [Glycine max]
 gb|KHN22137.1| Putative purine permease 11 [Glycine soja]
Length=362

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 7/110 (6%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +NE P++V    S+      K KR+ +W L+ L++ FL+VGQ+AA+ILGR YYD+GGN
Sbjct  1    MTDNEEPMIVPGSMSEL--AFNKYKRWQWWCLVTLSIAFLIVGQSAAVILGRFYYDQGGN  58

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+ATLVQTA FPIL IP F IPSP E S S++  PP+  I+    IYF
Sbjct  59   SKWMATLVQTAAFPILFIPLFTIPSPPEASTSAS--PPIKIIL---LIYF  103



>ref|XP_008364779.1| PREDICTED: probable purine permease 11 isoform X2 [Malus domestica]
Length=362

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
             M +++  IL ++     Q   +KL R+ +W L+ LNV FLLVGQ+AA++LGR YYD+GG
Sbjct  2    AMPDSQESILPRDGTVIEQTLFVKLGRWQWWFLVVLNVVFLLVGQSAAVLLGRFYYDQGG  61

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            NS WLATLVQTA FP+L IP +  PS KEQ+ SSN P      IKV  + +F
Sbjct  62   NSKWLATLVQTAAFPVLFIPLYFXPSSKEQATSSNPPS-----IKVLALVYF  108



>ref|XP_009339630.1| PREDICTED: probable purine permease 11 isoform X2 [Pyrus x bretschneideri]
Length=367

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 77/112 (69%), Gaps = 6/112 (5%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
             M +++  IL KE+    Q   +KL R+ +W L+ LNV FL+VGQ AA++LGR YYD+GG
Sbjct  2    AMPDSQESILPKEETVIEQTLFVKLGRWQWWFLVVLNVFFLIVGQTAAVLLGRFYYDQGG  61

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            NS WLATLVQTA FP+LLIP + +PS K+Q+ S+  PP     IKV  + +F
Sbjct  62   NSKWLATLVQTAAFPVLLIPLYFLPSSKDQATSN--PPS----IKVLALVYF  107



>gb|KDO85409.1| hypothetical protein CISIN_1g0170172mg, partial [Citrus sinensis]
Length=360

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 72/95 (76%), Gaps = 2/95 (2%)
 Frame = +3

Query  165  NETPILVKEDDSDTQNPLM-KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNST  341
            NE P+++ +  ++ Q+PL  KLK + +W+L+ +N+ FL+ GQAAA+ILGR YYD+GGNS 
Sbjct  1    NEEPMIIDKYLTN-QSPLFRKLKSWQWWVLVVVNIFFLIAGQAAAVILGRYYYDQGGNSK  59

Query  342  WLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
            WLATLVQTA FPIL IP FL+P+ +E S SS  P 
Sbjct  60   WLATLVQTAAFPILYIPLFLLPASQEVSSSSRYPS  94



>ref|XP_010092275.1| hypothetical protein L484_021136 [Morus notabilis]
 gb|EXB50909.1| hypothetical protein L484_021136 [Morus notabilis]
Length=389

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 74/108 (69%), Gaps = 4/108 (4%)
 Frame = +3

Query  162  ENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNST  341
            +N+ PIL K++ S  Q    K+KR+ +W L++LNV FLLVGQAAA+ILGR YYD+GGNS 
Sbjct  27   DNQEPILSKDETSTHQILFAKVKRWQWWCLVSLNVIFLLVGQAAAVILGRFYYDQGGNSK  86

Query  342  WLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            W+ATLVQTA FP+L +  F +PS +    SS      PSI  +  IYF
Sbjct  87   WMATLVQTAAFPLLYLSLFFLPSSQHSLTSSGA----PSIKILASIYF  130



>ref|XP_010661433.1| PREDICTED: probable purine permease 11 isoform X2 [Vitis vinifera]
Length=373

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M  +  PIL K++    Q+  + LK + +WLL+ALN+ FL+ GQAAA++LGR YYDKGGN
Sbjct  7    MPVSAEPILSKDETLTRQSSFIGLKCWQWWLLVALNIFFLVAGQAAAVLLGRFYYDKGGN  66

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
            S W+AT VQTA FPILLIP FLIPS KE S ++  PP
Sbjct  67   SKWMATFVQTAAFPILLIPLFLIPSSKEPSTTT--PP  101



>ref|XP_011085333.1| PREDICTED: probable purine permease 11 isoform X2 [Sesamum indicum]
Length=357

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +   PIL K+  S  Q+PL +LKR  +W+L+ LN+ FL+VGQAAA++LG  YY+KGGN
Sbjct  1    MLDIREPILAKDGPSTYQHPLCRLKRSQWWILVVLNIIFLIVGQAAAVLLGWFYYNKGGN  60

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            S W+ATLVQ+AGFPILL+PYF +  P ++S       P P I+ ++ IY
Sbjct  61   SKWMATLVQSAGFPILLVPYFFL-HPSDES----HGLPTPPILTLSAIY  104



>ref|XP_008364778.1| PREDICTED: probable purine permease 11 isoform X1 [Malus domestica]
Length=370

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = +3

Query  162  ENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNST  341
            +++  IL ++     Q   +KL R+ +W L+ LNV FLLVGQ+AA++LGR YYD+GGNS 
Sbjct  13   DSQESILPRDGTVIEQTLFVKLGRWQWWFLVVLNVVFLLVGQSAAVLLGRFYYDQGGNSK  72

Query  342  WLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            WLATLVQTA FP+L IP +  PS KEQ+ SSN P      IKV  + +F
Sbjct  73   WLATLVQTAAFPVLFIPLYFXPSSKEQATSSNPPS-----IKVLALVYF  116



>ref|XP_009339629.1| PREDICTED: probable purine permease 11 isoform X1 [Pyrus x bretschneideri]
Length=375

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 76/109 (70%), Gaps = 6/109 (6%)
 Frame = +3

Query  162  ENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNST  341
            +++  IL KE+    Q   +KL R+ +W L+ LNV FL+VGQ AA++LGR YYD+GGNS 
Sbjct  13   DSQESILPKEETVIEQTLFVKLGRWQWWFLVVLNVFFLIVGQTAAVLLGRFYYDQGGNSK  72

Query  342  WLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            WLATLVQTA FP+LLIP + +PS K+Q+ S+  PP     IKV  + +F
Sbjct  73   WLATLVQTAAFPVLLIPLYFLPSSKDQATSN--PPS----IKVLALVYF  115



>emb|CAN78594.1| hypothetical protein VITISV_020513 [Vitis vinifera]
Length=475

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            +A +  PIL K++    Q+  + LK + +WLL+ALN+ FLL GQAAA++LGR YYDKGGN
Sbjct  36   LALSADPILSKDETLTRQSSFIGLKCWQWWLLVALNIFFLLAGQAAAVLLGRFYYDKGGN  95

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
            S W+AT VQTA FPILLIP FLIPS KE S ++  PP
Sbjct  96   SKWMATFVQTAAFPILLIPLFLIPSSKEPSTTT--PP  130



>ref|XP_007052418.1| Purine permease 11 isoform 2 [Theobroma cacao]
 gb|EOX96575.1| Purine permease 11 isoform 2 [Theobroma cacao]
Length=351

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 4/93 (4%)
 Frame = +3

Query  207  QNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILL  386
            Q P +KLKR+ +WLL+A+N+ FL+ GQAAA++LGR YYD+GG S W+ATLVQTAGFPIL 
Sbjct  3    QTPFLKLKRWQWWLLVAMNIFFLIAGQAAAVLLGRFYYDQGGKSKWMATLVQTAGFPILC  62

Query  387  IPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
             P+FL+   +E S S+      PSI  +  +YF
Sbjct  63   FPFFLLRPSRESSASTTS----PSIKTLALLYF  91



>ref|XP_007218138.1| hypothetical protein PRUPE_ppa007245mg [Prunus persica]
 gb|EMJ19337.1| hypothetical protein PRUPE_ppa007245mg [Prunus persica]
Length=368

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 76/111 (68%), Gaps = 4/111 (4%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
             M +++  IL K++    Q   +KL R  +W ++ALN+ FL+VGQAAA++LGR YYD+GG
Sbjct  2    AMPDSQESILPKDETVIEQTQFVKLGRCQWWFMVALNIFFLIVGQAAAVLLGRFYYDRGG  61

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            NS W+ATLVQTA FP+LLIP + IPS K+   SS   P  PSI  +  IYF
Sbjct  62   NSKWMATLVQTAAFPVLLIPLYFIPSSKDPLTSS--AP--PSIKVLALIYF  108



>gb|KJB51291.1| hypothetical protein B456_008G210300 [Gossypium raimondii]
Length=326

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = +3

Query  207  QNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILL  386
            ++P +KLKR+ +WLL+A+N+ FL+ GQAAA++LGR YYDKGGNS  +ATLVQTAGFP+L 
Sbjct  3    ESPFLKLKRWQWWLLVAINIYFLIAGQAAAVLLGRFYYDKGGNSKCMATLVQTAGFPVLC  62

Query  387  IPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            IP+FL+   +E S SS      PSI  +  +YF
Sbjct  63   IPWFLLHPSREASTSSTS----PSIKTLALLYF  91



>ref|XP_007218139.1| hypothetical protein PRUPE_ppa007245mg [Prunus persica]
 gb|EMJ19338.1| hypothetical protein PRUPE_ppa007245mg [Prunus persica]
Length=376

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 79/119 (66%), Gaps = 8/119 (7%)
 Frame = +3

Query  141  TLHPPMAE----NETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILG  308
            +LH   +E    ++  IL K++    Q   +KL R  +W ++ALN+ FL+VGQAAA++LG
Sbjct  2    SLHKAESEWWRDSQESILPKDETVIEQTQFVKLGRCQWWFMVALNIFFLIVGQAAAVLLG  61

Query  309  RIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            R YYD+GGNS W+ATLVQTA FP+LLIP + IPS K+   SS   P  PSI  +  IYF
Sbjct  62   RFYYDRGGNSKWMATLVQTAAFPVLLIPLYFIPSSKDPLTSS--AP--PSIKVLALIYF  116



>ref|XP_006602851.1| PREDICTED: probable purine permease 11-like isoform X2 [Glycine 
max]
Length=362

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 74/110 (67%), Gaps = 7/110 (6%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M ++E P++V    S+      K KR+ +W L+ L++ FL+VGQ+AA+ILGR YYD+GGN
Sbjct  1    MTDSEEPMIVPGTMSEL--AFNKYKRWQWWCLVTLSIAFLIVGQSAAVILGRFYYDQGGN  58

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+ATLVQTA FPIL IP F IPSP E S S++      SI  +  IYF
Sbjct  59   SKWMATLVQTAAFPILFIPLFTIPSPPEASTSAS-----SSIKIILLIYF  103



>gb|KDP20127.1| hypothetical protein JCGZ_05896 [Jatropha curcas]
Length=385

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 79/112 (71%), Gaps = 4/112 (4%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
             + +N+  I  K++++  ++PLMKLK + +WLL+A+N+ FL+VGQ+AA++LGR YYD+GG
Sbjct  18   SVKDNQGTITDKDENTSAKSPLMKLKHWQWWLLVAINIFFLVVGQSAAVLLGRFYYDEGG  77

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            NSTW+ATLVQT  FPIL IP FL+     +S   +     PSI  +  IYFF
Sbjct  78   NSTWMATLVQTVAFPILYIPLFLLS----RSQKPSTSSTSPSIRTLALIYFF  125



>ref|XP_006464375.1| PREDICTED: probable purine permease 11-like isoform X3 [Citrus 
sinensis]
 ref|XP_006464376.1| PREDICTED: probable purine permease 11-like isoform X4 [Citrus 
sinensis]
 ref|XP_006464377.1| PREDICTED: probable purine permease 11-like isoform X5 [Citrus 
sinensis]
Length=356

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +3

Query  207  QNPLM-KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPIL  383
            Q+PL  KLK + +W+L+ +N+ FL+ GQAAA+ILGR YYD+GGNS WLATLVQTA FPIL
Sbjct  10   QSPLFRKLKSWQWWVLVVVNIFFLIAGQAAAVILGRYYYDQGGNSKWLATLVQTAAFPIL  69

Query  384  LIPYFLIPSPKEQSDSSNQPP  446
             IP FL+P+ +E S SS  P 
Sbjct  70   YIPLFLLPASQEVSSSSRYPS  90



>ref|XP_007139692.1| hypothetical protein PHAVU_008G051100g [Phaseolus vulgaris]
 gb|ESW11686.1| hypothetical protein PHAVU_008G051100g [Phaseolus vulgaris]
Length=396

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 75/110 (68%), Gaps = 7/110 (6%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            MA++E P++     S+      K KR+ +W L+AL +GFL++GQ AA+ILGR YYD+GGN
Sbjct  35   MADSEEPMIAPGTISEL--AFNKYKRWQWWFLVALCIGFLIIGQCAAVILGRFYYDQGGN  92

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+ATLVQTA FP+L IP + IP+P E S S++     PSI  +  IYF
Sbjct  93   SKWMATLVQTAAFPLLFIPLYTIPAPAEASTSAS-----PSIKIILLIYF  137



>ref|XP_003624233.1| hypothetical protein MTR_7g080750 [Medicago truncatula]
 gb|AES80451.1| purine permease [Medicago truncatula]
Length=352

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 75/110 (68%), Gaps = 5/110 (5%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +NE P+++    ++   P  K KR+ +W L+ L++ FL+VGQ+AA+ILGR YYD+GGN
Sbjct  1    MTDNEEPMIIAGTINEL--PFNKYKRWQWWFLVGLSIMFLIVGQSAAVILGRFYYDQGGN  58

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            STW+ATLVQT  FP+LLIP F IPS   +  +S  P   PSI  +  IYF
Sbjct  59   STWMATLVQTIAFPVLLIPLFTIPSSSSEVSASYVP---PSIKLIALIYF  105



>ref|XP_003551696.2| PREDICTED: probable purine permease 11-like isoform X1 [Glycine 
max]
Length=365

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 7/107 (7%)
 Frame = +3

Query  165  NETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTW  344
            +E P++V    S+      K KR+ +W L+ L++ FL+VGQ+AA+ILGR YYD+GGNS W
Sbjct  7    SEEPMIVPGTMSEL--AFNKYKRWQWWCLVTLSIAFLIVGQSAAVILGRFYYDQGGNSKW  64

Query  345  LATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            +ATLVQTA FPIL IP F IPSP E S S++      SI  +  IYF
Sbjct  65   MATLVQTAAFPILFIPLFTIPSPPEASTSAS-----SSIKIILLIYF  106



>ref|XP_002526505.1| ATPUP11, putative [Ricinus communis]
 gb|EEF35896.1| ATPUP11, putative [Ricinus communis]
Length=366

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +N+ PIL K++ + T++  +KLK + +WLL+A+N+ FL+ GQ+AA++LGR YYDKGGN
Sbjct  1    MTDNQEPILNKDEAATTRSSFLKLKLWQWWLLVAINISFLVAGQSAAVLLGRFYYDKGGN  60

Query  336  STWLATLVQTAGFPILLIPYFLI  404
            S WLATLVQTA FP+L +P  L+
Sbjct  61   SKWLATLVQTAAFPVLYVPLCLL  83



>gb|AFK45074.1| unknown [Lotus japonicus]
Length=364

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +NE P+++    S+   P  K KR+ +W ++AL++ FL++GQ+AA+ILGR YYD+GGN
Sbjct  1    MTDNEEPMILAGPSSEL--PFDKYKRWQWWFMVALSIAFLIIGQSAAVILGRFYYDQGGN  58

Query  336  STWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            S W+ATLVQTA FPIL IP+F IPS  E S +S+ PP    I+    IYF
Sbjct  59   SKWIATLVQTAAFPILFIPFFAIPSSSEAS-TSSAPPSFKVIV---LIYF  104



>ref|XP_011469542.1| PREDICTED: probable purine permease 11 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=373

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 6/113 (5%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            P+ +++  I  K +       L+KL R+ +W L+A+N+ FLLVGQAAA++LGR YYD+GG
Sbjct  10   PLIDSQEAIPSKNEIVMDPTLLIKLGRWQWWFLVAINIFFLLVGQAAAVLLGRFYYDQGG  69

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKV-TXIYFF  488
            NS W+ATLVQTA FP+L+IP + +PS K+QS SS    P     KV   IYFF
Sbjct  70   NSKWMATLVQTAAFPVLVIPLYFLPSQKDQSTSSTSSSP-----KVLALIYFF  117



>ref|XP_011469543.1| PREDICTED: probable purine permease 11 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=363

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 69/92 (75%), Gaps = 6/92 (7%)
 Frame = +3

Query  216  LMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPY  395
            L+KL R+ +W L+A+N+ FLLVGQAAA++LGR YYD+GGNS W+ATLVQTA FP+L+IP 
Sbjct  21   LIKLGRWQWWFLVAINIFFLLVGQAAAVLLGRFYYDQGGNSKWMATLVQTAAFPVLVIPL  80

Query  396  FLIPSPKEQSDSSNQPPPLPSIIKV-TXIYFF  488
            + +PS K+QS SS    P     KV   IYFF
Sbjct  81   YFLPSQKDQSTSSTSSSP-----KVLALIYFF  107



>ref|XP_006305130.1| hypothetical protein CARUB_v10009499mg [Capsella rubella]
 gb|EOA38028.1| hypothetical protein CARUB_v10009499mg [Capsella rubella]
Length=369

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = +3

Query  156  MAENETPILVKEDDS-DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            M+ N+ PILVKE+       PL+KLK + +W+L+++N+ FL+ GQAA+++LGR YYD+GG
Sbjct  1    MSGNQEPILVKEESVVGLPIPLLKLKSWQWWVLVSVNIFFLIGGQAASVLLGRFYYDQGG  60

Query  333  NSTWLATLVQTAGFPILLIPYFLI  404
            NS W+ATLVQTA FP+L IP  L+
Sbjct  61   NSKWMATLVQTAAFPVLYIPLLLL  84



>gb|KDO85410.1| hypothetical protein CISIN_1g0170172mg, partial [Citrus sinensis]
Length=320

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
            QAAA+ILGR YYD+GGNS WLATLVQTA FPIL IP FL+P+ +E S SS  P 
Sbjct  1    QAAAVILGRYYYDQGGNSKWLATLVQTAAFPILYIPLFLLPASQEVSSSSRYPS  54



>ref|XP_006445485.1| hypothetical protein CICLE_v10020615mg [Citrus clementina]
 gb|ESR58725.1| hypothetical protein CICLE_v10020615mg [Citrus clementina]
Length=323

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
            QAAA+ILGR YYD+GGNS WLATLVQTA FPIL IP FL+P+ +E S SS  P 
Sbjct  4    QAAAVILGRYYYDQGGNSKWLATLVQTAAFPILYIPLFLLPASQEVSSSSRYPS  57



>ref|XP_006445483.1| hypothetical protein CICLE_v10020615mg [Citrus clementina]
 gb|ESR58723.1| hypothetical protein CICLE_v10020615mg [Citrus clementina]
Length=339

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
            QAAA+ILGR YYD+GGNS WLATLVQTA FPIL IP FL+P+ +E S SS  P 
Sbjct  20   QAAAVILGRYYYDQGGNSKWLATLVQTAAFPILYIPLFLLPASQEVSSSSRYPS  73



>emb|CDY54350.1| BnaA09g53790D [Brassica napus]
Length=332

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +3

Query  162  ENETPILVKEDDSDTQNPL---MKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            E E+ +L +ED++  +  L   MKLKR  +W+ +++++ FL+  QA A++LGR YYD+GG
Sbjct  14   EEESFLLKEEDEASNEEVLPQIMKLKRSQWWIFVSISIFFLISAQAVAVLLGRFYYDQGG  73

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQ  440
            NS W++TLVQT GFPIL +P  L+P+    S  S +
Sbjct  74   NSKWISTLVQTVGFPILYLPLCLLPASPHTSYCSCK  109



>ref|NP_567339.1| putative purine permease 13 [Arabidopsis thaliana]
 sp|Q8RY83.1|PUP13_ARATH RecName: Full=Probable purine permease 13; Short=AtPUP13 [Arabidopsis 
thaliana]
 gb|AAL69503.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20108.1| unknown protein [Arabidopsis thaliana]
 gb|AAM65397.1| purine permease-like protein [Arabidopsis thaliana]
 gb|AEE82672.1| putative purine permease 13 [Arabidopsis thaliana]
Length=361

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 63/90 (70%), Gaps = 5/90 (6%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQ-----NPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYY  320
            M E E  +L+KE+D  T+       LMKLKR  +W+L+ +++ FL+  QA A++LGR YY
Sbjct  1    MDEEEAMLLLKEEDEGTRRTSVPTQLMKLKRTHWWILVFISIFFLISAQAIAVLLGRFYY  60

Query  321  DKGGNSTWLATLVQTAGFPILLIPYFLIPS  410
            ++GGNS W++TLVQT GFPIL +P   +P+
Sbjct  61   NEGGNSKWISTLVQTCGFPILYLPLCFLPA  90



>ref|XP_010056477.1| PREDICTED: probable purine permease 11 isoform X2 [Eucalyptus 
grandis]
 gb|KCW73240.1| hypothetical protein EUGRSUZ_E01707 [Eucalyptus grandis]
 gb|KCW73241.1| hypothetical protein EUGRSUZ_E01707 [Eucalyptus grandis]
Length=389

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 65/89 (73%), Gaps = 4/89 (4%)
 Frame = +3

Query  147  HPPMAENETPILVKEDDSDTQNPL--MKLKRFDFWlllalnvgfllvgQAAAIILGRIYY  320
            +  + ++E PI+   DD    N L  +KL+R  +WLL+ +N+ FL+ GQA+A++LGR YY
Sbjct  21   YCKVGDHEEPIM--SDDGPLANDLHLLKLERCRWWLLVVVNIFFLVAGQASAVLLGRFYY  78

Query  321  DKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            D+GGNS WL+TLVQTA FPIL IP FLIP
Sbjct  79   DQGGNSKWLSTLVQTAAFPILFIPLFLIP  107



>ref|XP_010056475.1| PREDICTED: probable purine permease 11 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010056476.1| PREDICTED: probable purine permease 11 isoform X1 [Eucalyptus 
grandis]
Length=399

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 65/89 (73%), Gaps = 4/89 (4%)
 Frame = +3

Query  147  HPPMAENETPILVKEDDSDTQNPL--MKLKRFDFWlllalnvgfllvgQAAAIILGRIYY  320
            +  + ++E PI+   DD    N L  +KL+R  +WLL+ +N+ FL+ GQA+A++LGR YY
Sbjct  31   YCKVGDHEEPIM--SDDGPLANDLHLLKLERCRWWLLVVVNIFFLVAGQASAVLLGRFYY  88

Query  321  DKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            D+GGNS WL+TLVQTA FPIL IP FLIP
Sbjct  89   DQGGNSKWLSTLVQTAAFPILFIPLFLIP  117



>ref|XP_009113499.1| PREDICTED: probable purine permease 13 [Brassica rapa]
Length=415

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +3

Query  162  ENETPILVKEDDSDTQNPL---MKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            E E+ +L +ED++  +  L   MKLKR  +W+ +++++ FL+  QA A++LGR YYD+GG
Sbjct  60   EEESFLLKEEDEASNEEVLPQIMKLKRSQWWIFVSISIFFLISAQAVAVLLGRFYYDQGG  119

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSS  434
            NS W++TLVQT GFPIL +P  L+P+    S  S
Sbjct  120  NSKWISTLVQTVGFPILYLPLCLLPASPHTSYCS  153



>ref|XP_004492882.1| PREDICTED: probable purine permease 11-like isoform X1 [Cicer 
arietinum]
Length=369

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            P+ +NE P+++    ++   P  K KR+ +W L+ L++ FL+VGQ+AA+ILGR YYD+GG
Sbjct  4    PITDNEEPMIIAGKIAEL--PFNKYKRWQWWFLVGLSILFLIVGQSAAVILGRFYYDQGG  61

Query  333  NSTWLATLVQTAGFPILLIPYFLI  404
            NSTW+ATLVQT  FPIL IP F I
Sbjct  62   NSTWMATLVQTIAFPILFIPLFTI  85



>emb|CDX75141.1| BnaC09g25410D [Brassica napus]
Length=332

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +3

Query  162  ENETPILVKEDDSDTQNPL---MKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            E E+ +L +ED++ ++  L   M LKR  +W+ + +++ FL+  QA A++LGR YYD+GG
Sbjct  14   EEESFLLKEEDEASSEEVLPQIMHLKRSQWWIFVFISIFFLISAQAVAVLLGRFYYDQGG  73

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSS  434
            NS W++TLVQT GFPIL +P  L+P+    S  S
Sbjct  74   NSKWISTLVQTVGFPILYLPLCLLPASPRTSYCS  107



>ref|XP_004492883.1| PREDICTED: probable purine permease 11-like isoform X2 [Cicer 
arietinum]
Length=365

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGN  335
            M +NE P+++    ++   P  K KR+ +W L+ L++ FL+VGQ+AA+ILGR YYD+GGN
Sbjct  1    MTDNEEPMIIAGKIAEL--PFNKYKRWQWWFLVGLSILFLIVGQSAAVILGRFYYDQGGN  58

Query  336  STWLATLVQTAGFPILLIPYFLI  404
            STW+ATLVQT  FPIL IP F I
Sbjct  59   STWMATLVQTIAFPILFIPLFTI  81



>ref|XP_010056479.1| PREDICTED: probable purine permease 11 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010056480.1| PREDICTED: probable purine permease 11 isoform X3 [Eucalyptus 
grandis]
 gb|KCW73242.1| hypothetical protein EUGRSUZ_E01707 [Eucalyptus grandis]
Length=358

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = +3

Query  189  EDDSDTQNPL--MKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQ  362
             DD    N L  +KL+R  +WLL+ +N+ FL+ GQA+A++LGR YYD+GGNS WL+TLVQ
Sbjct  2    SDDGPLANDLHLLKLERCRWWLLVVVNIFFLVAGQASAVLLGRFYYDQGGNSKWLSTLVQ  61

Query  363  TAGFPILLIPYFLIP  407
            TA FPIL IP FLIP
Sbjct  62   TAAFPILFIPLFLIP  76



>ref|XP_006287993.1| hypothetical protein CARUB_v10001226mg [Capsella rubella]
 gb|EOA20891.1| hypothetical protein CARUB_v10001226mg [Capsella rubella]
Length=366

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 61/87 (70%), Gaps = 5/87 (6%)
 Frame = +3

Query  162  ENETPILVKEDDSDTQ-----NPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDK  326
            E    +L+KE+D  T+       L+KLKR  +W+L+ +++ FL+  QA A++LGR YY++
Sbjct  5    EVVALLLLKEEDEVTRRTSVPTQLLKLKRTHWWVLVFISIFFLISAQAIAVLLGRFYYNE  64

Query  327  GGNSTWLATLVQTAGFPILLIPYFLIP  407
            GGNS W++TLVQT GFPIL IP  L+P
Sbjct  65   GGNSKWISTLVQTCGFPILYIPLCLLP  91



>ref|XP_009400212.1| PREDICTED: probable purine permease 11 [Musa acuminata subsp. 
malaccensis]
Length=374

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 8/84 (10%)
 Frame = +3

Query  213  PLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIP  392
            P  +L+ + +W ++ALN+ FLL GQ AA +LGR YYD+GGNS W+ATLVQTAGFPIL +P
Sbjct  27   PSSRLRSWQWWFIVALNIFFLLAGQTAATLLGRFYYDQGGNSKWMATLVQTAGFPILCLP  86

Query  393  YFLIPSPKEQSDSSNQPPPLPSII  464
             FL P        S  PPP  SII
Sbjct  87   LFLFP--------STHPPPATSII  102



>ref|XP_006397268.1| hypothetical protein EUTSA_v10028661mg [Eutrema salsugineum]
 gb|ESQ38721.1| hypothetical protein EUTSA_v10028661mg [Eutrema salsugineum]
Length=442

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 60/81 (74%), Gaps = 3/81 (4%)
 Frame = +3

Query  177  ILVKEDD---SDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWL  347
            +L+KE+D   S  +  LMKLKR  +WL + +++ FL+  QA A++LGR YY++GGNS W+
Sbjct  91   MLIKEEDEGSSQVRPQLMKLKRSQWWLFVFISIFFLISAQAVAVLLGRFYYNEGGNSKWI  150

Query  348  ATLVQTAGFPILLIPYFLIPS  410
            +TLVQT GFPIL +P  L+P+
Sbjct  151  STLVQTVGFPILYLPLCLLPA  171



>ref|XP_006393716.1| hypothetical protein EUTSA_v10011581mg [Eutrema salsugineum]
 gb|ESQ31002.1| hypothetical protein EUTSA_v10011581mg [Eutrema salsugineum]
Length=372

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +3

Query  150  PPMAENETPILVKEDDSDTQ-NPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDK  326
              M++N+ PILVKE+  +   +PL+KLK + +W+L+++N+ FL+ GQAA+++LGR YYD+
Sbjct  2    SSMSDNQEPILVKEESVEGIPSPLLKLKSWQWWVLVSINIFFLIGGQAASVLLGRFYYDE  61

Query  327  GGNSTWLATLVQTAGF  374
            GGNS W+ATLVQTA F
Sbjct  62   GGNSKWMATLVQTAAF  77



>ref|XP_010680002.1| PREDICTED: probable purine permease 11 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680070.1| PREDICTED: probable purine permease 11 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680126.1| PREDICTED: probable purine permease 11 [Beta vulgaris subsp. 
vulgaris]
Length=380

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 65/94 (69%), Gaps = 5/94 (5%)
 Frame = +3

Query  168  ETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWL  347
            + PIL +    +  +P ++L R  +W+LLA+N+ F+++GQ AAI+L R YY +GG+S ++
Sbjct  8    QNPILTRVRTQNEVSPFLRLTRKRWWILLAVNIAFVVLGQTAAILLARFYYAEGGSSMFV  67

Query  348  ATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPP  449
            ATLVQTAGFP+L IP  LIP P     +S  PPP
Sbjct  68   ATLVQTAGFPVLCIPLILIPLP-----ASTSPPP  96



>emb|CAB77995.1| putative protein [Arabidopsis thaliana]
 emb|CAB82106.1| putative protein [Arabidopsis thaliana]
Length=432

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 5/83 (6%)
 Frame = +3

Query  177  ILVKEDDSDTQ-----NPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNST  341
            +L+KE+D  T+       LMKLKR  +W+L+ +++ FL+  QA A++LGR YY++GGNS 
Sbjct  2    LLLKEEDEGTRRTSVPTQLMKLKRTHWWILVFISIFFLISAQAIAVLLGRFYYNEGGNSK  61

Query  342  WLATLVQTAGFPILLIPYFLIPS  410
            W++TLVQT GFPIL +P   +P+
Sbjct  62   WISTLVQTCGFPILYLPLCFLPA  84



>gb|KFK32117.1| hypothetical protein AALP_AA6G200500 [Arabis alpina]
Length=359

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 4/79 (5%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQN---PLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDK  326
            M E ET +LVKE+  +T      L+KLKR  +W+L+ +++ FL+  QA A++LGR YYDK
Sbjct  1    MDEEET-MLVKEEGEETIIVLPQLLKLKRSQWWILVFISIFFLISAQAVAVLLGRFYYDK  59

Query  327  GGNSTWLATLVQTAGFPIL  383
            GGNS W++TLVQT GFPIL
Sbjct  60   GGNSKWISTLVQTGGFPIL  78



>ref|XP_009775648.1| PREDICTED: probable purine permease 8 isoform X2 [Nicotiana sylvestris]
Length=334

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 76/128 (59%), Gaps = 16/128 (13%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQN---PLMKLK-------RFDFWlllalnvgfllvgQAAAII  302
             +AE +  I ++E+  +T+N   P++K +       ++  WL + ++   +L  Q+ A I
Sbjct  3    SVAEKQLDITIQEEAEETKNMETPIVKAQSLNPKADKYKKWLEIGIHTFIVLASQSVATI  62

Query  303  LGRIYYDKGGNSTWLATLVQTAGFPILLIP--YFLIPSPKEQSDSS----NQPPPLPSII  464
            LG++YY+KGGNSTWL++L QT GFPILLIP  ++   +PKE+   +    N     PSI+
Sbjct  63   LGKLYYNKGGNSTWLSSLTQTVGFPILLIPMIFWTKRTPKEEEGPTLRHINDDTKSPSIM  122

Query  465  KVTXIYFF  488
             +  +Y F
Sbjct  123  VLLSVYVF  130



>ref|XP_002874549.1| hypothetical protein ARALYDRAFT_351979 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50808.1| hypothetical protein ARALYDRAFT_351979 [Arabidopsis lyrata subsp. 
lyrata]
Length=250

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 58/82 (71%), Gaps = 5/82 (6%)
 Frame = +3

Query  177  ILVKEDD-----SDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNST  341
            +L+KE+D     +     LMKLKR  +W+L+ +++ FL+  QA  ++LGR YY++GGNS 
Sbjct  2    LLLKEEDEGRGRTSVPTQLMKLKRTQWWILVFISIFFLISAQAIGVLLGRFYYNEGGNSK  61

Query  342  WLATLVQTAGFPILLIPYFLIP  407
            W++TLVQT GFPIL +P  L+P
Sbjct  62   WISTLVQTCGFPILYLPLCLLP  83



>ref|XP_009775647.1| PREDICTED: probable purine permease 9 isoform X1 [Nicotiana sylvestris]
Length=407

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 76/128 (59%), Gaps = 16/128 (13%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQN---PLMKLK-------RFDFWlllalnvgfllvgQAAAII  302
             +AE +  I ++E+  +T+N   P++K +       ++  WL + ++   +L  Q+ A I
Sbjct  3    SVAEKQLDITIQEEAEETKNMETPIVKAQSLNPKADKYKKWLEIGIHTFIVLASQSVATI  62

Query  303  LGRIYYDKGGNSTWLATLVQTAGFPILLIP--YFLIPSPKEQSDSS----NQPPPLPSII  464
            LG++YY+KGGNSTWL++L QT GFPILLIP  ++   +PKE+   +    N     PSI+
Sbjct  63   LGKLYYNKGGNSTWLSSLTQTVGFPILLIPMIFWTKRTPKEEEGPTLRHINDDTKSPSIM  122

Query  465  KVTXIYFF  488
             +  +Y F
Sbjct  123  VLLSVYVF  130



>ref|XP_010674209.1| PREDICTED: probable purine permease 11 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=369

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  174  PILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLAT  353
            PIL K+        L KL R+ +WLL+ LN+ FL+ GQ AA++LGR YYD+GG+ST LAT
Sbjct  9    PILAKDGPQSMIPMLFKLNRWQWWLLVGLNIFFLVAGQTAAVLLGRFYYDQGGSSTLLAT  68

Query  354  LVQTAGFPILLIPYFLIPS  410
            LVQTAGFPIL IP   +P+
Sbjct  69   LVQTAGFPILFIPLIFLPA  87



>ref|XP_006358606.1| PREDICTED: probable purine permease 11-like [Solanum tuberosum]
Length=379

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = +3

Query  186  KEDDSDTQNPLMKLKR----FDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLAT  353
            ++DD+   N   ++ R    + +W  + L + FLLVGQ+AA +LGR YYD+GGNS W+AT
Sbjct  21   EDDDTINTNQQQQISRSNKHYGWWFRIFLYIIFLLVGQSAATLLGRFYYDEGGNSKWMAT  80

Query  354  LVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
             VQ+AGFPILL  +FL  S K  + SS + P   S+     IY F
Sbjct  81   FVQSAGFPILLPLFFLFKSSKNTAFSSREKPSKSSLF---LIYLF  122



>gb|KDO38041.1| hypothetical protein CISIN_1g0167861mg, partial [Citrus sinensis]
Length=302

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = +3

Query  150  PPMAENETPILVKEDDS------DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGR  311
            PP  + +T +  +E DS      + Q   +KLK + +WL + L V  LLVGQ+AA +LGR
Sbjct  4    PPALQLQTRVNDRELDSHIDTSMNQQWRFLKLKHYKWWLRVILYVVCLLVGQSAATLLGR  63

Query  312  IYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
            +YYDKGGNS W+AT VQ+AGFPILL P     S   +S ++  P 
Sbjct  64   LYYDKGGNSKWMATFVQSAGFPILL-PILCCFSNGSRSANTTDPK  107



>ref|XP_009421222.1| PREDICTED: probable purine permease 11 [Musa acuminata subsp. 
malaccensis]
Length=374

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 66/95 (69%), Gaps = 4/95 (4%)
 Frame = +3

Query  195  DSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGF  374
             ++T  P  KL+ + +WL++ALN+ FLL GQ   ++LGR+YY++GGNS W+AT+VQ+AGF
Sbjct  29   SNETPPPPSKLRHWRWWLMVALNICFLLAGQTVGVLLGRLYYNEGGNSKWMATVVQSAGF  88

Query  375  PILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXI  479
            P+L IP  L PSP   + +  +    PSI+KV  I
Sbjct  89   PVLFIPLLLYPSPPASTATVAR----PSIVKVAVI  119



>ref|NP_973972.1| purine permease 11 [Arabidopsis thaliana]
 gb|AEE32044.1| purine permease 11 [Arabidopsis thaliana]
Length=367

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  156  MAENETPILVKEDDS-DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            M+ N+ PILVKE+       PL+KLK + +W+L+++N+ FL+ GQAA+++LGR YYD+GG
Sbjct  1    MSGNQEPILVKEESVVGIPTPLLKLKSWQWWVLVSVNIFFLIGGQAASVLLGRFYYDEGG  60

Query  333  NSTWLATLVQTAGF  374
            NS W+ATLVQTA F
Sbjct  61   NSKWMATLVQTAAF  74



>ref|XP_010247689.1| PREDICTED: probable purine permease 11 [Nelumbo nucifera]
Length=385

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 60/97 (62%), Gaps = 12/97 (12%)
 Frame = +3

Query  186  KEDDSDTQNPLM-KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQ  362
            ++DD+   +PL+ +LK ++ W+ +      LL GQ AA +LGR+YYDKGG S W+AT+VQ
Sbjct  22   QKDDTINNHPLLSRLKHYNRWVRVIFYTLLLLSGQPAATLLGRLYYDKGGKSKWMATIVQ  81

Query  363  TAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVT  473
            +AGFPIL++P  L            Q  P  SIIK T
Sbjct  82   SAGFPILILPLCLF-----------QSSPANSIIKTT  107



>ref|XP_009123059.1| PREDICTED: probable purine permease 11 [Brassica rapa]
Length=365

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +3

Query  156  MAENETPILVKEDDSDTQ-NPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            M+ N+ PILVKE+  +   +PL+KLK + +W+L+++N+ FL+ GQAA+++LGR YY++GG
Sbjct  1    MSGNQEPILVKEESVEGIPSPLLKLKSWQWWVLVSINILFLIGGQAASVLLGRFYYEEGG  60

Query  333  NSTWLATLVQTAGF  374
            NS W+ATLVQTA F
Sbjct  61   NSKWMATLVQTAAF  74



>ref|XP_002519731.1| purine transporter, putative [Ricinus communis]
 gb|EEF42704.1| purine transporter, putative [Ricinus communis]
Length=381

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 60/86 (70%), Gaps = 2/86 (2%)
 Frame = +3

Query  225  LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLI  404
            LK + +WL +++ V FLL GQ AA ILGR+Y++KGGNS W+A  VQ AGFPI+L+ YFL 
Sbjct  33   LKNYKWWLKISIYVFFLLAGQTAATILGRLYFEKGGNSNWMAAFVQAAGFPIILLFYFLS  92

Query  405  PSPKEQSDSSNQPPPLPSIIKVTXIY  482
            P     ++S+++    PS +K+  IY
Sbjct  93   PLKTSAANSTDKTS--PSKLKLALIY  116



>gb|KFK36200.1| hypothetical protein AALP_AA4G090800 [Arabis alpina]
Length=366

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +3

Query  156  MAENETPILVKEDDS-DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            M++N+ PIL KE+      +PL+KLK + +WLL+++N+ FL+ GQAA+++LGR YYD+GG
Sbjct  1    MSDNQEPILAKEESVVGIPSPLLKLKSWQWWLLVSINIFFLIGGQAASVLLGRFYYDQGG  60

Query  333  NSTWLATLVQTAGF  374
            NS W+ATLVQTA F
Sbjct  61   NSKWMATLVQTAAF  74



>ref|XP_008677756.1| PREDICTED: uncharacterized protein LOC100502445 isoform X2 [Zea 
mays]
 ref|XP_008677757.1| PREDICTED: uncharacterized protein LOC100502445 isoform X2 [Zea 
mays]
 gb|AFW63439.1| hypothetical protein ZEAMMB73_545150 [Zea mays]
Length=384

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 71/115 (62%), Gaps = 7/115 (6%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYD  323
            +H  +A +  P     +++  QN     K + +WL++ LN+ FL+ GQ A+ +LGR YY+
Sbjct  19   VHVQIAGSSKPETSSTNETAPQNS--HTKHWHWWLMVTLNIFFLVAGQTASTLLGRFYYN  76

Query  324  KGGNSTWLATLVQTAGFPILLIPYFLI--PSPKEQSDSSNQPPPLPSIIKVTXIY  482
            +GGNS W++T VQTAGFP+L +  +L    SP  Q+ +SN   P  S+ K+T IY
Sbjct  77   QGGNSKWMSTFVQTAGFPVLFVALYLFRSKSPSTQTTTSN---PETSVTKITLIY  128



>gb|KDO38040.1| hypothetical protein CISIN_1g0167861mg [Citrus sinensis]
Length=382

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = +3

Query  150  PPMAENETPILVKEDDS------DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGR  311
            PP  + +T +  +E DS      + Q   +KLK + +WL + L V  LLVGQ+AA +LGR
Sbjct  4    PPALQLQTRVNDRELDSHIDTSMNQQWRFLKLKHYKWWLRVILYVVCLLVGQSAATLLGR  63

Query  312  IYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPP  446
            +YYDKGGNS W+AT VQ+AGFPILL P     S   +S ++  P 
Sbjct  64   LYYDKGGNSKWMATFVQSAGFPILL-PILCCFSNGSRSANTTDPK  107



>ref|NP_175096.1| purine permease 11 [Arabidopsis thaliana]
 sp|Q9LPF6.1|PUP11_ARATH RecName: Full=Probable purine permease 11; Short=AtPUP11 [Arabidopsis 
thaliana]
 gb|AAF78258.1|AC020576_2 Contains similarity to purine permease from Arabidopsis thaliana 
gb|AF078531. EST gb|AI997301 comes from this gene [Arabidopsis 
thaliana]
 gb|AAL32860.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29976.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE32045.1| purine permease 11 [Arabidopsis thaliana]
Length=379

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +3

Query  141  TLHPPMAENETPILVKEDDS-DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIY  317
             L    A N+ PILVKE+       PL+KLK + +W+L+++N+ FL+ GQAA+++LGR Y
Sbjct  8    VLVTGAAGNQEPILVKEESVVGIPTPLLKLKSWQWWVLVSVNIFFLIGGQAASVLLGRFY  67

Query  318  YDKGGNSTWLATLVQTAGF  374
            YD+GGNS W+ATLVQTA F
Sbjct  68   YDEGGNSKWMATLVQTAAF  86



>ref|XP_010461445.1| PREDICTED: probable purine permease 11 [Camelina sativa]
Length=368

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  156  MAENETPILVKEDDS-DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            M+ N+ PILVKE+       PL+KLK + +W+L+++N+ FL+ GQAA+++LGR YYD+GG
Sbjct  1    MSGNQEPILVKEESVVGLPIPLLKLKSWQWWVLVSVNIFFLIGGQAASVLLGRFYYDQGG  60

Query  333  NSTWLATLVQTAGF  374
            NS W+ATLVQTA F
Sbjct  61   NSKWMATLVQTAAF  74



>ref|XP_010500152.1| PREDICTED: probable purine permease 11 [Camelina sativa]
Length=368

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  156  MAENETPILVKEDDS-DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            M+ N+ PILVKE+       PL+KLK + +W+L+++N+ FL+ GQAA+++LGR YYD+GG
Sbjct  1    MSGNQEPILVKEESVVGLPIPLLKLKSWQWWVLVSVNIFFLIGGQAASVLLGRFYYDQGG  60

Query  333  NSTWLATLVQTAGF  374
            NS W+ATLVQTA F
Sbjct  61   NSKWMATLVQTAAF  74



>ref|XP_010479053.1| PREDICTED: probable purine permease 11 [Camelina sativa]
Length=368

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  156  MAENETPILVKEDDS-DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            M+ N+ PILVKE+       PL+KLK + +W+L+++N+ FL+ GQAA+++LGR YYD+GG
Sbjct  1    MSGNQEPILVKEESVVGLPIPLLKLKSWQWWVLVSVNIFFLIGGQAASVLLGRFYYDQGG  60

Query  333  NSTWLATLVQTAGF  374
            NS W+ATLVQTA F
Sbjct  61   NSKWMATLVQTAAF  74



>ref|XP_006647707.1| PREDICTED: probable purine permease 11-like [Oryza brachyantha]
Length=386

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPS--PKEQSDSSNQPPPLPS  458
            Q AA +LGR YY++GGNS W++T +QTAGFP+L +P +L  S  P  Q+ ++N P P  S
Sbjct  64   QTAATLLGRFYYNQGGNSKWMSTFIQTAGFPVLFVPLYLFRSKMPSTQTATTN-PGPKTS  122

Query  459  IIKVTXIY  482
            + K+T IY
Sbjct  123  VTKLTLIY  130



>gb|KJB66914.1| hypothetical protein B456_010G164800 [Gossypium raimondii]
Length=371

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = +3

Query  126  ECRLFTLHPPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIIL  305
            E +L  L      NE  +  ++ + +    + + + + +WLL+ +   FLL GQ+ A +L
Sbjct  6    EIQLQVLSEDEKLNEDSV-EQQTNGNQSTTITQQRTYKWWLLMTIYTFFLLSGQSVATLL  64

Query  306  GRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            GR+YYDKGGNS WLAT+VQ  GFPI LIP + +PS K  S +SN     PS++ ++ +YF
Sbjct  65   GRLYYDKGGNSKWLATIVQVVGFPI-LIPLYYLPSYKS-SHTSNITTNPPSLLVLSGMYF  122



>gb|KHG13240.1| putative purine permease 9 -like protein [Gossypium arboreum]
Length=371

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 66/100 (66%), Gaps = 2/100 (2%)
 Frame = +3

Query  186  KEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQT  365
            ++ + +    + + + + +WLL+ +   FLL GQ+ A +LGR+YYDKGGNS WLAT+VQ 
Sbjct  25   QQTNGNQSTTITQQRTYKWWLLMTIYTFFLLSGQSVATLLGRLYYDKGGNSKWLATIVQV  84

Query  366  AGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
             GFPI LIP + +PS K  S +SN     PS++ ++ +YF
Sbjct  85   VGFPI-LIPLYYLPSYKS-SHTSNITTNPPSLLVLSGMYF  122



>gb|AFK38153.1| unknown [Lotus japonicus]
Length=364

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +3

Query  162  ENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNST  341
            + E P+++    S+   P  K KR+ +WL++ +++ FL++G++A +IL R YY++GG+S 
Sbjct  2    DKEEPVILAVTSSEL--PFDKYKRWQWWLMVTISITFLIIGESAVVILARFYYEQGGSSK  59

Query  342  WLATLVQTAGFPILLIPYFLIP  407
            W+ATLVQTA FPILLIP F IP
Sbjct  60   WMATLVQTAAFPILLIPLFSIP  81



>ref|XP_008677755.1| PREDICTED: uncharacterized protein LOC100502445 isoform X1 [Zea 
mays]
 gb|AFW63438.1| hypothetical protein ZEAMMB73_545150 [Zea mays]
Length=482

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 71/115 (62%), Gaps = 7/115 (6%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYD  323
            +H  +A +  P     +++  QN     K + +WL++ LN+ FL+ GQ A+ +LGR YY+
Sbjct  117  VHVQIAGSSKPETSSTNETAPQNS--HTKHWHWWLMVTLNIFFLVAGQTASTLLGRFYYN  174

Query  324  KGGNSTWLATLVQTAGFPILLIPYFLI--PSPKEQSDSSNQPPPLPSIIKVTXIY  482
            +GGNS W++T VQTAGFP+L +  +L    SP  Q+ +SN   P  S+ K+T IY
Sbjct  175  QGGNSKWMSTFVQTAGFPVLFVALYLFRSKSPSTQTTTSN---PETSVTKITLIY  226



>emb|CDP13405.1| unnamed protein product [Coffea canephora]
Length=385

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 2/90 (2%)
 Frame = +3

Query  192  DDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAG  371
              + TQ  L   K + +W  ++L +  LL GQ+AA +LGR+YYDKGGNS W+AT VQ+AG
Sbjct  27   STATTQQRLPTYKDYMWWFRVSLYIVSLLAGQSAATLLGRLYYDKGGNSKWMATFVQSAG  86

Query  372  FPILLIPYFLIPSPKEQSDSSNQPPPLPSI  461
            FP+LL P  L+     +S S+N PP  PSI
Sbjct  87   FPVLL-P-ILLYVQLSKSSSNNAPPKHPSI  114



>gb|EMT19164.1| hypothetical protein F775_05921 [Aegilops tauschii]
Length=390

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +3

Query  225  LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLI  404
            +K + +WL++ LN+ FL+ GQ +A +LGR YY++GGNS WL+T VQTAGFP+L I  FL 
Sbjct  50   VKHWQWWLMVVLNMFFLVAGQTSATLLGRFYYNEGGNSKWLSTFVQTAGFPVLFIAQFLF  109

Query  405  PSPKEQSDSSNQPPPLPSIIKVTXIY  482
              PK  S  +    P  SI K+T IY
Sbjct  110  -RPKSPSTQATTSGPEASITKITLIY  134



>ref|XP_006662363.1| PREDICTED: probable purine permease 11-like [Oryza brachyantha]
Length=378

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 62/93 (67%), Gaps = 4/93 (4%)
 Frame = +3

Query  204  TQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPIL  383
            TQN    +K + +W+++ +N+ FL+ GQ A+ +LGR YY++GGNS W++T VQTAGFP+L
Sbjct  34   TQNS--PVKSWQWWVMVGVNMFFLIAGQTASTLLGRFYYNQGGNSKWMSTFVQTAGFPVL  91

Query  384  LIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
             I  +L  S  +   ++  P P  SI K+T IY
Sbjct  92   FIALYLFRSSTQ--TTTTNPAPKTSITKITLIY  122



>dbj|BAJ95311.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=387

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +3

Query  225  LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLI  404
            +K + +WL++ LN+ FL+ GQ +A +LGR YY++GGNS W++T VQTAGFP+L +  FL 
Sbjct  47   VKHWQWWLMVVLNMFFLIAGQTSATLLGRFYYNEGGNSKWMSTFVQTAGFPVLFVAQFLF  106

Query  405  PSPKEQSDSSNQPPPLPSIIKVTXIY  482
              PK  S  +    P  SIIK+T IY
Sbjct  107  -RPKSPSTQAINSSPEASIIKITLIY  131



>ref|NP_198932.1| putative purine permease 12 [Arabidopsis thaliana]
 sp|Q9FLL4.1|PUP12_ARATH RecName: Full=Putative purine permease 12; Short=AtPUP12 [Arabidopsis 
thaliana]
 dbj|BAB09718.1| purine permease-like protein [Arabidopsis thaliana]
 gb|AED94649.1| putative purine permease 12 [Arabidopsis thaliana]
Length=358

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 5/83 (6%)
 Frame = +3

Query  177  ILVKEDDSDTQ-----NPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNST  341
            +L+KE+D   +       LMKL R  +W+L+ +++ FL+  QA +++LGR YY++GGNS 
Sbjct  2    LLLKEEDEGRRRTSVPTQLMKLNRSQWWILVFISIFFLISAQAISVLLGRFYYNEGGNSK  61

Query  342  WLATLVQTAGFPILLIPYFLIPS  410
            W++TLVQT GFPIL +P  L+P+
Sbjct  62   WISTLVQTGGFPILYLPLSLLPA  84



>gb|KDO41083.1| hypothetical protein CISIN_1g043307mg, partial [Citrus sinensis]
Length=248

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 70/118 (59%), Gaps = 9/118 (8%)
 Frame = +3

Query  150  PPMAENETPILVKEDDS------DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGR  311
             P  + +T +  +E DS      + Q   +KLK + +WL + L V  LLVGQ+AA +LGR
Sbjct  4    SPELQLQTRVNDRELDSHIDTSVNQQWRFLKLKHYKWWLRVILYVVCLLVGQSAATLLGR  63

Query  312  IYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            +YYDKGGNS W+AT VQ+AGFPILL P  ++      S S+N+  P  S +    + F
Sbjct  64   LYYDKGGNSKWMATFVQSAGFPILL-P--VLCCFSNGSRSTNKTDPKISTLVCLYVAF  118



>ref|XP_008450060.1| PREDICTED: probable purine permease 10 isoform X2 [Cucumis melo]
Length=336

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSN--QPPPLPS  458
            QA A +LGR+Y+DKGG S WL TLVQ AGFPI   PY++I + K+++ ++N  Q    P+
Sbjct  14   QAVATLLGRLYFDKGGKSKWLGTLVQVAGFPIFF-PYYIIIATKQKTSTNNISQTEQQPT  72

Query  459  IIKVTXIY  482
            ++K+  +Y
Sbjct  73   LLKLVMVY  80



>ref|XP_004245857.1| PREDICTED: probable purine permease 11 [Solanum lycopersicum]
Length=379

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 65/112 (58%), Gaps = 8/112 (7%)
 Frame = +3

Query  168  ETPILVKEDDSDTQNPLMKLKR-----FDFWlllalnvgfllvgQAAAIILGRIYYDKGG  332
            E+   + ED+    N   ++ R     + +W  + L + FLLVGQ AA +LGR YYD+GG
Sbjct  14   ESSRQISEDNDTNTNQQQQISRKSNKHYGWWFRIFLYIIFLLVGQCAATLLGRFYYDEGG  73

Query  333  NSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            NS W+AT VQ++GFP+LL  +FL  S K  + SS   P  PS   +  IY F
Sbjct  74   NSKWMATFVQSSGFPVLLPLFFLFKSSKNTAFSS---PEKPSGFSLFLIYLF  122



>ref|XP_002454455.1| hypothetical protein SORBIDRAFT_04g031400 [Sorghum bicolor]
 gb|EES07431.1| hypothetical protein SORBIDRAFT_04g031400 [Sorghum bicolor]
Length=391

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 71/115 (62%), Gaps = 7/115 (6%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYD  323
            +H  +A +  P     + +  QN     + + +WL++ALN+ FL+ GQ A+ +LGR YY+
Sbjct  26   VHVQIAGSSKPETSSTNGTAPQNS--HTRHWHWWLMVALNIFFLVAGQTASTLLGRFYYN  83

Query  324  KGGNSTWLATLVQTAGFPILLIPYFLI--PSPKEQSDSSNQPPPLPSIIKVTXIY  482
            +GGNS W++T VQTAGFP+L +  +L    SP  Q+ +SN   P  S+ K+T IY
Sbjct  84   QGGNSKWMSTFVQTAGFPVLFVALYLFRSKSPSTQTTTSN---PETSVTKITLIY  135



>ref|XP_008450056.1| PREDICTED: probable purine permease 10 isoform X1 [Cucumis melo]
 ref|XP_008450057.1| PREDICTED: probable purine permease 10 isoform X1 [Cucumis melo]
 ref|XP_008450059.1| PREDICTED: probable purine permease 10 isoform X1 [Cucumis melo]
Length=381

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 3/68 (4%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSN--QPPPLPS  458
            QA A +LGR+Y+DKGG S WL TLVQ AGFPI   PY++I + K+++ ++N  Q    P+
Sbjct  59   QAVATLLGRLYFDKGGKSKWLGTLVQVAGFPIFF-PYYIIIATKQKTSTNNISQTEQQPT  117

Query  459  IIKVTXIY  482
            ++K+  +Y
Sbjct  118  LLKLVMVY  125



>ref|XP_010052099.1| PREDICTED: probable purine permease 9 [Eucalyptus grandis]
 gb|KCW75958.1| hypothetical protein EUGRSUZ_D00326 [Eucalyptus grandis]
Length=408

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 64/102 (63%), Gaps = 2/102 (2%)
 Frame = +3

Query  126  ECRLFTLHPPMAENETPILVKEDDSDTQNPLM-KLKRFDFWlllalnvgfllvgQAAAII  302
            E +L  +    A+ E   L     ++ Q  ++ K K F +W+ +AL    +L  Q+ A +
Sbjct  11   ELQLHIVGDQEAKEENSSLPTSIITNNQATIIPKPKNFGWWIRVALYSFLVLSSQSVATL  70

Query  303  LGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSD  428
            LGR+YY+KGGNS WLATLVQ  GFPIL + YF IP+PK++++
Sbjct  71   LGRLYYNKGGNSKWLATLVQLVGFPILFLLYF-IPTPKDRNN  111



>ref|XP_010674210.1| PREDICTED: probable purine permease 11 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=351

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +3

Query  216  LMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPY  395
            L KL R+ +WLL+ LN+ FL+ GQ AA++LGR YYD+GG+ST LATLVQTAGFPIL IP 
Sbjct  5    LFKLNRWQWWLLVGLNIFFLVAGQTAAVLLGRFYYDQGGSSTLLATLVQTAGFPILFIPL  64

Query  396  FLIPSP  413
              +P+ 
Sbjct  65   IFLPAS  70



>gb|KGN66057.1| hypothetical protein Csa_1G569340 [Cucumis sativus]
Length=364

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 6/83 (7%)
 Frame = +3

Query  201  DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPI  380
             + N   KL+R+ +W  + +   FL+ GQ+AA +LGR+YYDKGGNS W+ATLVQ+ GFPI
Sbjct  19   QSSNKTRKLERYTWWSRIGIYTVFLVCGQSAATLLGRLYYDKGGNSKWMATLVQSGGFPI  78

Query  381  L--LIPYFLIPSPKEQSDSSNQP  443
            L  L+ +F  P+      SS QP
Sbjct  79   LLPLLCFFSQPTK----SSSKQP  97



>ref|XP_010110511.1| hypothetical protein L484_023343 [Morus notabilis]
 gb|EXC26729.1| hypothetical protein L484_023343 [Morus notabilis]
Length=401

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  222  KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFL  401
            KL  + +WL +++ + FLL GQ+AA +LGR+YYDKGGNS W+ATLVQ+AGFP+LL   F 
Sbjct  52   KLIHYKWWLRVSIYILFLLSGQSAATLLGRLYYDKGGNSKWMATLVQSAGFPVLLPLLFF  111

Query  402  IPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
              SP + + + +     P +  +  +Y F
Sbjct  112  FSSPAKLTTTCSSSSTQPKVSSLVLLYLF  140



>ref|XP_008450620.1| PREDICTED: probable purine permease 11 isoform X1 [Cucumis melo]
Length=364

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = +3

Query  210  NPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLI  389
            N   KL+R+  W  + +   FL+ GQ+AA +LGR+YYDKGGNS W+ATLVQ+AGFPILL 
Sbjct  22   NKTRKLERYTRWSRIGIYTIFLVCGQSAATLLGRLYYDKGGNSKWMATLVQSAGFPILL-  80

Query  390  PYFLIPSPKEQSDSSNQP  443
            P+    S   +S SS QP
Sbjct  81   PFLWFFSQPTKS-SSKQP  97



>gb|KEH31564.1| purine permease [Medicago truncatula]
Length=421

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 62/95 (65%), Gaps = 8/95 (8%)
 Frame = +3

Query  222  KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFL  401
            +L+ F +W  ++L + FLLVGQ+ A +LGR+YYDKGGNS W+AT VQ+AGFPILL P + 
Sbjct  27   RLRDFKWWFRVSLYIVFLLVGQSTANLLGRLYYDKGGNSKWMATFVQSAGFPILL-PLYF  85

Query  402  IPSPKEQS-------DSSNQPPPLPSIIKVTXIYF  485
            I +P  +S       DSS +  P  S I    I+F
Sbjct  86   IFTPHAKSTNINANIDSSKKTKPKLSTIVSLYIFF  120



>ref|XP_004233086.1| PREDICTED: probable purine permease 10 [Solanum lycopersicum]
Length=375

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 60/115 (52%), Gaps = 6/115 (5%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYD  323
            LH    E E      E   +  N   +  +F  WL + +   F+L GQA   +LGR+YY+
Sbjct  9    LHLTFEEAERT----ESSENADNRKFQSSKFMLWLQIFIFTFFVLGGQAVGTLLGRVYYE  64

Query  324  KGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            +GG S WLATL QTAGFPILL P+   PSPK  ++        PSI     +Y F
Sbjct  65   QGGKSRWLATLAQTAGFPILL-PFICYPSPKNHNE-DELTTHHPSIFVRASVYIF  117



>emb|CDY14989.1| BnaA10g08670D [Brassica napus]
Length=415

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 58/71 (82%), Gaps = 1/71 (1%)
 Frame = +3

Query  165  NETPILVKEDDSDTQ-NPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNST  341
            N+ PILVKE+  +   +PL+KLK + +W+L+++N+ FL+ GQAA+++LGR YY++GGNS 
Sbjct  54   NQEPILVKEESVEGIPSPLLKLKSWQWWVLVSINILFLIGGQAASVLLGRFYYEEGGNSK  113

Query  342  WLATLVQTAGF  374
            W+ATLVQTA F
Sbjct  114  WMATLVQTAAF  124



>ref|XP_009597998.1| PREDICTED: probable purine permease 9 [Nicotiana tomentosiformis]
Length=417

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 73/139 (53%), Gaps = 21/139 (15%)
 Frame = +3

Query  135  LFTLHPPMAENETPILVKEDDSDTQNPLMKL------------KRFDFWlllalnvgfll  278
            +  +     E E  I++ +++++    L K+             ++  WL + ++   +L
Sbjct  1    MLAMGSSAQEKELDIIITQEETEEMQNLEKIIVEPESLILTAGNKYKGWLEVGIHAFIVL  60

Query  279  vgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFL------IPSPK-EQSDSSN  437
              Q+ A ILG++YYDKGGNSTWLA+L QT GFPILLIP  +      I +PK E+   S+
Sbjct  61   ASQSVATILGKLYYDKGGNSTWLASLTQTIGFPILLIPMIILNNDNKIKTPKLEEGMISH  120

Query  438  QPPPL--PSIIKVTXIYFF  488
                +  PS+  +  IY F
Sbjct  121  NDVDVKSPSVKVLLSIYVF  139



>ref|XP_004246178.1| PREDICTED: probable purine permease 11 [Solanum lycopersicum]
Length=377

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +3

Query  183  VKEDDSDTQNPLMKLKRFDF--WlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATL  356
            + ED+++ +  + K    ++  W  + + +  L+ GQ AA +LGR YYDKGGNS W+A  
Sbjct  19   ITEDETNEKKKIGKKSNLNYGWWCRIFIYIICLIGGQCAATLLGRFYYDKGGNSKWMAAF  78

Query  357  VQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            VQ++GFPIL+  +F   SPK ++DSS  P   PS   ++ IY
Sbjct  79   VQSSGFPILIPLFFFFKSPK-KTDSS--PLEKPSKFTLSMIY  117



>ref|XP_004295379.2| PREDICTED: probable purine permease 9 [Fragaria vesca subsp. 
vesca]
Length=371

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 65/103 (63%), Gaps = 5/103 (5%)
 Frame = +3

Query  177  ILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATL  356
            I+V+E +     P    + F +WL +A+   F+++GQ+AAI+LGR+YY+KGG S W+ATL
Sbjct  11   IIVQEAEPAISQP----RNFKWWLRIAIYTLFVMLGQSAAILLGRLYYNKGGKSIWMATL  66

Query  357  VQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            VQ  GFPI LIPY  + S K+ +  SN      S++ +  + F
Sbjct  67   VQFIGFPI-LIPYHCLSSSKKITTESNVNLLSSSVLALIYLSF  108



>gb|KDP45955.1| hypothetical protein JCGZ_11858 [Jatropha curcas]
Length=382

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 61/108 (56%), Gaps = 12/108 (11%)
 Frame = +3

Query  144  LHPPMA---ENETP-----ILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAI  299
            L P M    + ETP      L   DD   Q P  KL  + +WL +     F+L GQ+AA 
Sbjct  7    LQPEMTAVNDGETPDSNKGYLFSVDD-KLQLP--KLVHYKWWLRVTCYTLFVLSGQSAAT  63

Query  300  ILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQP  443
            +LGR+YYDKGGNS W+AT VQ+AGFPILL P     SP   S  + +P
Sbjct  64   LLGRLYYDKGGNSKWMATFVQSAGFPILL-PLLFFVSPSANSSLATKP  110



>ref|XP_007025157.1| Purine permease 10, putative [Theobroma cacao]
 gb|EOY27779.1| Purine permease 10, putative [Theobroma cacao]
Length=381

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 18/126 (14%)
 Frame = +3

Query  156  MAENE---TPILVKEDDSDTQNPLMKLK------------RFDFWlllalnvgfllvgQA  290
            MAE +    PI+  E+++  +NP + +             ++  WL + L   FLL GQ+
Sbjct  1    MAEAQRLQLPIISDEEEAKEENPAVNVNATNREITVSRSGKYKRWLRVVLYTIFLLCGQS  60

Query  291  AAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSD--SSNQPPPLPSII  464
               +LGR+YY+KGGNS WLA LVQ AGFPILL P++ +P+ K  +D  +S      PS  
Sbjct  61   VGTLLGRLYYEKGGNSKWLAALVQLAGFPILL-PFYCMPTRKMFNDLNASLTETKQPSFF  119

Query  465  KVTXIY  482
            K+  +Y
Sbjct  120  KLVLVY  125



>ref|XP_006436828.1| hypothetical protein CICLE_v10031810mg [Citrus clementina]
 ref|XP_006485365.1| PREDICTED: probable purine permease 11-like [Citrus sinensis]
 gb|ESR50068.1| hypothetical protein CICLE_v10031810mg [Citrus clementina]
Length=382

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 70/118 (59%), Gaps = 9/118 (8%)
 Frame = +3

Query  150  PPMAENETPILVKEDDS------DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGR  311
             P  + +T +  +E DS      + Q   +KLK + +WL + L V  LLVGQ+AA +LGR
Sbjct  4    SPELQLQTRVNDRELDSHIDTSVNQQWRFLKLKHYKWWLRVILYVVCLLVGQSAATLLGR  63

Query  312  IYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            +YYDKGGNS W+AT VQ+AGFPILL P  ++      S S+N+  P  S +    + F
Sbjct  64   LYYDKGGNSKWMATFVQSAGFPILL-P--VLCCFSNGSRSTNKTDPKISTLVCLYVAF  118



>ref|XP_010100972.1| hypothetical protein L484_010627 [Morus notabilis]
 gb|EXB86563.1| hypothetical protein L484_010627 [Morus notabilis]
Length=116

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQ  440
            Q+A  +LG++YYDKGGNSTW+ + +Q AGFPILL PY+L+PS K  + SS +
Sbjct  59   QSAGNLLGKLYYDKGGNSTWIGSFLQVAGFPILL-PYYLLPSRKNNNTSSRK  109



>gb|KJB37689.1| hypothetical protein B456_006G215500, partial [Gossypium raimondii]
Length=387

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 67/125 (54%), Gaps = 12/125 (10%)
 Frame = +3

Query  129  CRLFTLHPPMAENETPILVKEDDSDT-----QNPLMKLKRFDFWlllalnvgfllvgQAA  293
            C  F       E +T ++ +  D D        P    K + +W+ +   + FL+ GQ+A
Sbjct  2    CTAFMEEAQTVELQTRVVGQNQDEDIPFTNQSQP----KHYKWWIRVISYILFLISGQSA  57

Query  294  AIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQS--DSSNQPPPLPSIIK  467
            AI+LGR+Y+DKGGNS W+AT VQ+AGFPILL P+    SP  +S   S    P  P I  
Sbjct  58   AILLGRLYFDKGGNSKWMATFVQSAGFPILL-PFLFYFSPFAKSVPVSVTSVPRRPKIST  116

Query  468  VTXIY  482
            +  +Y
Sbjct  117  LVFLY  121



>ref|XP_002874546.1| ATPUP13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50805.1| ATPUP13 [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 57/82 (70%), Gaps = 7/82 (9%)
 Frame = +3

Query  165  NETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTW  344
             E  +L+KE+D  +       +R  +W+L+ +++ FL+  QA A++LGR YY++GGNS W
Sbjct  3    EEAMLLLKEEDEGS-------RRTSWWILVFISIFFLISAQAIAVLLGRFYYNEGGNSKW  55

Query  345  LATLVQTAGFPILLIPYFLIPS  410
            ++TLVQT GFPIL +P  L+P+
Sbjct  56   ISTLVQTGGFPILYLPLCLLPA  77



>ref|XP_006358633.1| PREDICTED: probable purine permease 11-like [Solanum tuberosum]
Length=376

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 68/112 (61%), Gaps = 7/112 (6%)
 Frame = +3

Query  153  PMAENETPILVKEDDSDTQNPLMKLKRFDF--WlllalnvgfllvgQAAAIILGRIYYDK  326
            P++E+   I   ED+++ Q  + +    ++  W  + + +  L+ GQ AA +LGR YYD+
Sbjct  11   PISESNRQI--SEDETNEQKKIGRKSNINYGWWCRIFIYIICLIGGQCAATLLGRFYYDE  68

Query  327  GGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            GGNS W+A  VQ++GFPIL+  +F   SPK ++DSS  P   PS + +  IY
Sbjct  69   GGNSKWMAAFVQSSGFPILIPLFFFFKSPK-KTDSS--PLEKPSKLTLYMIY  117



>ref|XP_004953494.1| PREDICTED: probable purine permease 11-like [Setaria italica]
Length=383

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +3

Query  228  KRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            K + +WL++ALN+ FL+ GQ A+ +LGR YY++GGNS W++T VQTAGFP+L I  +L  
Sbjct  49   KHWHWWLMVALNIFFLIAGQTASTLLGRFYYNQGGNSKWMSTFVQTAGFPVLFIALYLFR  108

Query  408  SPKEQSDSSNQPPPLPSIIKVTXIY  482
            S   Q+ +++   P  S+ K+T IY
Sbjct  109  SKSTQTTTAS---PETSVTKITLIY  130



>ref|XP_010052098.1| PREDICTED: probable purine permease 9 [Eucalyptus grandis]
Length=411

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 70/126 (56%), Gaps = 18/126 (14%)
 Frame = +3

Query  144  LHPPM---AENETPILVKEDDSDTQNPLM-KLKRFDFWlllalnvgfllvgQAAAIILGR  311
            LH P    A+ E         ++ Q+ L  K K F +W+ +AL   F+L GQ+ A +LGR
Sbjct  14   LHVPGDQGAKEENSYHSTSTITNNQSTLTPKPKNFRWWIRVALYSFFVLSGQSVATLLGR  73

Query  312  IYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSD-------------SSNQPPPL  452
            +YY+KGGNS WLATLVQ  GFPILL  YF IPS K+ +D             S +Q P L
Sbjct  74   LYYNKGGNSKWLATLVQLVGFPILLFLYF-IPSHKDPNDPNYPHIQTNPEAQSHSQSPSL  132

Query  453  PSIIKV  470
             S+  V
Sbjct  133  KSLALV  138



>gb|KCW75957.1| hypothetical protein EUGRSUZ_D00325 [Eucalyptus grandis]
Length=422

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 58/94 (62%), Gaps = 14/94 (15%)
 Frame = +3

Query  228  KRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            K F +W+ +AL   F+L GQ+ A +LGR+YY+KGGNS WLATLVQ  GFPILL  YF IP
Sbjct  38   KNFRWWIRVALYSFFVLSGQSVATLLGRLYYNKGGNSKWLATLVQLVGFPILLFLYF-IP  96

Query  408  SPKEQSD-------------SSNQPPPLPSIIKV  470
            S K+ +D             S +Q P L S+  V
Sbjct  97   SHKDPNDPNYPHIQTNPEAQSHSQSPSLKSLALV  130



>ref|XP_008225352.1| PREDICTED: probable purine permease 10 [Prunus mume]
Length=384

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +3

Query  207  QNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILL  386
            Q  + +LK F +W+ +A+   F+L GQ+AA++LGR+YY+KGG + W+ATLVQ  GFPI L
Sbjct  30   QATISQLKDFTWWVRMAIYALFVLSGQSAAVLLGRLYYNKGGKNLWMATLVQFIGFPI-L  88

Query  387  IPYFLIPSPKEQS--DSSNQPPPLP  455
            IPY  I S K+ +   + NQP  L 
Sbjct  89   IPYHCILSSKKIALDRNVNQPDALA  113



>emb|CDX71327.1| BnaC07g06060D [Brassica napus]
Length=416

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +3

Query  165  NETPILVKEDDS--DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNS  338
            N+ PILVKE++S     +PL+KLK + +W+L+++N+ FL+ GQAA+++LGR Y ++GGNS
Sbjct  54   NQEPILVKEEESVEGIPSPLLKLKSWQWWVLVSINILFLIGGQAASVLLGRFYCEEGGNS  113

Query  339  TWLATLVQTAGF  374
             W+ATLVQTA F
Sbjct  114  KWMATLVQTAAF  125



>ref|XP_003551463.1| PREDICTED: probable purine permease 9-like isoform X1 [Glycine 
max]
Length=414

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 73/129 (57%), Gaps = 8/129 (6%)
 Frame = +3

Query  108  HLSISAECRLFTLHPPMAENETPILVKEDDS----DTQNPLMKLKRFDFWlllalnvgfl  275
            H+    E +L  +    A+ E  +   ED+S      ++ + K KR+  WL ++++   +
Sbjct  18   HMGEPQEVQLTKIEANGAKEENSL---EDNSFGGPMNESTMSKKKRYYRWLRISIHSSLV  74

Query  276  lvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLP  455
            LV  +AAI+LGR+YY+KGG S W+ TLVQ AGFPI L P+  I +PK  + +S+  P   
Sbjct  75   LVCGSAAILLGRLYYEKGGKSKWMGTLVQLAGFPIQL-PFHFISAPKNLTTNSSIHPKQS  133

Query  456  SIIKVTXIY  482
            S   +  IY
Sbjct  134  SASILAFIY  142



>ref|XP_004293485.1| PREDICTED: probable purine permease 9 [Fragaria vesca subsp. 
vesca]
Length=398

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 74/118 (63%), Gaps = 13/118 (11%)
 Frame = +3

Query  162  ENETPILVKE-DDSDTQ-----NPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYD  323
            E +  I V+E +++++Q     N L + + F++WL +++   F+L GQA A +LGR YY+
Sbjct  8    ELQLSIKVQEANEANSQPDVPNNQLPRSRGFNWWLRISIYTVFVLAGQAIATLLGRQYYE  67

Query  324  KGGNSTWLATLVQTAGFPILLIPYFLIPS-----PKEQSDSSNQPPPLPSIIKVTXIY  482
            KGG+S WLATLVQ  GFPILL P++ IP+     P   S +S +  P PS + +  IY
Sbjct  68   KGGSSNWLATLVQLCGFPILL-PFYFIPALNKNCPTTNSTTSFESKP-PSTLVLASIY  123



>ref|XP_010091778.1| hypothetical protein L484_003838 [Morus notabilis]
 gb|EXB45754.1| hypothetical protein L484_003838 [Morus notabilis]
Length=338

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +3

Query  216  LMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPY  395
            +++ + +++W   A+ V  LL GQ+ A +LGR+Y+DKGG S W+ +LVQ AGFPILL PY
Sbjct  75   ILRARNYNWWFRTAIYVFLLLSGQSVATLLGRLYFDKGGESKWMRSLVQLAGFPILL-PY  133

Query  396  FLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            +LI S K+   +++    L S++    +Y
Sbjct  134  YLISSHKKAVTNTDMHSKLRSMLVHASVY  162



>ref|XP_010055380.1| PREDICTED: probable purine permease 11 [Eucalyptus grandis]
 ref|XP_010055381.1| PREDICTED: probable purine permease 11 [Eucalyptus grandis]
Length=367

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 63/106 (59%), Gaps = 7/106 (7%)
 Frame = +3

Query  183  VKEDDSDTQNPLMKLKR---FDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLAT  353
            +K+   D  NP +  +R   + +W+ +A  + FLL GQ+AA +LGR+YYDKGGNS W+AT
Sbjct  1    MKKTVVDMDNPDLPYQRTRNYKWWIRVAAYILFLLSGQSAATLLGRLYYDKGGNSKWMAT  60

Query  354  LVQTAGFPILLIPYFLIPSP---KEQSDSSNQPPPLPSIIKVTXIY  482
             VQ+AGFPI LIP  +  SP        +  Q P  P +  +  +Y
Sbjct  61   FVQSAGFPI-LIPLLIFFSPMFSNSTKSTRTQSPSKPKLSSLAFLY  105



>ref|XP_008784692.1| PREDICTED: probable purine permease 11 [Phoenix dactylifera]
 ref|XP_008784693.1| PREDICTED: probable purine permease 11 [Phoenix dactylifera]
 ref|XP_008784694.1| PREDICTED: probable purine permease 11 [Phoenix dactylifera]
 ref|XP_008784695.1| PREDICTED: probable purine permease 11 [Phoenix dactylifera]
 ref|XP_008784697.1| PREDICTED: probable purine permease 11 [Phoenix dactylifera]
 ref|XP_008784698.1| PREDICTED: probable purine permease 11 [Phoenix dactylifera]
 ref|XP_008779035.1| PREDICTED: probable purine permease 11 [Phoenix dactylifera]
 ref|XP_008779036.1| PREDICTED: probable purine permease 11 [Phoenix dactylifera]
 ref|XP_008779037.1| PREDICTED: probable purine permease 11 [Phoenix dactylifera]
Length=375

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  225  LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLI  404
            L+ + +WL++ALN+ FLL GQ  A++LGR YYDKGGNS W+ATLVQTAGFPI  +P  L 
Sbjct  31   LRHWQWWLVVALNIFFLLAGQTTALLLGRFYYDKGGNSKWMATLVQTAGFPIFFLPLLLF  90

Query  405  PS  410
            PS
Sbjct  91   PS  92



>gb|ACU17999.1| unknown [Glycine max]
Length=415

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 75/129 (58%), Gaps = 8/129 (6%)
 Frame = +3

Query  108  HLSISAECRLFTLHPPMAENETPILVKEDDS----DTQNPLMKLKRFDFWlllalnvgfl  275
            H+    E +L  + P  A+    +   ED+S      ++ +   KR+  WL +A++   +
Sbjct  18   HMGEPQEVQLSKIEPSGAKETNSL---EDNSFGGPMNESIMSNKKRYYRWLRVAIHSSLV  74

Query  276  lvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLP  455
            LV  +AA++LGR+YY+KGG S W+ TLVQ AGFPI L  YF + +PK  + +++  P  P
Sbjct  75   LVCASAAVLLGRLYYEKGGKSKWMGTLVQLAGFPIQLPVYFFL-APKNLTTNNSIHPKQP  133

Query  456  SIIKVTXIY  482
            S+  ++ IY
Sbjct  134  SVSMLSFIY  142



>ref|XP_003532171.1| PREDICTED: probable purine permease 9-like [Glycine max]
 gb|KHN41417.1| Putative purine permease 9 [Glycine soja]
Length=415

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 75/129 (58%), Gaps = 8/129 (6%)
 Frame = +3

Query  108  HLSISAECRLFTLHPPMAENETPILVKEDDS----DTQNPLMKLKRFDFWlllalnvgfl  275
            H+    E +L  + P  A+    +   ED+S      ++ +   KR+  WL +A++   +
Sbjct  18   HMGEPQEVQLSKIEPSGAKETNSL---EDNSFGGPMNESIMSNKKRYYRWLRVAIHSSLV  74

Query  276  lvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLP  455
            LV  +AA++LGR+YY+KGG S W+ TLVQ AGFPI L  YF + +PK  + +++  P  P
Sbjct  75   LVCASAAVLLGRLYYEKGGKSKWMGTLVQLAGFPIQLPVYFFL-APKNLTTNNSIHPKQP  133

Query  456  SIIKVTXIY  482
            S+  ++ IY
Sbjct  134  SVSMLSFIY  142



>ref|XP_004516108.1| PREDICTED: probable purine permease 9-like [Cicer arietinum]
Length=402

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +3

Query  189  EDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTA  368
            ED    ++  M  KR  ++L +A+ V  +LVGQ++A +LGR+YY+KGG S W+ATLVQ  
Sbjct  29   EDQIMNESIKMNKKR-RYYLKVAIYVALILVGQSSATLLGRLYYEKGGKSKWMATLVQLV  87

Query  369  GFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            GFPILL  YF I S K+ ++ +  P   PS   +T +Y
Sbjct  88   GFPILLPCYFFISSTKKNNNITIDPNK-PSFFMLTFVY  124



>ref|XP_008364183.1| PREDICTED: probable purine permease 9 [Malus domestica]
Length=382

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  234  FDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSP  413
            F  W+ + +   F+L GQ+AAI+LGR+YYDKGG   W+ATLVQ  GFPI LIPY  I S 
Sbjct  37   FTRWVRITIYTLFILSGQSAAILLGRLYYDKGGKIIWMATLVQFTGFPI-LIPYHCILSS  95

Query  414  KEQSDSSNQPPPLPSII  464
            K+ +  SN   P  S++
Sbjct  96   KKIAAHSNVHQPSASVL  112



>ref|XP_007146626.1| hypothetical protein PHAVU_006G056100g [Phaseolus vulgaris]
 gb|ESW18620.1| hypothetical protein PHAVU_006G056100g [Phaseolus vulgaris]
Length=409

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 62/102 (61%), Gaps = 6/102 (6%)
 Frame = +3

Query  192  DDSDTQNPL----MKLKRFDF-WlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATL  356
            +D+    P+    M  KR  + W  +A++   +LV  +AA++LGR+YY+KGG S W+ TL
Sbjct  41   EDNSFHGPMNESTMSRKRMYYRWFRIAIHSALVLVCGSAALLLGRLYYEKGGKSKWMGTL  100

Query  357  VQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            VQ  GFPILL PY+ I +PK  + +++  P  PS   +  +Y
Sbjct  101  VQLGGFPILL-PYYFISAPKNLATNNSIHPNQPSASMLAFVY  141



>ref|XP_010436374.1| PREDICTED: probable purine permease 13 [Camelina sativa]
Length=366

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 55/79 (70%), Gaps = 6/79 (8%)
 Frame = +3

Query  162  ENETPILVKEDD------SDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYD  323
            + +  +L+KE+D      +     L+KLKR  +W+L+ +++ FL+  QA A++LGR YY+
Sbjct  2    DEQALLLLKEEDEGKIRRTSVPTQLLKLKRTQWWILVFISIFFLISAQAIAVLLGRFYYN  61

Query  324  KGGNSTWLATLVQTAGFPI  380
            +GGNS W++TLVQT GFPI
Sbjct  62   QGGNSKWISTLVQTGGFPI  80



>ref|XP_009614172.1| PREDICTED: probable purine permease 10 [Nicotiana tomentosiformis]
Length=380

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 58/84 (69%), Gaps = 4/84 (5%)
 Frame = +3

Query  186  KEDDSDTQN---PLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATL  356
            KE+ SD +N    +  L ++ +W+ +++   F+L GQA   +LG++Y++KGGNS WLA+L
Sbjct  11   KEETSDNENKSKAVPSLVQYKWWIQISIYSTFVLSGQAIGTLLGKLYFNKGGNSIWLASL  70

Query  357  VQTAGFPILLIPYFLIPSPKEQSD  428
            VQ  GFPI LIP+ LIPS   +S+
Sbjct  71   VQNIGFPI-LIPFLLIPSLTNKSE  93



>ref|XP_011018648.1| PREDICTED: probable purine permease 11 isoform X1 [Populus euphratica]
 ref|XP_011018649.1| PREDICTED: probable purine permease 11 isoform X1 [Populus euphratica]
Length=392

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 62/108 (57%), Gaps = 10/108 (9%)
 Frame = +3

Query  189  EDDSDTQNPLMKLKR---FDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLV  359
             +D+ + N  MKL +   + +WL +   + FLL GQ+AA +LGR+YYDKGGNS W+AT V
Sbjct  22   SNDASSINNKMKLPKLIHYKWWLRVTCYILFLLSGQSAATLLGRLYYDKGGNSKWMATFV  81

Query  360  QTAGFPILLIPYFLIPSPKEQSDSSN-------QPPPLPSIIKVTXIY  482
            Q+AGFPILL   F   S      ++N         P  P +  +T +Y
Sbjct  82   QSAGFPILLPLLFFFTSSINSKTATNPISSSFANKPEGPKLSTLTFLY  129



>ref|XP_011018650.1| PREDICTED: probable purine permease 11 isoform X2 [Populus euphratica]
Length=390

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 62/108 (57%), Gaps = 10/108 (9%)
 Frame = +3

Query  189  EDDSDTQNPLMKLKR---FDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLV  359
             +D+ + N  MKL +   + +WL +   + FLL GQ+AA +LGR+YYDKGGNS W+AT V
Sbjct  20   SNDASSINNKMKLPKLIHYKWWLRVTCYILFLLSGQSAATLLGRLYYDKGGNSKWMATFV  79

Query  360  QTAGFPILLIPYFLIPSPKEQSDSSN-------QPPPLPSIIKVTXIY  482
            Q+AGFPILL   F   S      ++N         P  P +  +T +Y
Sbjct  80   QSAGFPILLPLLFFFTSSINSKTATNPISSSFANKPEGPKLSTLTFLY  127



>ref|XP_003570128.1| PREDICTED: probable purine permease 11 isoform X2 [Brachypodium 
distachyon]
Length=377

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = +3

Query  225  LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLI  404
            +K + +WL++ LN+ FL+ GQ A+ +LGR YY++GGNS W++T VQTAGFP+L I  FL 
Sbjct  37   VKPWQWWLMVTLNMFFLIAGQTASTLLGRFYYNQGGNSKWMSTFVQTAGFPVLFIAQFLF  96

Query  405  --PSPKEQSDSSNQPPPLPSIIKVTXIY  482
               SP  Q+ +SN   P  S  K+T IY
Sbjct  97   RPKSPSTQTTTSN---PEASGSKITLIY  121



>ref|XP_010235835.1| PREDICTED: probable purine permease 11 isoform X1 [Brachypodium 
distachyon]
Length=379

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = +3

Query  225  LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLI  404
            +K + +WL++ LN+ FL+ GQ A+ +LGR YY++GGNS W++T VQTAGFP+L I  FL 
Sbjct  39   VKPWQWWLMVTLNMFFLIAGQTASTLLGRFYYNQGGNSKWMSTFVQTAGFPVLFIAQFLF  98

Query  405  --PSPKEQSDSSNQPPPLPSIIKVTXIY  482
               SP  Q+ +SN   P  S  K+T IY
Sbjct  99   RPKSPSTQTTTSN---PEASGSKITLIY  123



>ref|XP_007146627.1| hypothetical protein PHAVU_006G056200g [Phaseolus vulgaris]
 gb|ESW18621.1| hypothetical protein PHAVU_006G056200g [Phaseolus vulgaris]
Length=439

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 78/149 (52%), Gaps = 22/149 (15%)
 Frame = +3

Query  93   LNLRFHLSISAECR-----LFTLHPPMAENETPIL--------VKEDDSDTQNPL-----  218
            L L FH+  + E +      FT+H  M E++   L        V+E +S   N       
Sbjct  26   LILSFHMGDTQEVQHPHQTSFTIH--MEESQELQLSKIEGNNGVQETNSLEGNSFGGPMN  83

Query  219  -MKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPY  395
              + K +  W  +A+    +LV  +AA++LGR+YY+KGG S W+ TL Q  GFPILL PY
Sbjct  84   ESRRKMYYRWFRIAIYSALVLVCGSAAVLLGRLYYEKGGKSKWMGTLTQLGGFPILL-PY  142

Query  396  FLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            + I +PK  + +++  P  PS+  +  +Y
Sbjct  143  YFISAPKNLATNNSIHPNQPSVSMLAFVY  171



>ref|XP_009608565.1| PREDICTED: probable purine permease 9 isoform X1 [Nicotiana tomentosiformis]
Length=383

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 2/108 (2%)
 Frame = +3

Query  159  AENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNS  338
            A++E  I     +   Q+      ++ +W+ + +   F+L GQA   +LGR+Y+DKGGNS
Sbjct  14   ADDEAKIEESSQNGTDQSKAPSFVQYKWWIQMVIYSTFVLSGQAIGTLLGRLYFDKGGNS  73

Query  339  TWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
             WLATLVQ  GFPI LIP+ LI S K   +   +    PS   V  +Y
Sbjct  74   KWLATLVQNIGFPI-LIPFLLITSTKTNHEVITEIQK-PSFYVVASLY  119



>ref|XP_006355610.1| PREDICTED: probable purine permease 9-like [Solanum tuberosum]
Length=377

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 2/100 (2%)
 Frame = +3

Query  189  EDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTA  368
            E   +  N  ++  +F  WL + +   F + GQAA  +LGR+YY++GG + W+ATL QTA
Sbjct  22   ESSENADNSSVQSSKFILWLQIFIFTFFTIGGQAAGTLLGRVYYEQGGQTRWIATLAQTA  81

Query  369  GFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            GF ILL P+   PSPK  ++        PSI     +Y F
Sbjct  82   GFSILL-PFICYPSPKNHNE-DELTIHQPSIFVRASVYIF  119



>ref|XP_009782918.1| PREDICTED: probable purine permease 10 [Nicotiana sylvestris]
Length=385

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 71/117 (61%), Gaps = 5/117 (4%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDTQNPLMKLKRF---DFWlllalnvgfllvgQAAAIILGRI  314
            +  P+ ++  P   ++++SD +N    +  F    +W+ +++   F+L GQA   +LG++
Sbjct  2    VDAPVLQSHVPGEEQKENSDNENKSKSVPSFVQYKWWIQISIYSTFVLSGQAIGTLLGKL  61

Query  315  YYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSS-NQPPPLPSIIKVTXIY  482
            Y++KGGN+ WLA+L+Q  GFPI LIP+ LIPS   +SD + N     PSI  +  +Y
Sbjct  62   YFNKGGNNIWLASLLQNIGFPI-LIPFLLIPSSTNKSDKNRNVNIKKPSIFVLVPLY  117



>ref|XP_004295378.1| PREDICTED: probable purine permease 10 [Fragaria vesca subsp. 
vesca]
Length=382

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 65/112 (58%), Gaps = 8/112 (7%)
 Frame = +3

Query  162  ENETPILVKEDDSDTQNPLMKLKR-FDFWlllalnvgfllvgQAAAIILGRIYYDKGGNS  338
            E    I V+E  S+  N L   +R F++WL + +   F+L GQA A +LGR YY+KGG S
Sbjct  8    ERHLSITVQE--SNEANSLPDRRRGFNWWLKMLIYTVFVLAGQAIATLLGRQYYEKGGKS  65

Query  339  TWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPL----PSIIKVTXIY  482
             WLATLVQ  GFPI L PY+ IP+  +   ++N    +    PS + +  IY
Sbjct  66   NWLATLVQICGFPIFL-PYYCIPAWNKNCPTTNSTIAIESKPPSTLVLASIY  116



>ref|XP_004233087.1| PREDICTED: probable purine permease 10 [Solanum lycopersicum]
Length=375

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 2/100 (2%)
 Frame = +3

Query  189  EDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTA  368
            E   + +   ++  +F  WL + +   F L GQAA  +LGR+YY++GG + W+ATL QTA
Sbjct  20   ESSENAKTSRLQSSKFILWLQIFIFTFFTLGGQAAGTLLGRVYYEQGGQTRWIATLAQTA  79

Query  369  GFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            GF ILL P+   PSPK  ++   +    PSI     +Y F
Sbjct  80   GFSILL-PFICYPSPKNHNE-DERTIHHPSIFVRASVYIF  117



>gb|KJB57288.1| hypothetical protein B456_009G157000 [Gossypium raimondii]
Length=408

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 74/131 (56%), Gaps = 24/131 (18%)
 Frame = +3

Query  123  AECRLFTLHPPMAENETPILVKEDDSDTQNPLM------KLKRFDFWlllalnvgfllvg  284
            AE R F L  P+   E     KE++ +  N ++      K KR   W+ + L + FLL G
Sbjct  34   AETRHFQL--PIVAQEA----KEENGNATNQVITELGSVKYKR---WICILLCIIFLLCG  84

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPK-----EQSDSSNQPPP  449
            Q+ A +LGR+Y+DKGG S WL+TL+Q AGFPI L+P++ I  PK       S  SN+   
Sbjct  85   QSVAALLGRLYFDKGGKSKWLSTLIQFAGFPI-LVPFYCISRPKMLTANHCSIGSNKQ--  141

Query  450  LPSIIKVTXIY  482
             PSI+ +  +Y
Sbjct  142  -PSIMMLGLVY  151



>gb|AFK38479.1| unknown [Medicago truncatula]
Length=108

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKE  419
            Q++A +LGR+YY+KGG S W+AT+VQ AGFPILL  YF I S K+
Sbjct  60   QSSATLLGRLYYEKGGKSKWMATVVQLAGFPILLPYYFFILSSKK  104



>ref|XP_006602140.1| PREDICTED: probable purine permease 9-like isoform X3 [Glycine 
max]
Length=365

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = +3

Query  207  QNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILL  386
            ++ + K KR+  WL ++++   +LV  +AAI+LGR+YY+KGG S W+ TLVQ AGFPI L
Sbjct  3    ESTMSKKKRYYRWLRISIHSSLVLVCGSAAILLGRLYYEKGGKSKWMGTLVQLAGFPIQL  62

Query  387  IPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
             P+  I +PK  + +S+  P   S   +  IY
Sbjct  63   -PFHFISAPKNLTTNSSIHPKQSSASILAFIY  93



>ref|XP_006602139.1| PREDICTED: probable purine permease 9-like isoform X2 [Glycine 
max]
Length=413

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +3

Query  189  EDDS----DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATL  356
            ED+S      ++ + K KR+  WL ++++   +LV  +AAI+LGR+YY+KGG S W+ TL
Sbjct  41   EDNSFGGPMNESTMSKKKRYYRWLRISIHSSLVLVCGSAAILLGRLYYEKGGKSKWMGTL  100

Query  357  VQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            VQ AGFPI L P+  I +PK  + +S+  P   S   +  IY
Sbjct  101  VQLAGFPIQL-PFHFISAPKNLTTNSSIHPKQSSASILAFIY  141



>gb|KHN31656.1| Putative purine permease 9 [Glycine soja]
Length=365

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = +3

Query  207  QNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILL  386
            ++ + K KR+  WL ++++   +LV  +AAI+LGR+YY+KGG S W+ TLVQ AGFPI L
Sbjct  3    ESTMSKKKRYYRWLRISIHSSLVLVCGSAAILLGRLYYEKGGKSKWMGTLVQLAGFPIQL  62

Query  387  IPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
             P+  I +PK  + +S+  P   S   +  IY
Sbjct  63   -PFHFISAPKNLTTNSSIHPKQSSASILAFIY  93



>ref|XP_008226761.1| PREDICTED: probable purine permease 10 [Prunus mume]
Length=392

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 59/88 (67%), Gaps = 4/88 (5%)
 Frame = +3

Query  228  KRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            K F++WL + L    +L GQ+ A +LGR+Y+DKGG+S WL  L+  AGFP LL+PY+ IP
Sbjct  41   KSFNWWLRMTLYTCLVLSGQSVATLLGRLYFDKGGHSNWLQALMNLAGFP-LLLPYYCIP  99

Query  408  SPKEQSD---SSNQPPPLPSIIKVTXIY  482
            + +++++   +S Q  P PS + +  +Y
Sbjct  100  ALRKRNNPTTNSVQSEPPPSTLTLASVY  127



>gb|KJB34975.1| hypothetical protein B456_006G093600 [Gossypium raimondii]
Length=337

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSII  464
            Q+A+ +LGR+YYDKGG S W+ATL Q AGFPI+++ Y L P PK  S + N+    PS +
Sbjct  10   QSASTLLGRLYYDKGGKSVWVATLAQLAGFPIVILCYCLAP-PK--SCTKNEQIRQPSAV  66

Query  465  KVTXIYF  485
             +  +YF
Sbjct  67   ILALVYF  73



>gb|EPS68820.1| hypothetical protein M569_05947, partial [Genlisea aurea]
Length=340

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  222  KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFL  401
            +L R ++W+L+ +++   + GQA AI+LG++Y   GG+S W+  LVQ  GFPI+LIPY L
Sbjct  3    QLSRLNWWVLVVISIILCISGQACAIVLGKVYSRNGGSSRWMINLVQNGGFPIVLIPYLL  62

Query  402  IPSPKEQSDSSNQPPP  449
              +  E S +   PPP
Sbjct  63   FITLGE-SKTDRSPPP  77



>ref|XP_009608566.1| PREDICTED: probable purine permease 10 isoform X2 [Nicotiana 
tomentosiformis]
Length=382

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 61/114 (54%), Gaps = 2/114 (2%)
 Frame = +3

Query  141  TLHPPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYY  320
             +   + ++E  I     +   Q+      ++ +W+ + +   F+L GQA   +LGR+Y+
Sbjct  7    VVQSQVQDDEAKIEESSQNGTDQSKAPSFVQYKWWIQMVIYSTFVLSGQAIGTLLGRLYF  66

Query  321  DKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            DKGGNS WLATLVQ  GFPI LIP+ LI S K   +   +    PS   V  +Y
Sbjct  67   DKGGNSKWLATLVQNIGFPI-LIPFLLITSTKTNHEVITEIQK-PSFYVVASLY  118



>ref|XP_004166556.1| PREDICTED: LOW QUALITY PROTEIN: probable purine permease 9-like 
[Cucumis sativus]
Length=381

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSS-NQPPPLPSI  461
            QA A +LGR+Y+DKGG S WL TLVQ AGFPI    Y +I   K  ++++ +Q    P++
Sbjct  59   QAVATLLGRLYFDKGGKSKWLGTLVQVAGFPIFFSYYIIINQSKTNTNNNISQTEQQPTL  118

Query  462  IKVTXIY  482
            +K+  +Y
Sbjct  119  LKLVMVY  125



>ref|XP_004233088.1| PREDICTED: probable purine permease 10 [Solanum lycopersicum]
Length=374

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 5/96 (5%)
 Frame = +3

Query  201  DTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPI  380
            + +N   +  +F  WL + +   F + GQAA  +LGR+YY++GG   W+ATL QTAGFPI
Sbjct  26   NAKNSKFQSSKFILWLQIFIFTFFTIGGQAAGTLLGRVYYEQGGKIRWIATLAQTAGFPI  85

Query  381  LLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            LL P+    + + Q    N+PP   S+     +Y F
Sbjct  86   LL-PFIFYSATRNQ----NEPPVNASVFVRASVYIF  116



>ref|XP_007025152.1| Purine permease 10 isoform 1 [Theobroma cacao]
 ref|XP_007025153.1| Purine permease 10 isoform 1 [Theobroma cacao]
 gb|EOY27774.1| Purine permease 10 isoform 1 [Theobroma cacao]
 gb|EOY27775.1| Purine permease 10 isoform 1 [Theobroma cacao]
Length=382

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 65/106 (61%), Gaps = 8/106 (8%)
 Frame = +3

Query  183  VKEDDSDTQNPLMKL-----KRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWL  347
            VKE++S       KL     + + +W+ + +   F+L GQ+A+ +LGR+YYDKGG S W+
Sbjct  16   VKEENSPQYLNGKKLTSPEPRNYKWWISIIMYAFFVLFGQSASTLLGRLYYDKGGKSIWV  75

Query  348  ATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            ATL Q AGFPI LIP + +  P+  S ++N+    PS + +  IYF
Sbjct  76   ATLAQLAGFPI-LIPCYCLSPPR--SCTTNEQTKQPSALILAIIYF  118



>ref|XP_011007505.1| PREDICTED: probable purine permease 9 isoform X1 [Populus euphratica]
 ref|XP_011012919.1| PREDICTED: probable purine permease 9 isoform X1 [Populus euphratica]
Length=379

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 69/111 (62%), Gaps = 13/111 (12%)
 Frame = +3

Query  150  PPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKG  329
            PP  ENET          +Q  + + ++  +WLL+A+    LL GQ+ A++LGR+Y++KG
Sbjct  21   PPRHENET----------SQPTIPQKRKSKWWLLMAIYSFLLLAGQSVAVLLGRLYFEKG  70

Query  330  GNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            GNS+W+  LVQ AGFPILL P++L   PK  S +SN    LPS + +  IY
Sbjct  71   GNSSWMGALVQPAGFPILL-PFYL-SQPKSPS-TSNFETSLPSNLVLASIY  118



>ref|XP_004233085.1| PREDICTED: probable purine permease 10 [Solanum lycopersicum]
Length=379

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = +3

Query  180  LVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLV  359
            ++ +++S  + P   L  + +W+ + +    +L  QA   +LGRIY++KGGNS WLATLV
Sbjct  22   IIPQNESQLKGP--TLVHYKWWIQMIIYSILVLSTQAIGTLLGRIYFEKGGNSKWLATLV  79

Query  360  QTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            QT  FPI LIP FL   PK +++ + +    PS I VT +Y
Sbjct  80   QTIAFPI-LIP-FLFIKPK-KTNKNIEIIKKPSFIIVTSLY  117



>ref|XP_008225422.1| PREDICTED: probable purine permease 9 [Prunus mume]
Length=393

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 62/97 (64%), Gaps = 6/97 (6%)
 Frame = +3

Query  207  QNPLMKLKR-FDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPIL  383
            + P++  +R  ++WL +A+   F++ GQ+AA +LGR+YY+K G S WL TLVQ AGFPIL
Sbjct  29   EQPVLPWRRNLNWWLRIAIYTLFVIAGQSAATLLGRLYYNKSGKSKWLGTLVQLAGFPIL  88

Query  384  LIPYFLIPS----PKEQSDSSNQPPPLPSIIKVTXIY  482
            L PY+ IP+    P     ++N P   PS + +  IY
Sbjct  89   L-PYYCIPASRRNPTINITTNNIPLKSPSTLILASIY  124



>emb|CDP06315.1| unnamed protein product [Coffea canephora]
Length=383

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 7/100 (7%)
 Frame = +3

Query  195  DSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGF  374
              D Q+    L+++ +WL +A+     L GQ   ++LGR+Y+DKGGNS W+ATLVQ  GF
Sbjct  26   QGDLQSDAPCLRQYTWWLQVAVYTILTLAGQTVGVLLGRLYFDKGGNSEWMATLVQNIGF  85

Query  375  PILLIPYFLIPSPKEQSDSSNQPPPL--PSIIKVTXIYFF  488
            P+LL P FL+ SP   S + NQ   +  PS + +   Y F
Sbjct  86   PVLL-P-FLLSSP---SKTRNQETGIVRPSFVVLASTYTF  120



>dbj|BAD07671.1| putative purine permease [Oryza sativa Japonica Group]
Length=385

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query  225  LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLI  404
            +K + +WL++ +N+ FL+ GQ A+ +LGR YY++GGNS W++T VQTAGFPIL I  FL 
Sbjct  43   VKSWQWWLMVGVNMFFLIAGQTASTLLGRFYYNQGGNSKWMSTFVQTAGFPILFIALFLF  102

Query  405  -PSPKEQSDSSNQPPPLPSIIKVTXIY  482
                      ++ P P  SI K+T IY
Sbjct  103  HSKTSSTQTVTSSPAPTISIPKITLIY  129



>gb|AFK34280.1| unknown [Medicago truncatula]
Length=393

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  195  DSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGF  374
            D      +M  K+  +++ +A+    +LVGQ++A +LGR+YY+KGG S W+AT+VQ AGF
Sbjct  30   DQIMNGSIMTNKKRIYYIKVAIYAALVLVGQSSATLLGRLYYEKGGKSKWMATVVQLAGF  89

Query  375  PILLIPYFLIPSPKEQSDSSN  437
            PILL  YF I S K+ + ++N
Sbjct  90   PILLPYYFFILSSKKLTTNNN  110



>ref|NP_001047783.1| Os02g0689200 [Oryza sativa Japonica Group]
 dbj|BAD07670.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF09697.1| Os02g0689200 [Oryza sativa Japonica Group]
 dbj|BAG93086.1| unnamed protein product [Oryza sativa Japonica Group]
Length=382

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query  225  LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLI  404
            +K + +WL++ +N+ FL+ GQ A+ +LGR YY++GGNS W++T VQTAGFPIL I  FL 
Sbjct  40   VKSWQWWLMVGVNMFFLIAGQTASTLLGRFYYNQGGNSKWMSTFVQTAGFPILFIALFLF  99

Query  405  -PSPKEQSDSSNQPPPLPSIIKVTXIY  482
                      ++ P P  SI K+T IY
Sbjct  100  HSKTSSTQTVTSSPAPTISIPKITLIY  126



>gb|EAZ24234.1| hypothetical protein OsJ_07985 [Oryza sativa Japonica Group]
Length=423

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query  225  LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLI  404
            +K + +WL++ +N+ FL+ GQ A+ +LGR YY++GGNS W++T VQTAGFPIL I  FL 
Sbjct  81   VKSWQWWLMVGVNMFFLIAGQTASTLLGRFYYNQGGNSKWMSTFVQTAGFPILFIALFLF  140

Query  405  -PSPKEQSDSSNQPPPLPSIIKVTXIY  482
                      ++ P P  SI K+T IY
Sbjct  141  HSKTSSTQTVTSSPAPTISIPKITLIY  167



>ref|XP_006355608.1| PREDICTED: probable purine permease 6-like isoform X2 [Solanum 
tuberosum]
Length=386

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 61/101 (60%), Gaps = 5/101 (5%)
 Frame = +3

Query  180  LVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLV  359
            ++ +++S    P   L  + +W+ + +    +L  QA   +LGRIY++KGGNS WLATLV
Sbjct  22   IISQNESQLNGP--TLVHYKWWIQMIIYSTLVLSTQAIGTLLGRIYFEKGGNSKWLATLV  79

Query  360  QTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            QT  FPI LIP FL   PK +++ + +    PS I V+ +Y
Sbjct  80   QTIAFPI-LIP-FLFIKPK-KTNKNIEIIKKPSFIIVSSLY  117



>ref|XP_006355607.1| PREDICTED: probable purine permease 6-like isoform X1 [Solanum 
tuberosum]
Length=387

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 61/101 (60%), Gaps = 5/101 (5%)
 Frame = +3

Query  180  LVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLV  359
            ++ +++S    P   L  + +W+ + +    +L  QA   +LGRIY++KGGNS WLATLV
Sbjct  23   IISQNESQLNGP--TLVHYKWWIQMIIYSTLVLSTQAIGTLLGRIYFEKGGNSKWLATLV  80

Query  360  QTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            QT  FPI LIP FL   PK +++ + +    PS I V+ +Y
Sbjct  81   QTIAFPI-LIP-FLFIKPK-KTNKNIEIIKKPSFIIVSSLY  118



>ref|XP_010096958.1| hypothetical protein L484_017773 [Morus notabilis]
 gb|EXB66535.1| hypothetical protein L484_017773 [Morus notabilis]
Length=373

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +3

Query  219  MKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYF  398
            ++ + +  WL  AL   F+L GQA A +LGR+YYDKGG S W+ TLVQ  GFP+ LIPY+
Sbjct  31   LEQRNYKRWLRTALYAVFVLAGQATATLLGRLYYDKGGKSKWIGTLVQLVGFPV-LIPYY  89

Query  399  LIP--SPKEQSDSSNQPPPLPSIIKVTXIY  482
            LI   S    S+ ++  P  PS+I ++  Y
Sbjct  90   LICILSKNPTSNGNHFHPKKPSLIVLSSAY  119



>ref|XP_007039598.1| Drug/metabolite transporter superfamily protein [Theobroma cacao]
 gb|EOY24099.1| Drug/metabolite transporter superfamily protein [Theobroma cacao]
Length=342

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQP  443
            Q+ A +LGR+YYDKGGNS W+AT VQ+AGFPILL P     SP  +S +S+ P
Sbjct  11   QSTATLLGRLYYDKGGNSKWMATFVQSAGFPILL-PLLFFFSPPTKSITSSNP  62



>ref|XP_007211409.1| hypothetical protein PRUPE_ppa006967mg [Prunus persica]
 gb|EMJ12608.1| hypothetical protein PRUPE_ppa006967mg [Prunus persica]
Length=388

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = +3

Query  228  KRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            + F++WL +A+    ++ GQ+ A +LGR+Y+DKGG+S WLAT+VQ  GFP+LL PY+ IP
Sbjct  37   RSFNWWLRVAIYAFLVIAGQSVATLLGRLYFDKGGDSKWLATVVQLCGFPVLL-PYYCIP  95

Query  408  SPKEQ---SDSSNQPPPLPSII  464
            +        +S+ Q  P  ++I
Sbjct  96   AASRNPITKNSTVQFKPQSTLI  117



>ref|XP_010538524.1| PREDICTED: probable purine permease 10 [Tarenaya hassleriana]
Length=386

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 5/114 (4%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYD  323
            L   + + + P   +++D ++  P  K + F  WL +     F+L GQ  A ILGR+YYD
Sbjct  7    LQVIVQQEKEPNPTEQEDRNSSVP--KSRSFRKWLRIGSYTFFVLSGQTVATILGRMYYD  64

Query  324  KGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDS-SNQPPPLPSIIKVTXIY  482
             GG S WLATLVQ  GFPILL  YFL P  ++ + +  N  P  P  + V  +Y
Sbjct  65   NGGKSKWLATLVQLVGFPILLPYYFLSPVKEDVTTTLGNFRPASP--VSVGSVY  116



>ref|XP_008225353.1| PREDICTED: probable purine permease 9 [Prunus mume]
 ref|XP_008225354.1| PREDICTED: probable purine permease 9 [Prunus mume]
Length=390

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +3

Query  228  KRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            + F++WL +A+    ++ GQ+ A +LGR+Y+DKGG+S WLAT+VQ  GFP+LL PY+ IP
Sbjct  37   RSFNWWLKVAIYAFLVIAGQSVATLLGRLYFDKGGDSKWLATVVQLCGFPVLL-PYYCIP  95

Query  408  SPKEQSDSSNQPPPL--PSIIKVTXIY  482
            +      + N       PS + +  +Y
Sbjct  96   AASRNPITKNSTIQFKQPSTLILASVY  122



>ref|XP_011007507.1| PREDICTED: probable purine permease 10 [Populus euphratica]
 ref|XP_011007508.1| PREDICTED: probable purine permease 10 [Populus euphratica]
 ref|XP_011007509.1| PREDICTED: probable purine permease 10 [Populus euphratica]
Length=385

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = +3

Query  228  KRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            + +  W+ +A+    LLVGQ+ A++LGR+Y+ KGGNS W+ATLVQ AGFP+ LIP++LI 
Sbjct  39   RNYRRWIGIAICTVLLLVGQSVAMLLGRLYFVKGGNSKWMATLVQLAGFPV-LIPFYLIS  97

Query  408  SPKEQSDSSNQPPPLPSIIKVTXIY  482
            +  + S + +Q    PS+  +  IY
Sbjct  98   TTSKPSTNDSQIKS-PSVTTLLLIY  121



>ref|XP_002272204.1| PREDICTED: probable purine permease 10 isoform X1 [Vitis vinifera]
Length=370

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = +3

Query  186  KEDDSDTQNPLM-----KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLA  350
            +E++S   N ++     +++++ +WL +A+   F+L GQ  A +LGR+Y++KGG S WLA
Sbjct  17   REENSAEGNVVLQTMTPRIRKYMWWLQIAIYSLFVLSGQTVATLLGRLYFEKGGKSKWLA  76

Query  351  TLVQTAGFPILLIPYFL-IPSPKEQSDSSNQPP  446
            TLVQ AGFPILL  Y L +P     SDS    P
Sbjct  77   TLVQLAGFPILLPLYCLSLPKSPRTSDSHTSQP  109



>ref|XP_002298513.2| hypothetical protein POPTR_0001s34550g [Populus trichocarpa]
 gb|EEE83318.2| hypothetical protein POPTR_0001s34550g [Populus trichocarpa]
Length=385

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSII  464
            Q+ A++LGR+Y+ KGGNS W+ATLVQ AGFP+ LIP++LI +  + S + +Q    PS+ 
Sbjct  58   QSVAMLLGRLYFVKGGNSKWMATLVQLAGFPV-LIPFYLISTNSKPSTNDSQIKS-PSVT  115

Query  465  KVTXIY  482
             +  IY
Sbjct  116  TLALIY  121



>ref|XP_006368464.1| hypothetical protein POPTR_0001s03050g [Populus trichocarpa]
 gb|ERP65033.1| hypothetical protein POPTR_0001s03050g [Populus trichocarpa]
Length=392

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 59/106 (56%), Gaps = 9/106 (8%)
 Frame = +3

Query  192  DDSDTQNPLM--KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQT  365
            D S   N +   KL  + +WL +   + FLL GQ+AA +LG +YYDKGGNS W+AT VQ+
Sbjct  24   DASSINNKMQLPKLIHYKWWLRVTCYILFLLSGQSAATLLGGLYYDKGGNSKWMATFVQS  83

Query  366  AGFPILLIPYFLIPSPKEQSDSSN-------QPPPLPSIIKVTXIY  482
            AGFPILL   F   S    + ++N         P  P +  +T +Y
Sbjct  84   AGFPILLPLLFFFTSSINSNTATNPISSSFANKPEGPKLSTLTFLY  129



>gb|KEH34049.1| purine permease [Medicago truncatula]
Length=361

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSN  437
            Q++A +LGR+YY+KGG S W+AT+VQ AGFPILL  YF I S K+ + ++N
Sbjct  28   QSSATLLGRLYYEKGGKSKWMATVVQLAGFPILLPYYFFILSSKKLTTNNN  78



>emb|CAN64869.1| hypothetical protein VITISV_041328 [Vitis vinifera]
Length=369

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +3

Query  186  KEDDSDTQNPLM-----KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLA  350
            +E++S   N ++     +++++ +WL +A+   F+L GQ  A +LGR+Y++KGG S WLA
Sbjct  16   REENSAEGNVVLQTMTPRIRKYMWWLQIAIYSLFVLSGQTVATLLGRLYFEKGGKSKWLA  75

Query  351  TLVQTAGFPILLIPYFL-IPSPKEQSDSSNQPPP  449
            TLVQ AGFPILL  Y L +P     SDS    P 
Sbjct  76   TLVQLAGFPILLPLYCLSLPKSPRTSDSHTSQPS  109



>gb|KCW75963.1| hypothetical protein EUGRSUZ_D00332 [Eucalyptus grandis]
Length=402

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSN  437
            QA A +LG +YY +GG+S WLA+LVQ  GFPILL+ YF IP+PK+ SD +N
Sbjct  65   QAVATLLGNLYYKEGGHSMWLASLVQLGGFPILLLLYF-IPTPKQPSDPNN  114



>ref|XP_010100975.1| hypothetical protein L484_010630 [Morus notabilis]
 gb|EXB86566.1| hypothetical protein L484_010630 [Morus notabilis]
Length=891

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 61/100 (61%), Gaps = 2/100 (2%)
 Frame = +3

Query  189  EDDSDTQNPLMKLKR-FDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQT  365
            + +   Q+P+    R   +WL +++   F+  G++ A +LGR+YYDKGGNS W+ATLVQ 
Sbjct  521  DTNVSNQSPIHGQARDHKWWLRVSIYAIFVYCGESVATLLGRLYYDKGGNSKWMATLVQI  580

Query  366  AGFPILLIPYFLIPSPKE-QSDSSNQPPPLPSIIKVTXIY  482
            AGFP+LL  Y   P+PK   ++S  +  P  S + +  +Y
Sbjct  581  AGFPMLLPYYCTAPTPKRPFTNSIIRSKPTRSALTILSVY  620



>ref|XP_010054270.1| PREDICTED: LOW QUALITY PROTEIN: probable purine permease 9 [Eucalyptus 
grandis]
Length=399

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSN  437
            QA A +LG +YY +GG+S WLA+LVQ  GFPILL+ YF IP+PK+ SD +N
Sbjct  50   QAVATLLGNLYYKEGGHSMWLASLVQLGGFPILLLLYF-IPTPKQPSDPNN  99



>ref|XP_006449638.1| hypothetical protein CICLE_v10018046mg, partial [Citrus clementina]
 gb|ESR62878.1| hypothetical protein CICLE_v10018046mg, partial [Citrus clementina]
Length=285

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSS  434
            QAAAI+LGR YYDKGGNS WL+TL Q  GFPILL+ Y + P P+ +  ++
Sbjct  34   QAAAILLGRQYYDKGGNSKWLSTLAQFGGFPILLLSYCINP-PRRKCKNT  82



>ref|XP_008383566.1| PREDICTED: probable purine permease 9 [Malus domestica]
Length=396

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 59/98 (60%), Gaps = 7/98 (7%)
 Frame = +3

Query  207  QNPLMKLKR-FDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPIL  383
            + PL+  +R F+ WL +A+   F++ GQ+AA +L R+YYDKGG S WL  LVQ AGFPIL
Sbjct  45   EXPLLPRRRSFNXWLRMAICTVFVIAGQSAATLLARLYYDKGGKSKWLGALVQLAGFPIL  104

Query  384  LIPYFLIPS----PKEQSDSSNQPPPL-PSIIKVTXIY  482
            L PY+  P+    P     +S  P    PS + +  IY
Sbjct  105  L-PYYFFPTKRTNPTTNIXTSTTPESKEPSTLILASIY  141



>ref|XP_009782581.1| PREDICTED: probable purine permease 10 isoform X1 [Nicotiana 
sylvestris]
Length=378

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 4/102 (4%)
 Frame = +3

Query  183  VKEDDSDTQNPLMK--LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATL  356
            V+ DD  T          ++ +W+ + +   F+L GQ+   +LGR+Y+DKGGNS WLATL
Sbjct  12   VQADDEATMEATSHNVTHQYKWWIQMVIYSIFVLSGQSIGTLLGRLYFDKGGNSKWLATL  71

Query  357  VQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            VQ  GFPI LIP+ LI S K   +   +    PS   V  +Y
Sbjct  72   VQNIGFPI-LIPFLLIKSAKTNHEVITEIQK-PSFYIVASLY  111



>ref|XP_002298512.2| hypothetical protein POPTR_0001s34540g [Populus trichocarpa]
 gb|EEE83317.2| hypothetical protein POPTR_0001s34540g [Populus trichocarpa]
Length=379

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 4/97 (4%)
 Frame = +3

Query  195  DSDTQNPLMKLKR-FDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAG  371
            +++T  P +  KR   +WLL+A     LL GQ+ A++LGR+Y++KGGNS+W+  LVQ AG
Sbjct  25   ENETNQPAIPQKRNSKWWLLMAFYSLLLLAGQSVAVLLGRLYFEKGGNSSWMGALVQPAG  84

Query  372  FPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            FPILL P++L   PK  S +SN    LPS + +  IY
Sbjct  85   FPILL-PFYL-SQPKSPS-TSNFETNLPSNLVLASIY  118



>dbj|BAG93087.1| unnamed protein product [Oryza sativa Japonica Group]
Length=335

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLI-PSPKEQSDSSNQPPPLPSI  461
            Q A+ +LGR YY++GGNS W++T VQTAGFPIL I  FL           ++ P P  SI
Sbjct  13   QTASTLLGRFYYNQGGNSKWMSTFVQTAGFPILFIALFLFHSKTSSTQTVTSSPAPTISI  72

Query  462  IKVTXIY  482
             K+T IY
Sbjct  73   PKITLIY  79



>ref|XP_010091777.1| hypothetical protein L484_003837 [Morus notabilis]
 gb|EXB45753.1| hypothetical protein L484_003837 [Morus notabilis]
Length=395

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +3

Query  228  KRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            ++   W+ + +   F+L GQ+A  +LG++YYDKGGNSTW+ + +Q AGFPILL PY+L+P
Sbjct  39   RKLTSWIRIGIYAVFVLAGQSAGNLLGKLYYDKGGNSTWIGSFLQVAGFPILL-PYYLLP  97

Query  408  SPK  416
            S K
Sbjct  98   SRK  100



>ref|XP_007025175.1| Uncharacterized protein TCM_029556 [Theobroma cacao]
 gb|EOY27797.1| Uncharacterized protein TCM_029556 [Theobroma cacao]
Length=280

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 68/120 (57%), Gaps = 10/120 (8%)
 Frame = +3

Query  123  AECRLFTLHPPMAE--NETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAA  296
            AE +   LH   A+  N T  +    +S  +N ++       WL +AL   F+L GQ +A
Sbjct  2    AEAQQVQLHVMEAKGSNSTRAISHRTESRPRNYMIS------WLRIALYTIFVLCGQTSA  55

Query  297  IILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQS--DSSNQPPPLPSIIKV  470
             +L R+YY+KGG+S W+ TLV   GFP+LL  Y+ I  PK  +  +++ +PP LP ++ V
Sbjct  56   TLLTRLYYEKGGSSQWMGTLVMIVGFPVLLPYYYCISQPKVTTPNNANTKPPSLPMLVFV  115



>ref|XP_004498216.1| PREDICTED: probable purine permease 9-like [Cicer arietinum]
Length=388

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKE  419
            Q++A +LGR+YY+KGG S W+ATLVQ AGFPILL  YF I S K+
Sbjct  60   QSSATLLGRLYYEKGGKSKWMATLVQLAGFPILLPYYFFILSSKK  104



>gb|KDO78105.1| hypothetical protein CISIN_1g041591mg, partial [Citrus sinensis]
Length=306

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSS  434
            QAAAI+LGR YYDKGGNS WL+TL Q  GFPILL+ Y + P P+ +  ++
Sbjct  34   QAAAILLGRQYYDKGGNSKWLSTLAQFGGFPILLLSYCINP-PRRKCKNT  82



>ref|XP_006467516.1| PREDICTED: probable purine permease 10-like [Citrus sinensis]
Length=395

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 43/69 (62%), Gaps = 4/69 (6%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFL---IPSPKEQSDSSNQPPPLP  455
            QAAA +LGR YYDKGGNS WLATLVQ AGFPILL PY+    I +P  Q     +  P  
Sbjct  63   QAAATLLGRQYYDKGGNSNWLATLVQLAGFPILL-PYYCCINISTPFVQLQRKIKIKPPN  121

Query  456  SIIKVTXIY  482
            S   +  +Y
Sbjct  122  SFFILASVY  130



>ref|XP_010247691.1| PREDICTED: probable purine permease 11 isoform X1 [Nelumbo nucifera]
Length=378

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +3

Query  189  EDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTA  368
            +D      P +K K + +WLL+ALN+ FLL+GQ+AA++LGR YYD+GGNS W+ATLVQTA
Sbjct  21   KDGIAVNQPSLKPKNWHWWLLVALNIAFLLIGQSAAVLLGRFYYDQGGNSKWMATLVQTA  80

Query  369  GFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
             FPILL+P FL PS +  S +S      PSI+ V  +Y F
Sbjct  81   AFPILLLPLFLFPSSQNPSTTSTDSAQ-PSIVTVVVVYLF  119



>ref|XP_009782582.1| PREDICTED: probable purine permease 10 isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = +3

Query  165  NETPILVK---EDDSDTQNPLMK--LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKG  329
             +T ++V+   +DD  T          ++ +W+ + +   F+L GQ+   +LGR+Y+DKG
Sbjct  2    GDTSVVVQSQVQDDEATMEATSHNVTHQYKWWIQMVIYSIFVLSGQSIGTLLGRLYFDKG  61

Query  330  GNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
            GNS WLATLVQ  GFPI LIP+ LI S K   +   +    PS   V  +Y
Sbjct  62   GNSKWLATLVQNIGFPI-LIPFLLIKSAKTNHEVITEIQK-PSFYIVASLY  110



>ref|XP_009123729.1| PREDICTED: probable purine permease 9 isoform X1 [Brassica rapa]
Length=392

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +3

Query  231  RFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPS  410
            R+  WLL+++   F++ GQ+ A ILGR+YYD GGNS WLAT+VQ  GFP+LL PY+L+ S
Sbjct  36   RYKRWLLVSVYTFFVISGQSVATILGRLYYDNGGNSKWLATVVQLVGFPVLL-PYYLLSS  94

Query  411  P  413
             
Sbjct  95   K  95



>gb|KDO78104.1| hypothetical protein CISIN_1g016119mg [Citrus sinensis]
Length=395

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 43/69 (62%), Gaps = 4/69 (6%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFL---IPSPKEQSDSSNQPPPLP  455
            QAAA +LGR YYDKGGNS WLATLVQ AGFPILL PY+    I +P  Q     +  P  
Sbjct  63   QAAATLLGRQYYDKGGNSNWLATLVQLAGFPILL-PYYCCINISTPFVQLQRKIKIKPPN  121

Query  456  SIIKVTXIY  482
            S   +  +Y
Sbjct  122  SFFILASVY  130



>ref|XP_009123730.1| PREDICTED: probable purine permease 9 isoform X2 [Brassica rapa]
Length=391

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +3

Query  231  RFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPS  410
            R+  WLL+++   F++ GQ+ A ILGR+YYD GGNS WLAT+VQ  GFP+LL PY+L+ S
Sbjct  35   RYKRWLLVSVYTFFVISGQSVATILGRLYYDNGGNSKWLATVVQLVGFPVLL-PYYLLSS  93

Query  411  P  413
             
Sbjct  94   K  94



>ref|XP_008229522.1| PREDICTED: probable purine permease 11 [Prunus mume]
Length=378

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  222  KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILL  386
            KL  + +WL + + + FLL GQ+AA +LGR+YYDKGGNS W+AT VQ+AGFPILL
Sbjct  33   KLPNYRWWLRVIIYILFLLTGQSAATLLGRLYYDKGGNSKWMATFVQSAGFPILL  87



>ref|XP_009131523.1| PREDICTED: probable purine permease 10 [Brassica rapa]
Length=390

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +3

Query  192  DDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAG  371
             +   Q  +   K +  WL +A+   F++ GQ+ A ILGRIYYD GGNS WLAT+VQ  G
Sbjct  22   QEERNQTGVTHSKTYKRWLRVAVYTFFVISGQSVATILGRIYYDNGGNSKWLATVVQLVG  81

Query  372  FPILLIPYFLIP  407
            FP+LL PY+L+ 
Sbjct  82   FPVLL-PYYLLS  92



>ref|XP_007025158.1| Purine permease 10 [Theobroma cacao]
 gb|EOY27780.1| Purine permease 10 [Theobroma cacao]
Length=411

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = +3

Query  195  DSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGF  374
             S   + + + + + +WL +A+   F L GQ+ A +LG++YYDKGGNS W+ T VQ AGF
Sbjct  71   GSSQSSTITRHRSYKWWLQMAIYTIFCLAGQSVATLLGKLYYDKGGNSKWMETFVQPAGF  130

Query  375  PILLIPYFLIPSP----KEQSDSSNQPPPL  452
            P+ LIP +L+ S     KE S  + + PPL
Sbjct  131  PV-LIPIYLLSSAYKTLKEDSTRNIKSPPL  159



>ref|XP_006449637.1| hypothetical protein CICLE_v10015513mg [Citrus clementina]
 gb|ESR62877.1| hypothetical protein CICLE_v10015513mg [Citrus clementina]
Length=395

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYF  398
            QAAA +LGR YYDKGGNS WLATLVQ AGFPILL PY+
Sbjct  63   QAAATLLGRQYYDKGGNSNWLATLVQLAGFPILL-PYY  99



>emb|CDX78835.1| BnaA01g09020D [Brassica napus]
Length=391

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +3

Query  192  DDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAG  371
             +   Q  +   K +  WL +A+   F++ GQ+ A ILGRIYYD GGNS WLAT+VQ  G
Sbjct  22   QEERNQTGVTHSKTYKRWLRVAVYTFFVISGQSVATILGRIYYDNGGNSKWLATVVQLVG  81

Query  372  FPILLIPYFLIP  407
            FP+LL PY+L+ 
Sbjct  82   FPVLL-PYYLLS  92



>ref|XP_008383506.1| PREDICTED: probable purine permease 9 [Malus domestica]
Length=391

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +3

Query  159  AENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNS  338
             ENE  +    D SD ++ L + +  ++W+ +A+    ++ GQ+ A +LGR YYDKG  S
Sbjct  17   GENEANLSGHTDVSD-RSLLPQRRSVNWWIRIAIYSFLVIAGQSVAALLGRQYYDKGAKS  75

Query  339  TWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPP  449
             WLAT+VQ  GFPI+L PY+ IP+ +      + P P
Sbjct  76   NWLATVVQLCGFPIML-PYYCIPASRXNPIPKDSPIP  111



>gb|KHN21034.1| Putative purine permease 9 [Glycine soja]
Length=390

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDS------SNQPP  446
            Q+AA +LGR+YYD GGNS W+AT VQTAGFP+LL  +   P+  + S +      S   P
Sbjct  41   QSAATLLGRLYYDSGGNSKWMATFVQTAGFPVLLPLFLYFPTTHDNSSNMSNDNFSETKP  100

Query  447  PLPSIIKVTXIY  482
             L +++ +  ++
Sbjct  101  KLYTLVFLYIVF  112



>ref|XP_002274345.2| PREDICTED: probable purine permease 10 [Vitis vinifera]
Length=385

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 59/91 (65%), Gaps = 4/91 (4%)
 Frame = +3

Query  189  EDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTA  368
            E D+  Q+ + +++   +W+ + +   FLL GQ  A +LGR+Y+DKGGNS W++T VQ A
Sbjct  23   EPDAGHQSTVPQIRGRIWWIQMGVYSFFLLSGQTVATLLGRLYFDKGGNSKWMSTFVQLA  82

Query  369  GFPILLIPYFLIPSPKEQSDSS---NQPPPL  452
            GFP LL+P++ I  PK  +  S   ++PP L
Sbjct  83   GFP-LLLPFYCISLPKNPTTDSIHMDRPPAL  112



>emb|CBI30830.3| unnamed protein product [Vitis vinifera]
Length=498

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 59/91 (65%), Gaps = 4/91 (4%)
 Frame = +3

Query  189  EDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTA  368
            E D+  Q+ + +++   +W+ + +   FLL GQ  A +LGR+Y+DKGGNS W++T VQ A
Sbjct  23   EPDAGHQSTVPQIRGRIWWIQMGVYSFFLLSGQTVATLLGRLYFDKGGNSKWMSTFVQLA  82

Query  369  GFPILLIPYFLIPSPKEQSDSS---NQPPPL  452
            GFP LL+P++ I  PK  +  S   ++PP L
Sbjct  83   GFP-LLLPFYCISLPKNPTTDSIHMDRPPAL  112



>ref|XP_006355609.1| PREDICTED: probable purine permease 10-like [Solanum tuberosum]
Length=375

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 59/115 (51%), Gaps = 6/115 (5%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYD  323
            LH  + E E      E   +  N  ++  +F  WL + +   F+L GQA   +LGR+YY+
Sbjct  9    LHLTIEEAERT----ESSENADNSSVQSSKFVLWLQIFIFTFFILGGQAVGTLLGRVYYE  64

Query  324  KGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            +GG S W+AT  QTAGF ILL P+   PS K  ++        PSI     +Y F
Sbjct  65   QGGKSRWIATFAQTAGFSILL-PFICYPSTKNHNE-QELIIHQPSIFVRASVYIF  117



>emb|CDX76538.1| BnaA08g08620D [Brassica napus]
Length=392

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +3

Query  231  RFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPS  410
            R+  WLL+ +   F++ GQ+ A ILGR+YYD GGNS WLAT+VQ  GFP+LL PY+L+ S
Sbjct  36   RYKRWLLVFVYTFFVISGQSVATILGRLYYDNGGNSKWLATVVQLVGFPVLL-PYYLLSS  94

Query  411  PKEQS  425
                +
Sbjct  95   KTHTT  99



>ref|XP_008444229.1| PREDICTED: probable purine permease 10 isoform X1 [Cucumis melo]
 ref|XP_008444237.1| PREDICTED: probable purine permease 10 isoform X1 [Cucumis melo]
Length=394

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSS  434
            Q AA +LGR+Y++KGGNS W+ TLVQ AGFPILL  Y+ I   K +++++
Sbjct  70   QTAANLLGRLYFEKGGNSKWIGTLVQVAGFPILLPYYYFIAKTKHKTNTN  119



>ref|XP_010655638.1| PREDICTED: probable purine permease 10 isoform X2 [Vitis vinifera]
Length=340

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query  222  KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFL  401
            +++++ +WL +A+   F+L GQ  A +LGR+Y++KGG S WLATLVQ AGFPILL  Y L
Sbjct  4    RIRKYMWWLQIAIYSLFVLSGQTVATLLGRLYFEKGGKSKWLATLVQLAGFPILLPLYCL  63

Query  402  -IPSPKEQSDSSNQPP  446
             +P     SDS    P
Sbjct  64   SLPKSPRTSDSHTSQP  79



>ref|XP_011007506.1| PREDICTED: probable purine permease 9 isoform X2 [Populus euphratica]
 ref|XP_011012920.1| PREDICTED: probable purine permease 9 isoform X2 [Populus euphratica]
Length=335

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 3/66 (5%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSII  464
            Q+ A++LGR+Y++KGGNS+W+  LVQ AGFPILL P++L   PK  S +SN    LPS +
Sbjct  12   QSVAVLLGRLYFEKGGNSSWMGALVQPAGFPILL-PFYL-SQPKSPS-TSNFETSLPSNL  68

Query  465  KVTXIY  482
             +  IY
Sbjct  69   VLASIY  74



>ref|XP_010434560.1| PREDICTED: probable purine permease 10 [Camelina sativa]
Length=394

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 5/90 (6%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDT----QNPLMKLKRFDFWlllalnvgfllvgQAAAIILGR  311
            L   + + + P L  +D+ D+    Q  +    ++  WL + +    ++ GQ  A ILGR
Sbjct  7    LQVIVQQGKEPNLTVQDERDSVSSSQTEVSHSDKYKRWLRVTIYTFLVISGQTVATILGR  66

Query  312  IYYDKGGNSTWLATLVQTAGFPILLIPYFL  401
            +YYD GGNS WLAT+VQ  GFP+L  PY+L
Sbjct  67   LYYDNGGNSKWLATVVQLVGFPVLF-PYYL  95



>ref|XP_010439888.1| PREDICTED: probable purine permease 10 [Camelina sativa]
Length=394

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 5/90 (6%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDT----QNPLMKLKRFDFWlllalnvgfllvgQAAAIILGR  311
            L   + + + P L  +D+ D+    Q  +    ++  WL + +    ++ GQ  A ILGR
Sbjct  7    LQVIVQQGKEPNLTVQDERDSVSSSQTEVSHSDKYKRWLRVTIYTFLVISGQTVATILGR  66

Query  312  IYYDKGGNSTWLATLVQTAGFPILLIPYFL  401
            +YYD GGNS WLAT+VQ  GFP+L  PY+L
Sbjct  67   LYYDNGGNSKWLATVVQLVGFPVLF-PYYL  95



>ref|XP_010663907.1| PREDICTED: probable purine permease 11 [Vitis vinifera]
Length=389

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +3

Query  234  FDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSP  413
            + +WL +A+   FLL GQ+ A +LGR+YYDKGGNS W+AT VQ+AGFPILL P F   SP
Sbjct  41   YKWWLRVAIYTLFLLAGQSTATLLGRLYYDKGGNSKWMATFVQSAGFPILL-PLFFFFSP  99

Query  414  KEQ  422
              +
Sbjct  100  TSK  102



>ref|XP_010677220.1| PREDICTED: probable purine permease 11 [Beta vulgaris subsp. 
vulgaris]
Length=389

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 13/91 (14%)
 Frame = +3

Query  222  KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIP---  392
            KL ++  W+ +   + FLLVGQ   I+L R+Y+DKGGNS W+AT VQTAGFPI LIP   
Sbjct  43   KLTQYKKWIRVMTYILFLLVGQTTGILLLRLYFDKGGNSKWMATFVQTAGFPI-LIPLKF  101

Query  393  YFLIPSPKEQSDSSNQPPPLPSIIKVTXIYF  485
            YF   SP             PS+ K+T +YF
Sbjct  102  YFSFTSPTNFR---------PSLFKLTSLYF  123



>gb|EEC73811.1| hypothetical protein OsI_08525 [Oryza sativa Indica Group]
Length=385

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +3

Query  225  LKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLI  404
            +K + +WL++ +N+ FL+ GQ  + +LGR YY++GGNS W++T VQTAGFP+L I  FL 
Sbjct  43   VKSWQWWLMVGVNMFFLIAGQTTSTLLGRFYYNQGGNSKWMSTFVQTAGFPVLFIALFLF  102

Query  405  -PSPKEQSDSSNQPPPLPSIIKVTXIY  482
                      ++ P P  SI K+T IY
Sbjct  103  RSKTSSTQTVTSSPAPTISIPKITLIY  129



>ref|XP_010517571.1| PREDICTED: probable purine permease 10 [Camelina sativa]
Length=394

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 5/90 (6%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDT----QNPLMKLKRFDFWlllalnvgfllvgQAAAIILGR  311
            L   + + + P L  +D+ D+    Q  +    ++  WL + +    ++ GQ  A ILGR
Sbjct  7    LQVIVQQGKEPNLTVQDERDSVSSSQTEVSHSDKYKRWLRVTIYTFLVISGQTVATILGR  66

Query  312  IYYDKGGNSTWLATLVQTAGFPILLIPYFL  401
            +YYD GGNS WLAT+VQ  GFP+L  PY+L
Sbjct  67   LYYDNGGNSKWLATVVQLVGFPVLF-PYYL  95



>ref|XP_007149374.1| hypothetical protein PHAVU_005G064800g [Phaseolus vulgaris]
 gb|ESW21368.1| hypothetical protein PHAVU_005G064800g [Phaseolus vulgaris]
Length=388

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +3

Query  183  VKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQ  362
            V     + +  L+   R+ +W L+ +NV  LL+GQ+ A++LGR Y+D+GG S W+ATLVQ
Sbjct  26   VSTTTEEGEQSLLLFSRWKWWFLVVINVTLLLMGQSGAVLLGRFYFDQGGKSIWMATLVQ  85

Query  363  TAGFPILLIPYFLIPSPKEQSDSSN  437
            +  FPIL  P    P  +  S +++
Sbjct  86   SVAFPILFFPLLFFPHSQNLSVTTD  110



>ref|XP_003550935.1| PREDICTED: probable purine permease 11-like [Glycine max]
 gb|KHN01665.1| Putative purine permease 10 [Glycine soja]
Length=390

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 2/77 (3%)
 Frame = +3

Query  207  QNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILL  386
            Q+P  + +++ +WL ++L + FLLVGQ+AA +LGR+YYD GGNS W+AT VQ+AGFP+LL
Sbjct  31   QHP--RFRKYKWWLRVSLYIIFLLVGQSAATLLGRLYYDNGGNSKWMATFVQSAGFPVLL  88

Query  387  IPYFLIPSPKEQSDSSN  437
               F  P       ++N
Sbjct  89   PLLFYFPRQTHAKFNNN  105



>dbj|BAD42937.1| unknown protein [Arabidopsis thaliana]
Length=145

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +3

Query  198  SDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFP  377
            S +Q  +     +  WL + L   F++ GQ  A ILGR+YYD GGNS WLAT+VQ  GFP
Sbjct  29   SSSQAEVSHSNTYKRWLRVTLYTFFVISGQTVATILGRVYYDNGGNSKWLATVVQLVGFP  88

Query  378  ILLIPYFLI  404
            +LL PY+++
Sbjct  89   VLL-PYYIL  96



>ref|XP_009608564.1| PREDICTED: probable purine permease 10 [Nicotiana tomentosiformis]
Length=382

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 56/115 (49%), Gaps = 6/115 (5%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYD  323
            LH    E E      E   + +    +   F  WL + +   F L GQA   +LGR+YY+
Sbjct  9    LHLTFEEAEGT----EISENAKTSRFQSSNFILWLQIFIFTFFALAGQAVGTLLGRVYYE  64

Query  324  KGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            +GG S W+ATLVQTAGFPILL P    PS  E  +        PSI     +Y F
Sbjct  65   QGGQSRWIATLVQTAGFPILL-PIICYPST-ENHNEQQLIVQQPSIFVRASVYIF  117



>ref|XP_010531551.1| PREDICTED: probable purine permease 10 [Tarenaya hassleriana]
Length=290

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSII  464
            Q  A ++GR+Y+D GG S+W+ TLVQ  GFPILL  YF  P+ + ++  SN   P P  +
Sbjct  58   QTIATLVGRLYFDGGGKSSWMQTLVQLVGFPILLPFYFFSPTKEHETTDSNARQPSP--V  115

Query  465  KVTXIY  482
            +   +Y
Sbjct  116  RAVSVY  121



>ref|XP_002870061.1| ATPUP10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46320.1| ATPUP10 [Arabidopsis lyrata subsp. lyrata]
Length=390

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = +3

Query  186  KEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQT  365
            +   S +Q  + +   +  WL ++L   F++ GQ  A ILGR+YYD GGNS WLAT+VQ 
Sbjct  25   RNSVSSSQTEVSRSNTYKRWLRVSLYTFFVISGQTVATILGRLYYDNGGNSKWLATVVQL  84

Query  366  AGFPILLIPYFLI  404
             GFP+LL PY+L+
Sbjct  85   VGFPVLL-PYYLM  96



>ref|XP_010100974.1| hypothetical protein L484_010629 [Morus notabilis]
 gb|EXB86565.1| hypothetical protein L484_010629 [Morus notabilis]
Length=413

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 4/89 (4%)
 Frame = +3

Query  192  DDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAG  371
            + S    P  KL R   W+ + +   F+L GQ+ A +LGR+YY+KGGNS W+ TLVQ  G
Sbjct  48   NQSSIPQPRRKLIR---WIRIGIYAVFVLAGQSVATLLGRLYYEKGGNSKWMGTLVQLVG  104

Query  372  FPILLIPYFLIPSPKEQSDSSNQPPPLPS  458
            FP+LL PY+L  + K ++  S     + S
Sbjct  105  FPVLL-PYYLFSAKKNKNAISESNANIIS  132



>ref|XP_009360854.1| PREDICTED: probable purine permease 9 isoform X1 [Pyrus x bretschneideri]
Length=429

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +3

Query  159  AENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNS  338
             ENE  +    D SD ++ L + +  ++W+ +A+    ++ GQ+ A  LGR YYDKG  S
Sbjct  55   GENEANLSGHTDVSD-RSLLPQRRSVNWWIRIAIYSFLVIAGQSVAAFLGRQYYDKGAKS  113

Query  339  TWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPP  449
             WLAT+VQ  GFP++L PY+ IP+ +      + P P
Sbjct  114  KWLATVVQLCGFPVIL-PYYCIPASRNNPIPKDSPIP  149



>emb|CBI30831.3| unnamed protein product [Vitis vinifera]
Length=309

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 6/82 (7%)
 Frame = +3

Query  186  KEDDSDTQNPLM-----KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLA  350
            +E++S   N ++     +++++ +WL +A+   F+L GQ  A +LGR+Y++KGG S WLA
Sbjct  17   REENSAEGNVVLQTMTPRIRKYMWWLQIAIYSLFVLSGQTVATLLGRLYFEKGGKSKWLA  76

Query  351  TLVQTAGFPILLIPYFLIPSPK  416
            TLVQ AGFPILL P + +  PK
Sbjct  77   TLVQLAGFPILL-PLYCLSLPK  97



>ref|XP_009360858.1| PREDICTED: probable purine permease 9 isoform X4 [Pyrus x bretschneideri]
Length=391

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +3

Query  159  AENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNS  338
             ENE  +    D SD ++ L + +  ++W+ +A+    ++ GQ+ A  LGR YYDKG  S
Sbjct  17   GENEANLSGHTDVSD-RSLLPQRRSVNWWIRIAIYSFLVIAGQSVAAFLGRQYYDKGAKS  75

Query  339  TWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPP  449
             WLAT+VQ  GFP++L PY+ IP+ +      + P P
Sbjct  76   KWLATVVQLCGFPVIL-PYYCIPASRNNPIPKDSPIP  111



>ref|XP_004976625.1| PREDICTED: probable purine permease 11-like [Setaria italica]
Length=364

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 52/85 (61%), Gaps = 8/85 (9%)
 Frame = +3

Query  228  KRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            K + +W ++A +  FL+VGQ +A +LGR YY +GGNS WL+  VQTAGFPIL    F  P
Sbjct  45   KNWKWWFVVAADAFFLIVGQTSATLLGRYYYSQGGNSKWLSAFVQTAGFPILFFGLFFFP  104

Query  408  SPKEQSDSSNQPPPLPSIIKVTXIY  482
            S      SS + P    I K+T IY
Sbjct  105  SK----SSSGETP----IGKITMIY  121



>ref|XP_002870060.1| purine permease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46319.1| purine permease family protein [Arabidopsis lyrata subsp. lyrata]
Length=344

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            Q+ A ILGR+YYD GGNS WLAT+VQ  GFPILL PY+L+ 
Sbjct  12   QSVATILGRLYYDNGGNSKWLATVVQVVGFPILL-PYYLLS  51



>ref|XP_009782583.1| PREDICTED: probable purine permease 9 [Nicotiana sylvestris]
Length=379

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 58/115 (50%), Gaps = 8/115 (7%)
 Frame = +3

Query  144  LHPPMAENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYD  323
            LH    E E  I   E  S  Q+      +F  WL + +   F L GQA   +LGR+YY+
Sbjct  9    LHLTFEEAE-GIETSEKTSRLQSS-----KFILWLQIFIFTFFALAGQAVGTLLGRVYYE  62

Query  324  KGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLPSIIKVTXIYFF  488
            +GG S W+ATLVQTAGFPILL P    PS    ++        PSI     +Y F
Sbjct  63   QGGQSRWVATLVQTAGFPILL-PIICYPSATNHNE-QQLIIHQPSIFVRASVYIF  115



>ref|XP_010517569.1| PREDICTED: probable purine permease 9 [Camelina sativa]
Length=390

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  186  KEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQT  365
            K   S +Q  +     +  W+ +A+   F++ GQ+ A ILGR+YYD GGNS WLAT+VQ 
Sbjct  25   KNSVSGSQKKVSYSNTYKRWIRIAVYTFFVITGQSVATILGRLYYDNGGNSKWLATVVQP  84

Query  366  AGFPILLIPYFLIP  407
             GFPILL PY+L+ 
Sbjct  85   VGFPILL-PYYLLS  97



>emb|CDX99493.1| BnaC01g10590D [Brassica napus]
Length=392

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIP  407
            Q+ A ILGRIYYD GGNS WLAT+VQ  GFP+LL PY+L+ 
Sbjct  53   QSVATILGRIYYDNGGNSKWLATVVQLVGFPVLL-PYYLLS  92



>ref|XP_007214484.1| hypothetical protein PRUPE_ppa020615mg, partial [Prunus persica]
 gb|EMJ15683.1| hypothetical protein PRUPE_ppa020615mg, partial [Prunus persica]
Length=325

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPP  449
            Q+AAI+LGR+YY+KGG + W+ATLVQ  GFPI LIPY  I S K+ +   N   P
Sbjct  12   QSAAILLGRLYYNKGGKNLWMATLVQFIGFPI-LIPYHCILSSKKIALDRNVNQP  65



>ref|XP_009353821.1| PREDICTED: probable purine permease 9 [Pyrus x bretschneideri]
Length=405

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +3

Query  159  AENETPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNS  338
             ENE  +    D SD ++ L + +  ++W+ +A+    ++ GQ+ A  LGR YYDKG  S
Sbjct  17   GENEANLSGHTDVSD-RSLLPQRRSVNWWIRIAIYSFLVIAGQSVAAFLGRQYYDKGAKS  75

Query  339  TWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPP  449
             WLAT+VQ  GFP++L PY+ IP+ +      + P P
Sbjct  76   KWLATVVQLCGFPVIL-PYYCIPASRNNPIPKDSPIP  111



>ref|XP_010054266.1| PREDICTED: probable purine permease 9 [Eucalyptus grandis]
Length=410

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 57/95 (60%), Gaps = 5/95 (5%)
 Frame = +3

Query  171  TPILVKEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLA  350
            T I+     + T  P    + F +W+ +AL   F+L GQ+   +LGR+YY+KGGNS WLA
Sbjct  31   TSIITNNQATITPRP----QNFWWWIRVALCSFFVLSGQSVGTLLGRLYYNKGGNSKWLA  86

Query  351  TLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLP  455
            TLV   GFPILL+ Y +IP+ K  S    +  PLP
Sbjct  87   TLVPLVGFPILLLLY-VIPTSKNPSSPHIEAHPLP  120



>ref|XP_004147439.1| PREDICTED: probable purine permease 9-like [Cucumis sativus]
 ref|XP_004164942.1| PREDICTED: probable purine permease 9-like [Cucumis sativus]
Length=385

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 8/71 (11%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSN-----QPPP  449
            Q+  ++LGR+Y+DKGGNS WLATLV   GFP LL+P ++I S    S SSN      PP 
Sbjct  47   QSVGVMLGRLYFDKGGNSKWLATLVSLIGFP-LLLPLYMIKSLNTSSPSSNITLQSNPPT  105

Query  450  LPSIIKVTXIY  482
             P+  K+  +Y
Sbjct  106  SPA--KLAFVY  114



>gb|KCW75960.1| hypothetical protein EUGRSUZ_D00328, partial [Eucalyptus grandis]
Length=341

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSNQPPPLP  455
            Q+   +LGR+YY+KGGNS WLATLV   GFPILL+ Y +IP+ K  S    +  PLP
Sbjct  12   QSVGTLLGRLYYNKGGNSKWLATLVPLVGFPILLLLY-VIPTSKNPSSPHIEAHPLP  67



>ref|XP_010677221.1| PREDICTED: probable purine permease 11 isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010677222.1| PREDICTED: probable purine permease 11 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=396

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 10/88 (11%)
 Frame = +3

Query  222  KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILL-IPYF  398
            KLK +  W      + FLLVGQ  A +LGR+Y+DKGGNS W+AT VQ+AGFPIL+ + +F
Sbjct  55   KLKHYSKWFRFTSYIIFLLVGQTTATLLGRLYFDKGGNSKWMATFVQSAGFPILIPLKFF  114

Query  399  LIPSPKEQSDSSNQPPPLPSIIKVTXIY  482
                      SS+     PS+ ++  +Y
Sbjct  115  F---------SSSAASIRPSLAQLASLY  133



>ref|XP_010052097.1| PREDICTED: probable purine permease 9 [Eucalyptus grandis]
 gb|KCW75956.1| hypothetical protein EUGRSUZ_D00324 [Eucalyptus grandis]
Length=377

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query  186  KEDDSDTQNPLMKLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQT  365
            + D S  +  L   + + +WL +A+   F+L GQ+ A ILGR+YY+KGG S W+ TLVQ 
Sbjct  26   RNDASKPEAALSSARSYKWWLRIAVFSLFVLSGQSVATILGRLYYEKGGKSKWMETLVQI  85

Query  366  AGFPILLIPYFLIPSPKEQSDSSN  437
             GFPI LIPY L  SP + S ++ 
Sbjct  86   VGFPI-LIPY-LFFSPSKSSSATK  107



>gb|KGN65548.1| hypothetical protein Csa_1G445360 [Cucumis sativus]
Length=405

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 8/71 (11%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSSN-----QPPP  449
            Q+  ++LGR+Y+DKGGNS WLATLV   GFP LL+P ++I S    S SSN      PP 
Sbjct  67   QSVGVMLGRLYFDKGGNSKWLATLVSLIGFP-LLLPLYMIKSLNTSSPSSNITLQSNPPT  125

Query  450  LPSIIKVTXIY  482
             P+  K+  +Y
Sbjct  126  SPA--KLAFVY  134



>ref|XP_008444266.1| PREDICTED: probable purine permease 10 [Cucumis melo]
Length=381

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 48/69 (70%), Gaps = 4/69 (6%)
 Frame = +3

Query  285  QAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFLIPSPKEQSDSS---NQPPPLP  455
            QA A +LGR+Y+DKGG S WL TLVQ AGFPI   PY++I +  ++++++   +Q    P
Sbjct  59   QAVATLLGRLYFDKGGKSKWLGTLVQVAGFPIFF-PYYIIIATNQKTNTNNNISQTEQQP  117

Query  456  SIIKVTXIY  482
            +++K+  +Y
Sbjct  118  TLLKLVMVY  126



>ref|XP_004508992.1| PREDICTED: probable purine permease 10-like [Cicer arietinum]
Length=464

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  222  KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYF  398
            + + + +W  +++ + FLL+GQ+AA +LGR+YYDKGGNS W+AT VQ+AGFP+LL  +F
Sbjct  110  RFRDYRWWFRVSIYIIFLLIGQSAATLLGRLYYDKGGNSKWMATFVQSAGFPLLLPLFF  168



>ref|XP_002447004.1| hypothetical protein SORBIDRAFT_06g026770 [Sorghum bicolor]
 gb|EES11332.1| hypothetical protein SORBIDRAFT_06g026770 [Sorghum bicolor]
Length=374

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  222  KLKRFDFWlllalnvgfllvgQAAAIILGRIYYDKGGNSTWLATLVQTAGFPILLIPYFL  401
            K K +  W+++ ++  FL+VGQ +A +LGR YY +GGNS WL+T VQTAGFPIL    F 
Sbjct  47   KAKNWKRWIMVVVDAIFLIVGQTSATLLGRYYYSQGGNSKWLSTFVQTAGFPILFFGLFF  106

Query  402  IPSPKEQSDS  431
             PS    S++
Sbjct  107  FPSKSPSSET  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370