BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H09

Length=541
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601677.1|  PREDICTED: 60S ribosomal protein L8-like           306   5e-102   Nicotiana tomentosiformis
ref|XP_006360110.1|  PREDICTED: 60S ribosomal protein L8-like           306   8e-102   Solanum tuberosum [potatoes]
ref|NP_001234115.1|  60S ribosomal protein L8                           306   9e-102   
gb|ABB55374.1|  ribosomal protein L2-like                               305   1e-101   Solanum tuberosum [potatoes]
ref|XP_004244173.1|  PREDICTED: 60S ribosomal protein L8-like           305   2e-101   Solanum lycopersicum
ref|XP_009597412.1|  PREDICTED: 60S ribosomal protein L8                305   2e-101   Nicotiana tomentosiformis
ref|XP_006362915.1|  PREDICTED: 60S ribosomal protein L8-like           305   2e-101   Solanum tuberosum [potatoes]
ref|XP_009792898.1|  PREDICTED: 60S ribosomal protein L8-like           305   2e-101   Nicotiana sylvestris
gb|KDP41064.1|  hypothetical protein JCGZ_03170                         303   1e-100   Jatropha curcas
gb|KDP32235.1|  hypothetical protein JCGZ_13842                         302   2e-100   Jatropha curcas
ref|XP_010246956.1|  PREDICTED: 60S ribosomal protein L8                302   2e-100   Nelumbo nucifera [Indian lotus]
gb|EPS67154.1|  hypothetical protein M569_07621                         302   2e-100   Genlisea aurea
ref|XP_006363509.1|  PREDICTED: 60S ribosomal protein L8-like           301   5e-100   Solanum tuberosum [potatoes]
ref|XP_004251488.1|  PREDICTED: 60S ribosomal protein L8-like           301   5e-100   Solanum lycopersicum
ref|XP_009602138.1|  PREDICTED: 60S ribosomal protein L8-like           301   5e-100   Nicotiana tomentosiformis
gb|EYU19189.1|  hypothetical protein MIMGU_mgv1a012096mg                301   7e-100   Erythranthe guttata [common monkey flower]
ref|XP_006447449.1|  hypothetical protein CICLE_v10016308mg             301   7e-100   Citrus clementina [clementine]
ref|XP_011095301.1|  PREDICTED: 60S ribosomal protein L8-1              301   8e-100   Sesamum indicum [beniseed]
ref|XP_002269409.1|  PREDICTED: 60S ribosomal protein L8                300   2e-99    Vitis vinifera
sp|P25998.1|RL8_TOBAC  RecName: Full=60S ribosomal protein L8; Al...    300   2e-99    Nicotiana tabacum [American tobacco]
ref|XP_010279131.1|  PREDICTED: 60S ribosomal protein L8-like           299   4e-99    Nelumbo nucifera [Indian lotus]
ref|XP_002515688.1|  60S ribosomal protein L8, putative                 299   5e-99    Ricinus communis
ref|XP_002526326.1|  60S ribosomal protein L8, putative                 298   5e-99    Ricinus communis
ref|XP_010241006.1|  PREDICTED: 60S ribosomal protein L8-like           298   6e-99    Nelumbo nucifera [Indian lotus]
ref|XP_008454581.1|  PREDICTED: 60S ribosomal protein L8                297   1e-98    Cucumis melo [Oriental melon]
ref|XP_004151970.1|  PREDICTED: 60S ribosomal protein L8-like           297   2e-98    Cucumis sativus [cucumbers]
ref|XP_002281476.1|  PREDICTED: 60S ribosomal protein L8                297   2e-98    Vitis vinifera
gb|EPS68269.1|  hypothetical protein M569_06503                         297   2e-98    Genlisea aurea
ref|XP_002283149.1|  PREDICTED: 60S ribosomal protein L8                296   7e-98    Vitis vinifera
ref|XP_007046725.1|  Ribosomal protein L2 family                        295   8e-98    Theobroma cacao [chocolate]
ref|XP_010940992.1|  PREDICTED: 60S ribosomal protein L8-like           295   1e-97    Elaeis guineensis
ref|XP_011025941.1|  PREDICTED: 60S ribosomal protein L8-3              295   2e-97    Populus euphratica
emb|CDP05823.1|  unnamed protein product                                295   2e-97    Coffea canephora [robusta coffee]
ref|XP_011043211.1|  PREDICTED: 60S ribosomal protein L8-3              295   2e-97    Populus euphratica
ref|XP_006387604.1|  hypothetical protein POPTR_0789s00200g             294   4e-97    Populus trichocarpa [western balsam poplar]
gb|ACG36313.1|  60S ribosomal protein L2                                293   5e-97    Zea mays [maize]
ref|XP_006383123.1|  ribosomal protein L2                               293   5e-97    Populus trichocarpa [western balsam poplar]
ref|XP_008777192.1|  PREDICTED: 60S ribosomal protein L8-like           293   6e-97    Phoenix dactylifera
ref|XP_010029697.1|  PREDICTED: 60S ribosomal protein L8-3-like         293   6e-97    Eucalyptus grandis [rose gum]
ref|XP_011025942.1|  PREDICTED: 60S ribosomal protein L8-1              293   7e-97    Populus euphratica
ref|XP_008781786.1|  PREDICTED: 60S ribosomal protein L8-like           293   1e-96    Phoenix dactylifera
ref|XP_008785107.1|  PREDICTED: 60S ribosomal protein L8                293   1e-96    Phoenix dactylifera
ref|XP_010033473.1|  PREDICTED: 60S ribosomal protein L8-3              293   1e-96    Eucalyptus grandis [rose gum]
ref|XP_010920228.1|  PREDICTED: 60S ribosomal protein L8-1              292   2e-96    Elaeis guineensis
ref|XP_006654068.1|  PREDICTED: 60S ribosomal protein L8-like           292   2e-96    Oryza brachyantha
ref|XP_004134871.1|  PREDICTED: 60S ribosomal protein L8-like           292   2e-96    Cucumis sativus [cucumbers]
ref|XP_010526791.1|  PREDICTED: 60S ribosomal protein L8-3-like         292   2e-96    Tarenaya hassleriana [spider flower]
ref|NP_001130582.1|  60S ribosomal protein L2 isoform 1                 292   2e-96    Zea mays [maize]
gb|ACN36341.1|  unknown                                                 291   3e-96    Zea mays [maize]
dbj|BAJ89887.1|  predicted protein                                      291   3e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009384636.1|  PREDICTED: 60S ribosomal protein L8-like           291   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009146753.1|  PREDICTED: 60S ribosomal protein L8-3              291   3e-96    Brassica rapa
ref|XP_010548296.1|  PREDICTED: 60S ribosomal protein L8-3-like         291   4e-96    Tarenaya hassleriana [spider flower]
gb|KHG30041.1|  60S ribosomal L8-3 -like protein                        291   4e-96    Gossypium arboreum [tree cotton]
gb|KHG03835.1|  60S ribosomal L8-3 -like protein                        291   4e-96    Gossypium arboreum [tree cotton]
ref|XP_010531080.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    291   4e-96    Tarenaya hassleriana [spider flower]
ref|XP_002459748.1|  hypothetical protein SORBIDRAFT_02g009810          291   4e-96    Sorghum bicolor [broomcorn]
ref|XP_008440805.1|  PREDICTED: 60S ribosomal protein L8-3              291   5e-96    Cucumis melo [Oriental melon]
ref|XP_009401927.1|  PREDICTED: 60S ribosomal protein L8                291   5e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001067062.1|  Os12g0567700                                       291   5e-96    
gb|KDO71154.1|  hypothetical protein CISIN_1g037430mg                   289   5e-96    Citrus sinensis [apfelsine]
gb|KHF99003.1|  60S ribosomal L8-3 -like protein                        291   5e-96    Gossypium arboreum [tree cotton]
gb|ACG36992.1|  60S ribosomal protein L2                                291   5e-96    Zea mays [maize]
ref|XP_010237139.1|  PREDICTED: 60S ribosomal protein L8                291   5e-96    Brachypodium distachyon [annual false brome]
ref|XP_009109323.1|  PREDICTED: 60S ribosomal protein L8-3              291   6e-96    Brassica rapa
gb|KJB17672.1|  hypothetical protein B456_003G010500                    291   6e-96    Gossypium raimondii
gb|KFK40178.1|  hypothetical protein AALP_AA3G340400                    291   6e-96    Arabis alpina [alpine rockcress]
gb|AFK48547.1|  unknown                                                 290   8e-96    Medicago truncatula
ref|XP_010550457.1|  PREDICTED: 60S ribosomal protein L8-3-like         290   8e-96    Tarenaya hassleriana [spider flower]
ref|XP_009381986.1|  PREDICTED: 60S ribosomal protein L8-like           290   8e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010547429.1|  PREDICTED: 60S ribosomal protein L8-3              290   9e-96    Tarenaya hassleriana [spider flower]
gb|AAO23119.1|  ribosomal protein L2                                    287   9e-96    Brassica juncea [brown mustard]
ref|XP_003612146.1|  60S ribosomal protein L2                           290   1e-95    Medicago truncatula
ref|XP_004956031.1|  PREDICTED: 60S ribosomal protein L8-like           290   1e-95    Setaria italica
emb|CDY47054.1|  BnaAnng08420D                                          290   1e-95    Brassica napus [oilseed rape]
ref|XP_006412022.1|  hypothetical protein EUTSA_v10026029mg             290   1e-95    Eutrema salsugineum [saltwater cress]
ref|XP_002884102.1|  predicted protein                                  290   2e-95    Arabidopsis lyrata subsp. lyrata
emb|CDY25126.1|  BnaC07g03810D                                          288   3e-95    Brassica napus [oilseed rape]
ref|XP_006298239.1|  hypothetical protein CARUB_v10014300mg             290   3e-95    
ref|XP_010113368.1|  60S ribosomal protein L8                           289   3e-95    Morus notabilis
gb|KHG27748.1|  60S ribosomal L8-3 -like protein                        289   3e-95    Gossypium arboreum [tree cotton]
gb|EMT07940.1|  60S ribosomal protein L8                                289   3e-95    
ref|XP_010413173.1|  PREDICTED: 60S ribosomal protein L8-1 isofor...    289   4e-95    Camelina sativa [gold-of-pleasure]
gb|KJB40136.1|  hypothetical protein B456_007G048200                    289   4e-95    Gossypium raimondii
ref|XP_006284367.1|  hypothetical protein CARUB_v10005539mg             289   4e-95    Capsella rubella
ref|XP_010691536.1|  PREDICTED: 60S ribosomal protein L8-1              288   4e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006425513.1|  hypothetical protein CICLE_v10026308mg             288   5e-95    Citrus clementina [clementine]
emb|CDY38171.1|  BnaA07g02120D                                          288   5e-95    Brassica napus [oilseed rape]
ref|XP_002869043.1|  60S ribosomal protein L8                           288   5e-95    
ref|XP_003623912.1|  60S ribosomal protein L2                           288   6e-95    Medicago truncatula
gb|AIS93791.1|  60S ribosomal protein L8-3                              288   6e-95    Ziziphus jujuba [Chinese jujube]
ref|NP_195336.1|  60S ribosomal protein L8-3                            288   7e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007156128.1|  hypothetical protein PHAVU_003G261000g             288   7e-95    Phaseolus vulgaris [French bean]
ref|XP_010109570.1|  60S ribosomal protein L8                           288   1e-94    Morus notabilis
ref|XP_007157927.1|  hypothetical protein PHAVU_002G109700g             288   1e-94    Phaseolus vulgaris [French bean]
ref|NP_179393.1|  60S ribosomal protein L8-1                            287   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446820.1|  PREDICTED: 60S ribosomal protein L8-3-like         287   1e-94    Camelina sativa [gold-of-pleasure]
emb|CDY24796.1|  BnaA08g15140D                                          287   2e-94    Brassica napus [oilseed rape]
ref|XP_004512125.1|  PREDICTED: 60S ribosomal protein L8-like           287   2e-94    Cicer arietinum [garbanzo]
ref|XP_004492717.1|  PREDICTED: 60S ribosomal protein L8-3-like         287   2e-94    Cicer arietinum [garbanzo]
ref|XP_007225812.1|  hypothetical protein PRUPE_ppa010172mg             287   2e-94    Prunus persica
ref|XP_006409207.1|  hypothetical protein EUTSA_v10022820mg             287   2e-94    Eutrema salsugineum [saltwater cress]
ref|XP_010432197.1|  PREDICTED: 60S ribosomal protein L8-3              286   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_006380799.1|  hypothetical protein POPTR_0007s140402g            283   2e-94    
ref|XP_003547944.1|  PREDICTED: 60S ribosomal protein L8-3-like         286   2e-94    Glycine max [soybeans]
gb|ACU19917.1|  unknown                                                 286   2e-94    Glycine max [soybeans]
ref|XP_006847902.1|  hypothetical protein AMTR_s00029p00109050          286   4e-94    Amborella trichopoda
ref|XP_009138409.1|  PREDICTED: 60S ribosomal protein L8-3-like         286   6e-94    Brassica rapa
ref|XP_007157930.1|  hypothetical protein PHAVU_002G110000g             286   6e-94    Phaseolus vulgaris [French bean]
ref|XP_003517183.1|  PREDICTED: 60S ribosomal protein L8-3              285   8e-94    Glycine max [soybeans]
ref|XP_007213832.1|  hypothetical protein PRUPE_ppa010183mg             285   8e-94    Prunus persica
gb|ACU17029.1|  unknown                                                 285   8e-94    Glycine max [soybeans]
ref|XP_008383360.1|  PREDICTED: 60S ribosomal protein L8-3              285   8e-94    
ref|XP_003537629.1|  PREDICTED: 60S ribosomal protein L8-3-like         285   1e-93    Glycine max [soybeans]
ref|XP_008392283.1|  PREDICTED: 60S ribosomal protein L8-3-like         285   1e-93    Malus domestica [apple tree]
ref|NP_001136667.1|  hypothetical protein                               281   2e-93    
gb|ACN40978.1|  unknown                                                 284   3e-93    Picea sitchensis
ref|XP_009102287.1|  PREDICTED: 60S ribosomal protein L8-1              284   3e-93    Brassica rapa
gb|EMS54696.1|  60S ribosomal protein L8                                284   5e-93    Triticum urartu
ref|XP_004293702.1|  PREDICTED: 60S ribosomal protein L8-3              283   6e-93    Fragaria vesca subsp. vesca
gb|ABD33430.1|  Translation protein SH3-like                            279   8e-93    Medicago truncatula
ref|XP_008222449.1|  PREDICTED: 60S ribosomal protein L8-3              282   1e-92    Prunus mume [ume]
gb|ACN39952.1|  unknown                                                 282   2e-92    Picea sitchensis
gb|ACU24202.1|  unknown                                                 281   5e-92    Glycine max [soybeans]
ref|NP_001236274.1|  ribosomal protein L2                               280   9e-92    
gb|ACN40218.1|  unknown                                                 280   1e-91    Picea sitchensis
ref|XP_009136602.1|  PREDICTED: 60S ribosomal protein L8-1-like         280   2e-91    Brassica rapa
ref|XP_006403942.1|  hypothetical protein EUTSA_v10011106mg             279   2e-91    Eutrema salsugineum [saltwater cress]
emb|CDX90658.1|  BnaA03g41230D                                          278   4e-91    
gb|KFK30242.1|  hypothetical protein AALP_AA7G236100                    279   5e-91    Arabis alpina [alpine rockcress]
ref|XP_010515511.1|  PREDICTED: 60S ribosomal protein L8-2-like         276   4e-90    Camelina sativa [gold-of-pleasure]
emb|CDY35456.1|  BnaC03g62040D                                          276   6e-90    Brassica napus [oilseed rape]
emb|CDY29006.1|  BnaC07g32120D                                          275   1e-89    Brassica napus [oilseed rape]
ref|XP_002877791.1|  60S ribosomal protein L8                           275   1e-89    Arabidopsis lyrata subsp. lyrata
ref|XP_010426664.1|  PREDICTED: 60S ribosomal protein L8-2-like         275   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_006292747.1|  hypothetical protein CARUB_v10019000mg             272   1e-88    Capsella rubella
ref|XP_010503802.1|  PREDICTED: 60S ribosomal protein L8-2              272   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_002969950.1|  hypothetical protein SELMODRAFT_170971             270   8e-88    Selaginella moellendorffii
ref|XP_001759367.1|  predicted protein                                  270   1e-87    
ref|XP_009150832.1|  PREDICTED: 60S ribosomal protein L8-1-like         269   2e-87    
gb|AEX91926.1|  ribosomal protein L2                                    266   3e-87    Aegiceras corniculatum
gb|KFK34361.1|  hypothetical protein AALP_AA5G135500                    268   5e-87    Arabis alpina [alpine rockcress]
ref|NP_190687.2|  60S ribosomal protein L8-2                            268   7e-87    Arabidopsis thaliana [mouse-ear cress]
emb|CAB62641.1|  ribosomal protein L8 homolog                           267   9e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002440105.1|  hypothetical protein SORBIDRAFT_09g026110          266   3e-86    Sorghum bicolor [broomcorn]
emb|CAA60445.1|  60S ribosomal protein L2                               265   6e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004963645.1|  PREDICTED: 60S ribosomal protein L8-like           264   2e-85    Setaria italica
ref|XP_003559105.1|  PREDICTED: 60S ribosomal protein L8-like           260   7e-84    Brachypodium distachyon [annual false brome]
gb|EMT02913.1|  60S ribosomal protein L8                                258   7e-83    
tpg|DAA47081.1|  TPA: hypothetical protein ZEAMMB73_093162              255   5e-82    
tpg|DAA60348.1|  TPA: hypothetical protein ZEAMMB73_760140              253   2e-81    
ref|XP_001692985.1|  ribosomal protein L8, component of cytosolic...    245   4e-78    Chlamydomonas reinhardtii
ref|XP_002950895.1|  component of cytosolic 80S ribosome and 60S ...    242   6e-77    Volvox carteri f. nagariensis
gb|EPZ33659.1|  60S ribosomal protein L8                                241   2e-76    Rozella allomycis CSF55
gb|KFM82783.1|  60S ribosomal protein L8                                239   1e-75    Stegodyphus mimosarum
ref|XP_005191848.1|  PREDICTED: 60S ribosomal protein L8                238   2e-75    Musca domestica
ref|XP_005848475.1|  hypothetical protein CHLNCDRAFT_35106              236   9e-75    Chlorella variabilis
ref|XP_796001.1|  PREDICTED: 60S ribosomal protein L8-like              236   1e-74    Strongylocentrotus purpuratus [purple urchin]
ref|XP_002740227.1|  PREDICTED: 60S ribosomal protein L8-like iso...    236   1e-74    Saccoglossus kowalevskii
ref|XP_003060681.1|  predicted protein                                  236   2e-74    Micromonas pusilla CCMP1545
gb|KFH72591.1|  60S ribosomal protein L8                                235   3e-74    Mortierella verticillata NRRL 6337
ref|XP_002593183.1|  hypothetical protein BRAFLDRAFT_277869             235   4e-74    Branchiostoma floridae
ref|XP_002504932.1|  predicted protein                                  234   6e-74    Micromonas commoda
ref|XP_003385674.1|  PREDICTED: 60S ribosomal protein L8-like           234   9e-74    Amphimedon queenslandica
gb|ACO13132.1|  60S ribosomal protein L8                                234   9e-74    Lepeophtheirus salmonis
gb|KDR10917.1|  60S ribosomal protein L8                                234   1e-73    Zootermopsis nevadensis
tpg|DAA34056.1|  TPA: putative ribosomal protein L8e                    232   1e-73    Amblyomma variegatum
gb|KIY97177.1|  60S ribosomal protein L8                                233   2e-73    Monoraphidium neglectum
gb|AFY52355.1|  ribosomal protein L2                                    228   3e-73    Cyrtandra longifolia
ref|XP_002998398.1|  60S ribosomal protein L8, putative                 233   3e-73    Phytophthora infestans T30-4
gb|AFY52348.1|  ribosomal protein L2                                    228   3e-73    Cyrtandra hashimotoi
ref|XP_005646819.1|  ribosomal protein L8 component of cytosolic ...    233   4e-73    Coccomyxa subellipsoidea C-169
ref|XP_004341437.1|  ribosomal proteins l2, RNA binding domain co...    232   6e-73    Acanthamoeba castellanii str. Neff
ref|XP_008909337.1|  60S ribosomal protein                              232   7e-73    Phytophthora parasitica INRA-310
gb|ELU14121.1|  hypothetical protein CAPTEDRAFT_224611                  231   9e-73    Capitella teleta
ref|XP_011401819.1|  60S ribosomal protein L8                           231   1e-72    Auxenochlorella protothecoides
gb|AFY52372.1|  ribosomal protein L2                                    226   1e-72    Cyrtandra kealiae subsp. kealiae
gb|ABM55545.1|  putative ribosomal protein L8e                          231   1e-72    Maconellicoccus hirsutus [pink hibiscus mealybug]
emb|CAJ17248.1|  ribosomal protein L8e                                  230   1e-72    Meladema coriacea
gb|ACD65160.1|  putative 60S ribosomal protein RPL8                     230   1e-72    Phoronis muelleri
ref|XP_008478127.1|  PREDICTED: 60S ribosomal protein L8                231   2e-72    Diaphorina citri
gb|AFG29037.1|  ribosomal protein L8                                    230   2e-72    Merizodus soledadinus
ref|XP_009534555.1|  hypothetical protein PHYSODRAFT_338451             231   2e-72    Phytophthora sojae
ref|XP_003740440.1|  PREDICTED: 60S ribosomal protein L8-like           231   2e-72    Galendromus occidentalis
gb|AFY52388.1|  ribosomal protein L2                                    226   2e-72    Cyrtandra sp. Kului 2
gb|ABR27873.1|  60S ribosomal protein L8                                230   3e-72    Triatoma infestans
ref|XP_005832116.1|  large subunit ribosomal protein L8e, cytopla...    230   3e-72    Guillardia theta CCMP2712
ref|XP_011207468.1|  PREDICTED: 60S ribosomal protein L8                230   4e-72    Bactrocera dorsalis [papaya fruit fly]
gb|ADQ73877.1|  60S ribosomal protein L8                                230   4e-72    Laodelphax striatella
ref|XP_008554954.1|  PREDICTED: 60S ribosomal protein L8                229   6e-72    Microplitis demolitor
ref|XP_011305008.1|  PREDICTED: 60S ribosomal protein L8                229   7e-72    Fopius arisanus
ref|XP_002046631.1|  GJ12374                                            229   7e-72    Drosophila virilis
gb|ABO26687.1|  ribosomal protein l                                     229   8e-72    Haliotis discus discus
ref|XP_002067839.1|  GK12506                                            229   8e-72    Drosophila willistoni
gb|AGM32497.1|  60S ribosomal protein L8                                229   9e-72    Coptotermes formosanus
ref|XP_001354294.1|  GA11728                                            229   9e-72    Drosophila pseudoobscura pseudoobscura
ref|XP_011195824.1|  PREDICTED: 60S ribosomal protein L8                229   1e-71    
ref|XP_004525368.1|  PREDICTED: 60S ribosomal protein L8-like           229   1e-71    Ceratitis capitata [medfly]
ref|XP_003699499.1|  PREDICTED: 60S ribosomal protein L8-like           229   1e-71    Megachile rotundata
ref|XP_002007266.1|  GI12472                                            228   1e-71    Drosophila mojavensis
ref|XP_011154371.1|  PREDICTED: 60S ribosomal protein L8                228   2e-71    Harpegnathos saltator
ref|XP_967983.1|  PREDICTED: 60S ribosomal protein L8                   228   2e-71    Tribolium castaneum [rust-red flour beetle]
gb|AGF71018.1|  Ribosomol Protein L2                                    223   2e-71    Cyrtandra schizocalyx
ref|XP_393671.2|  PREDICTED: 60S ribosomal protein L8                   228   2e-71    Apis mellifera [bee]
gb|KDO30353.1|  60S ribosomal protein L8                                228   3e-71    Saprolegnia parasitica CBS 223.65
gb|EDL29627.1|  mCG131128, isoform CRA_c                                225   3e-71    Mus musculus [mouse]
ref|XP_003003318.1|  60S ribosomal protein L2                           228   3e-71    Verticillium alfalfae VaMs.102
ref|XP_003488525.1|  PREDICTED: 60S ribosomal protein L8-like           228   4e-71    
ref|NP_001080465.1|  60S ribosomal protein L8                           227   4e-71    Xenopus laevis [clawed frog]
ref|XP_004648827.1|  PREDICTED: 60S ribosomal protein L8-like           224   5e-71    Octodon degus
gb|KIK45298.1|  hypothetical protein CY34DRAFT_801802                   227   5e-71    Suillus luteus UH-Slu-Lm8-n1
ref|XP_002158217.1|  PREDICTED: 60S ribosomal protein L8-like           227   5e-71    Hydra vulgaris
ref|XP_001984329.1|  GH16390                                            227   5e-71    Drosophila grimshawi
gb|EAW82047.1|  ribosomal protein L8, isoform CRA_a                     224   5e-71    Homo sapiens [man]
gb|KHN00487.1|  60S ribosomal protein L8-3                              226   5e-71    Glycine soja [wild soybean]
ref|XP_005613443.1|  PREDICTED: 60S ribosomal protein L8                227   5e-71    
gb|AAX62427.1|  ribosomal protein L8                                    227   5e-71    Lysiphlebus testaceipes
gb|ACD65115.1|  putative 60S ribosomal protein RPL8                     225   6e-71    Novocrania anomala
dbj|BAG62679.1|  unnamed protein product                                224   6e-71    Homo sapiens [man]
gb|KIK65760.1|  hypothetical protein GYMLUDRAFT_159153                  226   7e-71    Gymnopus luxurians FD-317 M1
gb|EFA79851.1|  60S ribosomal protein L8                                226   7e-71    Heterostelium album PN500
ref|XP_004443046.1|  PREDICTED: 60S ribosomal protein L8                227   7e-71    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|AHB20200.1|  ribosomal protein L8                                    227   8e-71    Pelophylax nigromaculatus [black-spotted frog]
gb|AAW51390.1|  GekBS074P                                               223   8e-71    Gekko japonicus
ref|XP_002083372.1|  GD13692                                            226   8e-71    
ref|XP_011344215.1|  PREDICTED: 60S ribosomal protein L8                226   8e-71    Ooceraea biroi
ref|NP_524726.1|  ribosomal protein L8, isoform A                       226   9e-71    Drosophila melanogaster
ref|XP_008606117.1|  60S ribosomal protein L8                           226   1e-70    Saprolegnia diclina VS20
gb|ABW23214.1|  ribosomal protein rpl8                                  226   1e-70    Eurythoe complanata
emb|CDI97033.1|  60S ribosomal protein L8                               226   1e-70    Echinococcus multilocularis
ref|XP_007064510.1|  PREDICTED: 60S ribosomal protein L8-like iso...    226   1e-70    
gb|AAM94272.1|  ribosomal protein L8                                    224   1e-70    Azumapecten farreri [Farrer's scallop]
ref|XP_005301814.1|  PREDICTED: 60S ribosomal protein L8                226   1e-70    Chrysemys picta bellii
ref|XP_003398066.1|  PREDICTED: 60S ribosomal protein L8-like           226   1e-70    Bombus terrestris [large earth bumblebee]
ref|XP_005688829.1|  PREDICTED: 60S ribosomal protein L8                226   1e-70    
gb|ABZ04222.1|  ribosomal protein rpl8                                  224   2e-70    Lineus viridis
gb|ACR24945.1|  ribosomal protein L8                                    226   2e-70    Lepidochitona cinerea
gb|EUB59723.1|  60S ribosomal protein L8                                226   2e-70    Echinococcus granulosus
ref|XP_009556955.1|  PREDICTED: 60S ribosomal protein L8                225   2e-70    Cuculus canorus
ref|XP_008498553.1|  PREDICTED: 60S ribosomal protein L8 isoform X1     225   2e-70    Calypte anna
gb|ACH43811.1|  putative ribosomal protein L8                           225   2e-70    Taeniopygia guttata
gb|KFO69777.1|  60S ribosomal protein L8                                225   3e-70    Cuculus canorus
ref|NP_001232342.1|  putative ribosomal protein L8                      225   3e-70    Taeniopygia guttata
gb|KFV15691.1|  60S ribosomal protein L8                                225   3e-70    Tauraco erythrolophus
gb|KFP05901.1|  60S ribosomal protein L8                                225   3e-70    Calypte anna
ref|XP_005037305.1|  PREDICTED: 60S ribosomal protein L8-like iso...    226   3e-70    
gb|AEE62804.1|  unknown                                                 225   3e-70    Dendroctonus ponderosae
dbj|GAM25974.1|  hypothetical protein SAMD00019534_091490               225   3e-70    Acytostelium subglobosum LB1
ref|XP_011160596.1|  PREDICTED: 60S ribosomal protein L8                225   3e-70    Solenopsis invicta [imported red fire ant]
ref|XP_006015707.1|  PREDICTED: 60S ribosomal protein L8-like           225   3e-70    Alligator sinensis
ref|XP_009073685.1|  PREDICTED: 60S ribosomal protein L8 isoform X1     225   3e-70    Acanthisitta chloris
gb|KFO58581.1|  60S ribosomal protein L8                                225   3e-70    Corvus brachyrhynchos
ref|XP_001607020.1|  PREDICTED: 60S ribosomal protein L8                225   3e-70    Nasonia vitripennis
gb|KFP80671.1|  60S ribosomal protein L8                                225   3e-70    Acanthisitta chloris
ref|XP_006692773.1|  60S ribosomal protein L2-like protein              225   3e-70    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_011504452.1|  PREDICTED: 60S ribosomal protein L8                225   3e-70    Ceratosolen solmsi marchali
gb|KGL83381.1|  60S ribosomal protein L8                                225   4e-70    Tinamus guttatus
gb|KFQ69689.1|  60S ribosomal protein L8                                225   4e-70    Phaethon lepturus
ref|XP_001940537.1|  60S ribosomal protein L2                           226   4e-70    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_011254169.1|  PREDICTED: 60S ribosomal protein L8                225   4e-70    Camponotus floridanus
gb|KDQ29556.1|  hypothetical protein PLEOSDRAFT_1064355                 224   4e-70    Pleurotus ostreatus PC15
emb|CAX72065.1|  60S ribosomal protein L8                               222   5e-70    Schistosoma japonicum
emb|CEF97530.1|  Ribosomal protein L2, conserved site                   224   5e-70    Ostreococcus tauri
ref|XP_002383008.1|  60S ribosomal protein L2                           224   5e-70    Aspergillus flavus NRRL3357
emb|CAJ17246.1|  ribosomal protein L8e                                  224   5e-70    Biphyllus lunatus
ref|XP_003304522.1|  60S ribosomal protein L2                           224   5e-70    
emb|CAC93850.1|  ribosomal protein L8                                   224   5e-70    Paracentrotus lividus [common sea urchin]
gb|ACY71298.1|  ribosomal protein L8                                    224   6e-70    Chrysomela tremula
ref|NP_988925.1|  60S ribosomal protein L8                              224   6e-70    Xenopus tropicalis [western clawed frog]
emb|CCA17322.1|  60S ribosomal protein L8 putative                      224   6e-70    Albugo laibachii Nc14
emb|CDW57474.1|  60S ribosomal protein L8                               224   6e-70    Trichuris trichiura
gb|ERL84896.1|  hypothetical protein D910_02319                         225   6e-70    Dendroctonus ponderosae
ref|XP_007809468.1|  60S ribosomal protein L2                           224   6e-70    Metarhizium acridum CQMa 102
ref|XP_002482166.1|  60S ribosomal protein L2                           224   7e-70    Talaromyces stipitatus ATCC 10500
emb|CAJ17272.1|  ribosomal protein L8e                                  224   7e-70    Timarcha balearica
ref|XP_009225686.1|  60S ribosomal protein L2                           224   7e-70    Gaeumannomyces tritici R3-111a-1
gb|AAP88877.1|  ribosomal protein L8                                    224   7e-70    synthetic construct
gb|ETN58771.1|  60S ribosomal protein L8                                224   7e-70    Anopheles darlingi [American malaria mosquito]
gb|AAH12197.1|  Ribosomal protein L8                                    224   7e-70    Homo sapiens [man]
ref|XP_003663310.1|  60S ribosomal protein L2-like protein              224   8e-70    
gb|KIW09225.1|  60S ribosomal protein L2-B                              224   8e-70    
ref|NP_001155749.1|  60S ribosomal protein L8-like                      224   8e-70    
ref|XP_007464583.1|  PREDICTED: 60S ribosomal protein L8                224   8e-70    
gb|KIJ19808.1|  hypothetical protein PAXINDRAFT_166030                  224   9e-70    
ref|XP_005424919.1|  PREDICTED: 60S ribosomal protein L8-like           224   9e-70    
gb|KFB48277.1|  hypothetical protein ZHAS_00016403                      224   9e-70    
gb|ADT80693.1|  ribosomal protein L8                                    224   9e-70    
ref|XP_007862601.1|  60S ribosomal protein L2/L8                        224   1e-69    
dbj|BAE40270.1|  unnamed protein product                                224   1e-69    
gb|EFX70296.1|  hypothetical protein DAPPUDRAFT_231628                  224   1e-69    
gb|ACH43809.1|  putative ribosomal protein L8                           224   1e-69    
emb|CEJ01282.1|  Putative 60S ribosomal protein L2                      222   1e-69    
ref|XP_008326429.1|  PREDICTED: 60S ribosomal protein L8                224   1e-69    
gb|AAX29338.1|  ribosomal protein L8                                    224   1e-69    
ref|NP_000964.1|  60S ribosomal protein L8                              224   1e-69    
ref|XP_315817.2|  AGAP005802-PA                                         224   1e-69    
ref|XP_001884415.1|  60S ribosomal protein L2                           224   1e-69    
gb|ACH43810.1|  putative ribosomal protein L8                           224   1e-69    
ref|XP_010997030.1|  PREDICTED: 60S ribosomal protein L8                224   1e-69    
gb|KIK07667.1|  hypothetical protein K443DRAFT_673247                   223   1e-69    
gb|AAX48832.1|  L2/L8                                                   223   1e-69    
gb|ABW03354.1|  ribosomal protein L8                                    223   1e-69    
ref|XP_010786881.1|  PREDICTED: 60S ribosomal protein L8                223   1e-69    
ref|NP_001127510.1|  60S ribosomal protein L8                           223   1e-69    
ref|XP_003343679.1|  60S ribosomal protein L2                           223   1e-69    
emb|CCE30887.1|  probable 60S ribosomal protein L8.e                    223   1e-69    
emb|CAJ17249.1|  ribosomal protein L8e                                  223   1e-69    
ref|XP_002726116.1|  PREDICTED: 60S ribosomal protein L8                223   1e-69    
ref|XP_007843023.1|  60s ribosomal protein l2                           223   2e-69    
ref|XP_644192.1|  60S ribosomal protein L8                              223   2e-69    
ref|XP_001266002.1|  60S ribosomal protein L2                           223   2e-69    
ref|XP_009823382.1|  60S ribosomal protein L8                           223   2e-69    
ref|XP_957299.2|  60S ribosomal protein L2                              223   2e-69    
emb|CDS11433.1|  Putative 60S ribosomal protein L2                      223   2e-69    
ref|NP_001098379.1|  60S ribosomal protein L8                           223   2e-69    
emb|CEF62192.1|  60S ribosomal protein L8                               223   2e-69    
ref|XP_005091519.1|  PREDICTED: 60S ribosomal protein L8 isoform X3     223   2e-69    
ref|XP_006895186.1|  PREDICTED: 60S ribosomal protein L8-like           223   2e-69    
ref|XP_009891578.1|  PREDICTED: 60S ribosomal protein L8                223   2e-69    
ref|XP_001242138.1|  60S ribosomal protein L2                           223   2e-69    
ref|XP_007821986.1|  Ribosomal protein L2                               223   2e-69    
dbj|BAM17689.1|  ribosomal protein L8                                   223   2e-69    
gb|ABS57451.1|  ribosomal protein L8                                    222   2e-69    
emb|CDQ82511.1|  unnamed protein product                                223   2e-69    
emb|CAJ17247.1|  ribosomal protein L8e                                  223   2e-69    
ref|XP_003760524.1|  PREDICTED: 60S ribosomal protein L8-like           223   2e-69    
ref|XP_001364034.1|  PREDICTED: 60S ribosomal protein L8-like           223   2e-69    
gb|AFM88772.1|  60S ribosomal protein L8-like protein                   223   2e-69    
ref|XP_005395995.1|  PREDICTED: 60S ribosomal protein L8 isoform X1     224   2e-69    
ref|NP_001037141.1|  ribosomal protein L8                               223   3e-69    
gb|AFK10683.1|  60S ribosomal protein L8-like protein                   223   3e-69    
gb|EHJ74425.1|  ribosomal protein L8                                    223   3e-69    
gb|KIM42855.1|  hypothetical protein M413DRAFT_444500                   223   3e-69    
emb|CBK20206.2|  Ribosomal protein L2                                   223   3e-69    
emb|CAX83044.1|  60S ribosomal protein L8                               221   3e-69    
ref|XP_007834251.1|  60S ribosomal protein L2                           223   3e-69    
gb|ACY95331.1|  ribosomal protein L8                                    223   3e-69    
gb|AFM86426.1|  60S ribosomal protein L8-like protein                   223   3e-69    
ref|XP_007426563.1|  PREDICTED: 60S ribosomal protein L8-like iso...    223   3e-69    
gb|AEL28873.1|  ribosomal protein L8                                    223   3e-69    
ref|XP_006638953.1|  PREDICTED: 60S ribosomal protein L8-like           223   3e-69    
emb|CDO74170.1|  hypothetical protein BN946_scf185043.g221              223   3e-69    
ref|XP_007291505.1|  60S ribosomal protein L2                           223   3e-69    
emb|CDH59059.1|  60s ribosomal protein l2                               223   3e-69    
ref|XP_001417217.1|  Ribosomal protein L8, component of cytosolic...    223   3e-69    
ref|XP_002147944.1|  60S ribosomal protein L8, putative                 221   3e-69    
gb|KGL99875.1|  60S ribosomal protein L8                                223   3e-69    
gb|KFP31259.1|  60S ribosomal protein L8                                223   3e-69    
gb|AGN29659.1|  60S ribosomal protein L8                                223   3e-69    
ref|XP_006676755.1|  hypothetical protein BATDEDRAFT_32888              223   3e-69    
emb|CDS32687.1|  60S ribosomal protein L8                               237   3e-69    
gb|ACI68574.1|  60S ribosomal protein L8                                221   3e-69    
emb|CCQ18624.1|  60S ribosomal protein L2/L8                            222   3e-69    
ref|XP_001218018.1|  60S ribosomal protein L2                           222   4e-69    
dbj|BAE27085.1|  unnamed protein product                                222   4e-69    
gb|EHH64502.1|  60S ribosomal protein L8                                222   4e-69    
ref|XP_007392111.1|  hypothetical protein PHACADRAFT_191922             223   4e-69    
gb|KIM60775.1|  hypothetical protein SCLCIDRAFT_1216482                 222   4e-69    
ref|XP_007882390.1|  hypothetical protein PFL1_06653                    222   4e-69    
ref|XP_003837654.1|  similar to 60S ribosomal protein L2/L8             222   4e-69    
emb|CDH49679.1|  60s ribosomal protein l2                               223   4e-69    
ref|XP_001657711.1|  AAEL000987-PA                                      222   4e-69    
ref|XP_007372676.1|  60S large subunit ribosomal protein L2A            222   4e-69    
emb|CEG64963.1|  Putative 60S ribosomal protein L2                      222   4e-69    
ref|XP_004454647.1|  PREDICTED: 60S ribosomal protein L8                222   5e-69    
ref|XP_007954245.1|  PREDICTED: 60S ribosomal protein L8                222   5e-69    
gb|KIY71788.1|  ribosomal protein L2                                    222   5e-69    
ref|XP_753997.1|  60S ribosomal protein L8                              222   5e-69    
emb|CEG70401.1|  Putative 60S ribosomal protein L2                      222   5e-69    
ref|XP_008866291.1|  60S ribosomal protein L8                           222   5e-69    
ref|XP_003219006.2|  PREDICTED: 60S ribosomal protein L8                223   5e-69    
ref|XP_007268118.1|  ribosomal protein L2                               222   5e-69    
gb|EMS18520.1|  60S ribosomal protein l2                                222   6e-69    
gb|KIJ70605.1|  hypothetical protein HYDPIDRAFT_23698                   222   6e-69    
ref|XP_008027735.1|  hypothetical protein SETTUDRAFT_163975             222   6e-69    
ref|XP_003866688.1|  Rpl2 60S ribosomal protein L2                      222   6e-69    
dbj|BAN00314.1|  ribosomal protein L8                                   221   6e-69    
gb|KDR74469.1|  hypothetical protein GALMADRAFT_250439                  221   7e-69    
gb|EIE77970.1|  60S ribosomal protein L2                                221   7e-69    
ref|XP_003283424.1|  60S ribosomal protein L8                           221   7e-69    
ref|XP_007686815.1|  hypothetical protein COCMIDRAFT_4310               221   7e-69    
gb|EMD94966.1|  hypothetical protein COCHEDRAFT_1092909                 222   7e-69    
gb|KHJ40331.1|  Ribosomal Proteins L2, RNA binding domain protein       221   7e-69    
dbj|GAM36043.1|  protein component of the large 60S ribosomal sub...    222   7e-69    
ref|XP_003051763.1|  60S ribosomal protein L2                           221   7e-69    
gb|ABC48600.1|  ribosomal protein L8                                    221   7e-69    
ref|XP_003655282.1|  60S ribosomal protein L2                           221   7e-69    
ref|XP_001841927.1|  60S ribosomal protein L8                           222   7e-69    
ref|XP_011114790.1|  hypothetical protein H072_9155                     221   8e-69    
gb|KEZ41523.1|  hypothetical protein SAPIO_CDS7682                      221   8e-69    
emb|CAX78859.1|  60S ribosomal protein L8                               221   8e-69    
gb|EIF49989.1|  60s ribosomal protein l2                                221   8e-69    
ref|XP_001841263.1|  60S ribosomal protein L2                           221   8e-69    
dbj|GAD98557.1|  60S ribosomal protein L2                               221   8e-69    
ref|XP_002424997.1|  60S ribosomal protein L8, putative                 222   9e-69    
gb|ACN09867.1|  60S ribosomal protein L8                                221   9e-69    
gb|KHJ33848.1|  putative 60s ribosomal protein l2                       221   9e-69    
ref|NP_001279928.1|  ribosomal protein L8                               221   1e-68    
ref|XP_002544821.1|  60S ribosomal protein L2                           221   1e-68    
ref|XP_001908183.1|  hypothetical protein                               221   1e-68    
gb|KIW26666.1|  60S ribosomal protein L2-B                              221   1e-68    
ref|XP_002147943.1|  60S ribosomal protein L2                           221   1e-68    
ref|NP_957007.1|  60S ribosomal protein L8                              221   1e-68    
gb|KIO03087.1|  hypothetical protein M404DRAFT_633067                   221   1e-68    
emb|CCD31438.1|  ribosomal protein L8                                   221   1e-68    
gb|AAW25518.1|  SJCHGC01239 protein                                     221   1e-68    
ref|XP_009017482.1|  hypothetical protein HELRODRAFT_154764             221   1e-68    
gb|ACH70990.1|  ribosomal protein L8-1                                  221   1e-68    
emb|CCX32899.1|  Similar to 60S ribosomal protein L2; acc. no. Q7...    221   1e-68    
ref|NP_001271860.1|  uncharacterized protein LOC101866434               221   1e-68    
gb|ACN10341.1|  60S ribosomal protein L8                                221   1e-68    
gb|KGK36845.1|  hypothetical protein JL09_g4003                         221   1e-68    
gb|ACH70991.1|  ribosomal protein L8-2                                  221   1e-68    
gb|AFM89524.1|  60S ribosomal protein L8-like protein                   221   1e-68    
gb|KIX94270.1|  60S ribosomal protein L2-A                              221   1e-68    
gb|KDB17445.1|  60S ribosomal protein L2                                221   1e-68    
gb|EHK24690.1|  hypothetical protein TRIVIDRAFT_215647                  221   1e-68    
ref|XP_008280694.1|  PREDICTED: 60S ribosomal protein L8                221   1e-68    
ref|XP_004196582.1|  Piso0_003804                                       221   1e-68    
ref|XP_003451605.1|  PREDICTED: 60S ribosomal protein L8-like           221   1e-68    
gb|ABQ57487.1|  ribosomal protein L8                                    221   1e-68    
emb|CAX83046.1|  60S ribosomal protein L8                               221   1e-68    
ref|XP_010888281.1|  PREDICTED: 60S ribosomal protein L8                221   1e-68    
ref|XP_006788191.1|  PREDICTED: 60S ribosomal protein L8-like iso...    221   2e-68    
gb|AAP20209.1|  ribosomal protein L8                                    219   2e-68    
ref|XP_004203626.1|  Piso0_000642                                       221   2e-68    
gb|KJA21645.1|  hypothetical protein HYPSUDRAFT_87873                   221   2e-68    
dbj|BAJ96063.1|  predicted protein                                      221   2e-68    
emb|CAX72074.1|  60S ribosomal protein L8                               221   2e-68    
ref|XP_011326599.1|  60S ribosomal protein L2                           220   2e-68    
ref|XP_001387403.1|  60S ribosomal protein L2                           220   2e-68    
gb|KIW75426.1|  60S ribosomal protein L2-A                              220   2e-68    
ref|XP_006686293.1|  hypothetical protein CANTEDRAFT_134553             220   2e-68    
gb|AAD47076.1|AF164152_1  ribosomal protein L8                          221   2e-68    
ref|XP_005935904.1|  PREDICTED: 60S ribosomal protein L8-like iso...    221   2e-68    
tpe|CBF86515.1|  TPA: hypothetical protein similar to 60S ribosom...    220   2e-68    
ref|XP_002797891.1|  60S ribosomal protein L2                           220   2e-68    
ref|XP_010600484.1|  PREDICTED: 60S ribosomal protein L8                223   2e-68    
gb|AFQ22729.1|  ribosomal protein L8                                    220   2e-68    
ref|XP_007305535.1|  60S ribosomal protein L2/L8                        220   2e-68    
gb|AFA34382.1|  ribosomal protein L8                                    219   3e-68    
gb|KIW98414.1|  60S ribosomal protein L2-B                              220   3e-68    
ref|XP_005803043.1|  PREDICTED: 60S ribosomal protein L8-like           220   3e-68    
ref|XP_008035853.1|  60S ribosomal protein L2/L8                        220   3e-68    
gb|EFX02808.1|  60S ribosomal protein l2                                220   3e-68    
ref|XP_001398365.1|  60S ribosomal protein L2                           220   3e-68    
gb|AAV91388.1|  ribosomal protein 17                                    219   3e-68    
gb|EQL03571.1|  Ribosomal protein L2                                    220   3e-68    
ref|XP_001730486.1|  hypothetical protein MGL_2282                      220   3e-68    
ref|XP_004639702.1|  PREDICTED: 60S ribosomal protein L8-like           220   3e-68    
gb|KDQ12707.1|  hypothetical protein BOTBODRAFT_161253                  220   3e-68    
ref|XP_007912451.1|  putative 60s ribosomal protein l2 protein          220   3e-68    
ref|XP_010383481.1|  PREDICTED: 60S ribosomal protein L2-A-like         219   3e-68    
gb|EIF45281.1|  60s ribosomal protein                                   220   3e-68    
gb|KIK96113.1|  hypothetical protein PAXRUDRAFT_139195                  220   3e-68    
dbj|GAA89854.1|  60S ribosomal protein L2                               220   3e-68    
emb|CAF93691.1|  unnamed protein product                                222   3e-68    
gb|KIL67319.1|  hypothetical protein M378DRAFT_159734                   220   3e-68    
gb|EPB91658.1|  60S ribosomal protein L2                                220   3e-68    
dbj|BAO93696.1|  60S ribosomal protein L8                               220   3e-68    
ref|XP_457613.1|  60S ribosomal protein L2                              220   3e-68    
ref|XP_006880309.1|  PREDICTED: 60S ribosomal protein L8-like           220   3e-68    
ref|XP_004991040.1|  ribosomal protein L8                               220   3e-68    
ref|XP_003961670.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    220   3e-68    
gb|ADO29331.1|  60S ribosomal protein l8                                220   3e-68    
ref|XP_005091517.1|  PREDICTED: 60S ribosomal protein L8 isoform X1     221   3e-68    
gb|EPQ64880.1|  Protein component of the large (60S) ribosomal su...    220   3e-68    
emb|CAO94725.1|  putative ribosomal protein L8                          217   3e-68    
gb|AAN05596.1|  ribosomal protein L                                     220   3e-68    
gb|ABY28367.1|  ribosomal protein L8                                    220   4e-68    
sp|P41569.1|RL8_AEDAL  RecName: Full=60S ribosomal protein L8           220   4e-68    
ref|XP_505841.1|  60S ribosomal protein L2                              219   4e-68    
ref|XP_001273971.1|  60S ribosomal protein L2                           219   4e-68    
ref|XP_002417680.1|  60S ribosomal protein L2                           219   4e-68    
gb|ELR10371.1|  60S ribosomal protein L2                                219   5e-68    
gb|ESA06333.1|  hypothetical protein GLOINDRAFT_335890                  219   5e-68    
gb|EMD31841.1|  hypothetical protein CERSUDRAFT_119412                  219   5e-68    
gb|AFX64027.1|  60S ribosomal protein L8                                218   6e-68    
ref|XP_007280391.1|  60s ribosomal protein l2                           219   6e-68    
gb|KDN66527.1|  putative ribosomal Proteins L2 domain-containing ...    219   6e-68    
gb|EFQ24959.1|  ribosomal Proteins L2 domain-containing protein         219   6e-68    
emb|CEJ89262.1|  Putative 60S ribosomal protein L2                      219   6e-68    
ref|XP_008717534.1|  60S ribosomal protein L2                           219   6e-68    
gb|AGH70155.1|  60S ribosomal protein L8                                219   6e-68    
ref|XP_002475473.1|  60S ribosomal protein L2/L8                        219   7e-68    
emb|CCD59814.1|  60S ribosomal protein L8, putative                     219   7e-68    
gb|AIL48318.1|  large subunit ribosomal protein 2                       219   7e-68    
ref|XP_003717323.1|  60S ribosomal protein L2                           219   7e-68    
emb|CBJ28111.1|  conserved unknown protein                              219   7e-68    
ref|XP_007727608.1|  60S ribosomal protein L2                           219   7e-68    
ref|XP_006005896.1|  PREDICTED: 60S ribosomal protein L8-like           219   7e-68    
gb|KJB50868.1|  hypothetical protein B456_008G190400                    215   7e-68    
gb|AFX64009.1|  60S ribosomal protein L8                                218   7e-68    
gb|AFX64023.1|  60S ribosomal protein L8                                218   8e-68    
gb|KHN95120.1|  60S ribosomal protein L2                                219   8e-68    
ref|XP_007603322.1|  60S ribosomal protein L2                           219   8e-68    
ref|XP_002837284.1|  60S ribosomal protein L2                           220   9e-68    
gb|EPB83062.1|  60S ribosomal protein L2                                219   9e-68    
gb|KGQ12884.1|  60S ribosomal protein L2                                219   9e-68    
emb|CEP19372.1|  hypothetical protein                                   219   1e-67    



>ref|XP_009601677.1| PREDICTED: 60S ribosomal protein L8-like [Nicotiana tomentosiformis]
Length=260

 Score =   306 bits (784),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGV++EVIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVITEVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEHKV
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_006360110.1| PREDICTED: 60S ribosomal protein L8-like [Solanum tuberosum]
Length=260

 Score =   306 bits (783),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 145/152 (95%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGV++EVIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVITEVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            +TFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEHKV
Sbjct  61   ITFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  152



>ref|NP_001234115.1| 60S ribosomal protein L8 [Solanum lycopersicum]
 sp|P29766.1|RL8_SOLLC RecName: Full=60S ribosomal protein L8; AltName: Full=L2; AltName: 
Full=Ribosomal protein TL2 [Solanum lycopersicum]
 emb|CAA45863.1| ribosomal protein L2 [Solanum lycopersicum]
Length=260

 Score =   306 bits (783),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFR+LDFGERNGYLKGV++EVIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRTLDFGERNGYLKGVITEVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEHKV
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTR+KLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRVKLPS  152



>gb|ABB55374.1| ribosomal protein L2-like [Solanum tuberosum]
Length=261

 Score =   305 bits (782),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFR+LDFGERNGYLKGV++EVIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRTLDFGERNGYLKGVITEVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEHKV
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTR+KLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRVKLPS  152



>ref|XP_004244173.1| PREDICTED: 60S ribosomal protein L8-like [Solanum lycopersicum]
Length=260

 Score =   305 bits (780),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFR+LDFGERNGYLKGV++EVIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRTLDFGERNGYLKGVITEVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            +TFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEHKV
Sbjct  61   ITFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_009597412.1| PREDICTED: 60S ribosomal protein L8 [Nicotiana tomentosiformis]
 ref|XP_009769981.1| PREDICTED: 60S ribosomal protein L8 [Nicotiana sylvestris]
Length=260

 Score =   305 bits (780),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFR+LDFGERNGYLKGV++EVIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRTLDFGERNGYLKGVITEVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEHKV
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTR+KLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRVKLPS  152



>ref|XP_006362915.1| PREDICTED: 60S ribosomal protein L8-like [Solanum tuberosum]
Length=260

 Score =   305 bits (780),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFR+LDFGERNGYLKGV++EVIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRTLDFGERNGYLKGVITEVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEHKV
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTR+KLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRVKLPS  152



>ref|XP_009792898.1| PREDICTED: 60S ribosomal protein L8-like [Nicotiana sylvestris]
Length=260

 Score =   305 bits (780),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGV++EVIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVITEVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            +TFRHPFRY+HQKELF+AAEGMY+GQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEHKV
Sbjct  61   ITFRHPFRYKHQKELFVAAEGMYSGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  152



>gb|KDP41064.1| hypothetical protein JCGZ_03170 [Jatropha curcas]
Length=261

 Score =   303 bits (775),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGV++E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVITEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  152



>gb|KDP32235.1| hypothetical protein JCGZ_13842 [Jatropha curcas]
Length=261

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGV++E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVITEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FARCSGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGAFARCSGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_010246956.1| PREDICTED: 60S ribosomal protein L8 [Nelumbo nucifera]
Length=261

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E++HDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIVHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRS+PEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSVPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  152



>gb|EPS67154.1| hypothetical protein M569_07621, partial [Genlisea aurea]
Length=260

 Score =   302 bits (773),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRYQHQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYQHQKELFVAAEGMYTGQFVYCGKKANLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIV+SHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVVSHNPDNGTTRIKLPS  152



>ref|XP_006363509.1| PREDICTED: 60S ribosomal protein L8-like [Solanum tuberosum]
Length=260

 Score =   301 bits (771),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            +TFRHPFRY+HQKELF+AAEGMYTGQF+YCGKKA L+VGNVL LRSIPEGAVVCNVEHKV
Sbjct  61   MTFRHPFRYKHQKELFVAAEGMYTGQFIYCGKKANLMVGNVLALRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_004251488.1| PREDICTED: 60S ribosomal protein L8-like [Solanum lycopersicum]
Length=260

 Score =   301 bits (771),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            +TFRHPFRY+HQKELF+AAEGMYTGQF+YCGKKA L+VGNVL LRSIPEGAVVCNVEHKV
Sbjct  61   MTFRHPFRYKHQKELFVAAEGMYTGQFIYCGKKANLMVGNVLALRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_009602138.1| PREDICTED: 60S ribosomal protein L8-like [Nicotiana tomentosiformis]
 ref|XP_009789257.1| PREDICTED: 60S ribosomal protein L8-like [Nicotiana sylvestris]
Length=260

 Score =   301 bits (771),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLD+GERNGYLKGVVSE+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGVVSEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQF+YCGKKA L+VGNVL LRSIPEGAVVCNVEHKV
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFIYCGKKANLMVGNVLALRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  152



>gb|EYU19189.1| hypothetical protein MIMGU_mgv1a012096mg [Erythranthe guttata]
Length=261

 Score =   301 bits (770),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGS+FKSHTHHRKGPARFRSLDFGERNGYLKGV++E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSIFKSHTHHRKGPARFRSLDFGERNGYLKGVITEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFR+QHQKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRFQHQKELFVAAEGMYTGQFIYCGKKANLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FARCSGDYAIVISHNPDNGTTR+KLPS
Sbjct  121  GDRGSFARCSGDYAIVISHNPDNGTTRVKLPS  152



>ref|XP_006447449.1| hypothetical protein CICLE_v10016308mg [Citrus clementina]
 ref|XP_006469742.1| PREDICTED: 60S ribosomal protein L8-like [Citrus sinensis]
 gb|ESR60689.1| hypothetical protein CICLE_v10016308mg [Citrus clementina]
 gb|KDO47732.1| hypothetical protein CISIN_1g024947mg [Citrus sinensis]
Length=260

 Score =   301 bits (770),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGV++E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVITEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRYQHQKELF+AAEGMYTGQFVYCG+KA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYQHQKELFVAAEGMYTGQFVYCGRKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYA+VISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARCSGDYAVVISHNPDNDTTRIKLPS  152



>ref|XP_011095301.1| PREDICTED: 60S ribosomal protein L8-1 [Sesamum indicum]
 ref|XP_011097945.1| PREDICTED: 60S ribosomal protein L8-1 [Sesamum indicum]
Length=261

 Score =   301 bits (770),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFR+QHQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRFQHQKELFVAAEGMYTGQFVYCGKKANLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_002269409.1| PREDICTED: 60S ribosomal protein L8 [Vitis vinifera]
Length=260

 Score =   300 bits (767),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA LIVGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKATLIVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIV+SHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVVSHNPDNGTSRIKLPS  152



>sp|P25998.1|RL8_TOBAC RecName: Full=60S ribosomal protein L8; AltName: Full=60S ribosomal 
protein L2 [Nicotiana tabacum]
 emb|CAA44362.1| 60S ribosomal protein L2 [Nicotiana tabacum]
Length=260

 Score =   300 bits (767),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGR+IRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGV++EVIHDPGRGAPLAR
Sbjct  1    MGRLIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVITEVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFR+PFRY HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEHKV
Sbjct  61   VTFRYPFRYNHQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSG YAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARCSGAYAIVISHNPDNGTTRIKLPS  152



>ref|XP_010279131.1| PREDICTED: 60S ribosomal protein L8-like [Nelumbo nucifera]
Length=261

 Score =   299 bits (765),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E++HDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEILHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARSSGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_002515688.1| 60S ribosomal protein L8, putative [Ricinus communis]
 gb|EEF46635.1| 60S ribosomal protein L8, putative [Ricinus communis]
Length=261

 Score =   299 bits (765),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FARCSGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGSFARCSGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_002526326.1| 60S ribosomal protein L8, putative [Ricinus communis]
 gb|EEF36062.1| 60S ribosomal protein L8, putative [Ricinus communis]
Length=261

 Score =   298 bits (764),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FARCSGDYAIVISHNPDNGTTR+KLPS
Sbjct  121  GDRGAFARCSGDYAIVISHNPDNGTTRVKLPS  152



>ref|XP_010241006.1| PREDICTED: 60S ribosomal protein L8-like [Nelumbo nucifera]
Length=261

 Score =   298 bits (764),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E++HDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIVHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRS+PEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSVPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARSSGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_008454581.1| PREDICTED: 60S ribosomal protein L8 [Cucumis melo]
Length=260

 Score =   297 bits (761),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLDFGERNGYLKGVVSE+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDFGERNGYLKGVVSEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELFIAAEGMYTGQFVYCGKKA L+VGNVLP+R+IPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFIAAEGMYTGQFVYCGKKANLVVGNVLPIRAIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_004151970.1| PREDICTED: 60S ribosomal protein L8-like [Cucumis sativus]
 ref|XP_004160265.1| PREDICTED: 60S ribosomal protein L8-like [Cucumis sativus]
 gb|KGN57945.1| hypothetical protein Csa_3G403970 [Cucumis sativus]
Length=260

 Score =   297 bits (760),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLDFGERNGYLKGVVSE+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDFGERNGYLKGVVSEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELFIAAEGMYTGQFVYCGKKA L+VGNVLP+R+IPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFIAAEGMYTGQFVYCGKKANLVVGNVLPVRAIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_002281476.1| PREDICTED: 60S ribosomal protein L8 [Vitis vinifera]
 emb|CAN80494.1| hypothetical protein VITISV_021173 [Vitis vinifera]
Length=260

 Score =   297 bits (760),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKANLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDY+IV+SHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYSIVVSHNPDNGTSRIKLPS  152



>gb|EPS68269.1| hypothetical protein M569_06503, partial [Genlisea aurea]
Length=259

 Score =   297 bits (760),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRYQHQKELF+AAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGA+VCNVEH V
Sbjct  61   VTFRHPFRYQHQKELFVAAEGIYTGQFIYCGKKANLVVGNVLPLRSIPEGAIVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAI++SHN DNGTTRIKLPS
Sbjct  121  GDRGVFARASGDYAIIVSHNADNGTTRIKLPS  152



>ref|XP_002283149.1| PREDICTED: 60S ribosomal protein L8 [Vitis vinifera]
Length=260

 Score =   296 bits (757),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA L+VGNVLP+RSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGKKANLVVGNVLPVRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIV+SHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVVSHNPDNGTSRIKLPS  152



>ref|XP_007046725.1| Ribosomal protein L2 family [Theobroma cacao]
 gb|EOX90882.1| Ribosomal protein L2 family [Theobroma cacao]
Length=260

 Score =   295 bits (756),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+HTHHRKGPARFRSLDFGERNGYLKGVV+EVIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKAHTHHRKGPARFRSLDFGERNGYLKGVVTEVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNDTTRIKLPS  152



>ref|XP_010940992.1| PREDICTED: 60S ribosomal protein L8-like [Elaeis guineensis]
Length=261

 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLD+GERNGYLKGVV+++IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDYGERNGYLKGVVTDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELFIAAEGMYTGQFVYCG+KA+L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFIAAEGMYTGQFVYCGRKASLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNGTSRIKLPS  152



>ref|XP_011025941.1| PREDICTED: 60S ribosomal protein L8-3 [Populus euphratica]
Length=260

 Score =   295 bits (754),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRS+PEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSVPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRIKLPS  152



>emb|CDP05823.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   295 bits (754),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGA SVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGACSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVNEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRYQ QKELF+AAEGM+TGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEHK+
Sbjct  61   VSFRHPFRYQQQKELFVAAEGMFTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHKM  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_011043211.1| PREDICTED: 60S ribosomal protein L8-3 [Populus euphratica]
Length=260

 Score =   295 bits (754),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVNEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRS+PEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSVPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRIKLPS  152



>ref|XP_006387604.1| hypothetical protein POPTR_0789s00200g [Populus trichocarpa]
 gb|ABK93898.1| unknown [Populus trichocarpa]
 gb|ABK94853.1| unknown [Populus trichocarpa]
 gb|ERP46518.1| hypothetical protein POPTR_0789s00200g [Populus trichocarpa]
Length=260

 Score =   294 bits (752),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRS+PEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSVPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRIKLPS  152



>gb|ACG36313.1| 60S ribosomal protein L2 [Zea mays]
 gb|ACG37904.1| 60S ribosomal protein L2 [Zea mays]
 tpg|DAA47082.1| TPA: 60S ribosomal protein L2 [Zea mays]
 tpg|DAA55198.1| TPA: 60S ribosomal protein L2 [Zea mays]
Length=261

 Score =   293 bits (751),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L +GNVLPLR IPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPLRGIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  152



>ref|XP_006383123.1| ribosomal protein L2 [Populus trichocarpa]
 gb|ABK94183.1| unknown [Populus trichocarpa]
 gb|ERP60920.1| ribosomal protein L2 [Populus trichocarpa]
Length=260

 Score =   293 bits (751),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRS+PEGAVVCNVEH V
Sbjct  61   VSFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSVPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRIKLPS  152



>ref|XP_008777192.1| PREDICTED: 60S ribosomal protein L8-like [Phoenix dactylifera]
Length=261

 Score =   293 bits (751),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLD+GERNGY+KGVV+++IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDYGERNGYIKGVVTDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELFIAAEG+YTGQFVYCG+KA+L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFIAAEGIYTGQFVYCGRKASLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_010029697.1| PREDICTED: 60S ribosomal protein L8-3-like [Eucalyptus grandis]
 gb|KCW56656.1| hypothetical protein EUGRSUZ_I02360 [Eucalyptus grandis]
Length=261

 Score =   293 bits (751),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E++HDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEILHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTR+KLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRVKLPS  152



>ref|XP_011025942.1| PREDICTED: 60S ribosomal protein L8-1 [Populus euphratica]
Length=260

 Score =   293 bits (750),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            +TFRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRS+PEGAVVCNVEH V
Sbjct  61   ITFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSVPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRIKLPS  152



>ref|XP_008781786.1| PREDICTED: 60S ribosomal protein L8-like [Phoenix dactylifera]
Length=261

 Score =   293 bits (749),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLD+GERNGYLKGVV+++IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDYGERNGYLKGVVTDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELFIAAEG+YTGQF+YCG+KA+L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFIAAEGIYTGQFIYCGRKASLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_008785107.1| PREDICTED: 60S ribosomal protein L8 [Phoenix dactylifera]
Length=261

 Score =   293 bits (749),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLD+GERNGYLKGVV+++IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDYGERNGYLKGVVTDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELFIAAEG+YTGQF+YCG+KA+L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFIAAEGIYTGQFIYCGRKASLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_010033473.1| PREDICTED: 60S ribosomal protein L8-3 [Eucalyptus grandis]
 gb|KCW53130.1| hypothetical protein EUGRSUZ_J02422 [Eucalyptus grandis]
Length=260

 Score =   293 bits (749),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E++HDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIVHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_010920228.1| PREDICTED: 60S ribosomal protein L8-1 [Elaeis guineensis]
Length=261

 Score =   292 bits (748),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLD+GERNGYLKGVV+++IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDYGERNGYLKGVVTDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ QKELF+AAEGMYTGQFVYCG+KA+L+VGNVLPLRSIPEGAVVCN+EH V
Sbjct  61   VTFRHPFRYKKQKELFVAAEGMYTGQFVYCGRKASLMVGNVLPLRSIPEGAVVCNIEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDNGTTRIKLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNGTTRIKLPS  152



>ref|XP_006654068.1| PREDICTED: 60S ribosomal protein L8-like [Oryza brachyantha]
Length=261

 Score =   292 bits (748),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L +GNVLP+RS+PEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPIRSVPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  152



>ref|XP_004134871.1| PREDICTED: 60S ribosomal protein L8-like [Cucumis sativus]
 ref|XP_004158874.1| PREDICTED: 60S ribosomal protein L8-like [Cucumis sativus]
 gb|KGN48902.1| hypothetical protein Csa_6G505310 [Cucumis sativus]
Length=260

 Score =   292 bits (747),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ Q ELF+AAEGMYTGQFVYCGKKA L+VGNVLP+RSIPEGAVVCNVEH V
Sbjct  61   VSFRHPFRYKKQNELFVAAEGMYTGQFVYCGKKANLVVGNVLPVRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_010526791.1| PREDICTED: 60S ribosomal protein L8-3-like [Tarenaya hassleriana]
Length=260

 Score =   292 bits (747),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGK+A+L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKRASLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVI+HNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVIAHNPDNDTTRIKLPS  152



>ref|NP_001130582.1| 60S ribosomal protein L2 isoform 1 [Zea mays]
 gb|ACF78857.1| unknown [Zea mays]
 gb|ACG24789.1| 60S ribosomal protein L2 [Zea mays]
 gb|ACG24967.1| 60S ribosomal protein L2 [Zea mays]
 tpg|DAA60349.1| TPA: 60S ribosomal protein L2 isoform 1 [Zea mays]
 tpg|DAA60350.1| TPA: 60S ribosomal protein L2 isoform 2 [Zea mays]
Length=260

 Score =   292 bits (747),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L +GNVLPLR IPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPLRGIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  152



>gb|ACN36341.1| unknown [Zea mays]
Length=261

 Score =   291 bits (746),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYC ++A L +GNVLPLR IPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCARRATLSIGNVLPLRGIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  152



>dbj|BAJ89887.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86044.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87651.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=261

 Score =   291 bits (746),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L VGNVLPLRS+PEG V+CNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSVGNVLPLRSVPEGGVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  152



>ref|XP_009384636.1| PREDICTED: 60S ribosomal protein L8-like [Musa acuminata subsp. 
malaccensis]
Length=261

 Score =   291 bits (746),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLDFGERNGYLKGVV+E++HDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDFGERNGYLKGVVTEILHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ QKELFIAAEGMYTGQFVYCG+KA+L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKLQKELFIAAEGMYTGQFVYCGRKASLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNGTSRIKLPS  152



>ref|XP_009146753.1| PREDICTED: 60S ribosomal protein L8-3 [Brassica rapa]
Length=258

 Score =   291 bits (746),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VSFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDN TTR+KLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNDTTRVKLPS  152



>ref|XP_010548296.1| PREDICTED: 60S ribosomal protein L8-3-like [Tarenaya hassleriana]
Length=260

 Score =   291 bits (745),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGK+A+L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKRASLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVI+HNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVIAHNPDNDTTRIKLPS  152



>gb|KHG30041.1| 60S ribosomal L8-3 -like protein [Gossypium arboreum]
Length=260

 Score =   291 bits (745),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+HTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKAHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRIKLPS  152



>gb|KHG03835.1| 60S ribosomal L8-3 -like protein [Gossypium arboreum]
 gb|KJB70939.1| hypothetical protein B456_011G099200 [Gossypium raimondii]
Length=260

 Score =   291 bits (745),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+HTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKAHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRIKLPS  152



>ref|XP_010531080.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L8-3 [Tarenaya 
hassleriana]
Length=248

 Score =   291 bits (744),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGK+A+LIVGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKRASLIVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVI+HNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVIAHNPDNDTTRIKLPS  152



>ref|XP_002459748.1| hypothetical protein SORBIDRAFT_02g009810 [Sorghum bicolor]
 gb|EER96269.1| hypothetical protein SORBIDRAFT_02g009810 [Sorghum bicolor]
Length=261

 Score =   291 bits (745),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L +GNVLPLR IPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPLRGIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  152



>ref|XP_008440805.1| PREDICTED: 60S ribosomal protein L8-3 [Cucumis melo]
Length=260

 Score =   291 bits (745),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ Q ELF+AAEGMYTGQFVYCGKKA L+VGNVLP+RSIPEGAVVCNVEH V
Sbjct  61   VSFRHPFRYKKQNELFVAAEGMYTGQFVYCGKKANLVVGNVLPIRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARCSGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_009401927.1| PREDICTED: 60S ribosomal protein L8 [Musa acuminata subsp. malaccensis]
Length=261

 Score =   291 bits (745),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLDFGERNGYLKGV++E++HDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDFGERNGYLKGVITEILHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ QKELFIAAEGMYTGQFVYCG+KA+L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKLQKELFIAAEGMYTGQFVYCGRKASLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNGTSRIKLPS  152



>ref|NP_001067062.1| Os12g0567700 [Oryza sativa Japonica Group]
 pdb|3J61|A Chain A, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|ABA99598.1| 60S ribosomal protein L2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30081.1| Os12g0567700 [Oryza sativa Japonica Group]
 gb|EAY83561.1| hypothetical protein OsI_38771 [Oryza sativa Indica Group]
 gb|EAZ20909.1| hypothetical protein OsJ_36548 [Oryza sativa Japonica Group]
Length=261

 Score =   291 bits (745),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L +GNVLP+RS+PEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPIRSVPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  152



>gb|KDO71154.1| hypothetical protein CISIN_1g037430mg, partial [Citrus sinensis]
Length=198

 Score =   289 bits (739),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAQFRSLDFGERNGYLKGVVAEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY  QKELFIAAEGMYTGQFVYCGKKA L+VGNVLP+RSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYMKQKELFIAAEGMYTGQFVYCGKKATLMVGNVLPVRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYA++ISHNPDN TTR+KLPS
Sbjct  121  GDRGVLARASGDYAVIISHNPDNDTTRVKLPS  152



>gb|KHF99003.1| 60S ribosomal L8-3 -like protein [Gossypium arboreum]
Length=260

 Score =   291 bits (744),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+HTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKAHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRIKLPS  152



>gb|ACG36992.1| 60S ribosomal protein L2 [Zea mays]
Length=261

 Score =   291 bits (744),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVI AQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIHAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L +GNVLPLR IPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPLRGIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  152



>ref|XP_010237139.1| PREDICTED: 60S ribosomal protein L8 [Brachypodium distachyon]
Length=261

 Score =   291 bits (744),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L VGNVLPLRS+PEG V+CNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSVGNVLPLRSVPEGGVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  152



>ref|XP_009109323.1| PREDICTED: 60S ribosomal protein L8-3 [Brassica rapa]
Length=258

 Score =   291 bits (744),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVI+HNPDN TTR+KLPS
Sbjct  121  GDRGVFARASGDYAIVIAHNPDNDTTRVKLPS  152



>gb|KJB17672.1| hypothetical protein B456_003G010500 [Gossypium raimondii]
Length=260

 Score =   291 bits (744),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+HTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKAHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRIKLPS  152



>gb|KFK40178.1| hypothetical protein AALP_AA3G340400 [Arabis alpina]
Length=258

 Score =   291 bits (744),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRYQ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYQKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVI+HNPDN TTRIKLPS
Sbjct  121  GDRGVLARASGDYAIVIAHNPDNDTTRIKLPS  152



>gb|AFK48547.1| unknown [Medicago truncatula]
Length=256

 Score =   290 bits (743),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVNEIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ QKELF+AAEG+YTGQF+YCGKKA L+VGNVLPLR IPEGAV+CNVEH V
Sbjct  61   VTFRHPFRYKKQKELFVAAEGLYTGQFIYCGKKATLVVGNVLPLRMIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FARCSGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGAFARCSGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_010550457.1| PREDICTED: 60S ribosomal protein L8-3-like [Tarenaya hassleriana]
Length=258

 Score =   290 bits (743),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGK+A+L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKRASLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVI+HNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVIAHNPDNDTTRIKLPS  152



>ref|XP_009381986.1| PREDICTED: 60S ribosomal protein L8-like [Musa acuminata subsp. 
malaccensis]
Length=261

 Score =   290 bits (743),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ QKELFIAAEG+YTGQF+YCG+KA+L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKLQKELFIAAEGIYTGQFIYCGRKASLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNGTSRIKLPS  152



>ref|XP_010547429.1| PREDICTED: 60S ribosomal protein L8-3 [Tarenaya hassleriana]
Length=258

 Score =   290 bits (743),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGK+A+L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKRASLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVI+HNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVIAHNPDNDTTRIKLPS  152



>gb|AAO23119.1| ribosomal protein L2 [Brassica juncea]
Length=170

 Score =   287 bits (734),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VSFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGD AIVISHNPDN TTR+KLPS
Sbjct  121  GDRGVLARASGDCAIVISHNPDNDTTRVKLPS  152



>ref|XP_003612146.1| 60S ribosomal protein L2 [Medicago truncatula]
 gb|AES95104.1| 60S ribosomal L8-like protein [Medicago truncatula]
Length=258

 Score =   290 bits (742),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVNEIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ QKELF+AAEG+YTGQF+YCGKKA L+VGNVLPLR IPEGAV+CNVEH V
Sbjct  61   VTFRHPFRYKKQKELFVAAEGLYTGQFIYCGKKATLVVGNVLPLRMIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FARCSGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGAFARCSGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_004956031.1| PREDICTED: 60S ribosomal protein L8-like [Setaria italica]
 ref|XP_004962712.1| PREDICTED: 60S ribosomal protein L8-like [Setaria italica]
Length=261

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEG+YTGQF+YCG++A L +GNVLPLR IPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGIYTGQFIYCGRRATLSIGNVLPLRGIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  152



>emb|CDY47054.1| BnaAnng08420D [Brassica napus]
 emb|CDX72577.1| BnaC07g45990D [Brassica napus]
 emb|CDX69201.1| BnaC01g02520D [Brassica napus]
Length=258

 Score =   290 bits (742),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDN TTR+KLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNDTTRVKLPS  152



>ref|XP_006412022.1| hypothetical protein EUTSA_v10026029mg [Eutrema salsugineum]
 gb|ESQ53475.1| hypothetical protein EUTSA_v10026029mg [Eutrema salsugineum]
Length=258

 Score =   290 bits (742),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVI+HNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVIAHNPDNDTSRIKLPS  152



>ref|XP_002884102.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60361.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=258

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFR++ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRFKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVI+HNPDN TTRIKLPS
Sbjct  121  GDRGVLARASGDYAIVIAHNPDNDTTRIKLPS  152



>emb|CDY25126.1| BnaC07g03810D [Brassica napus]
 emb|CDY20905.1| BnaC06g01250D [Brassica napus]
Length=235

 Score =   288 bits (737),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLD+GERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLR+IPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRAIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNDTTRIKLPS  152



>ref|XP_006298239.1| hypothetical protein CARUB_v10014300mg [Capsella rubella]
 gb|EOA31137.1| hypothetical protein CARUB_v10014300mg [Capsella rubella]
Length=290

 Score =   290 bits (742),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  82   EMGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
             MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLA
Sbjct  32   SMGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLA  91

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RVTFRHPFR++ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH 
Sbjct  92   RVTFRHPFRFKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHH  151

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGDRGV AR SGDYAIVI+HNPDN TTRIKLPS
Sbjct  152  VGDRGVLARASGDYAIVIAHNPDNDTTRIKLPS  184



>ref|XP_010113368.1| 60S ribosomal protein L8 [Morus notabilis]
 gb|EXC35375.1| 60S ribosomal protein L8 [Morus notabilis]
Length=260

 Score =   289 bits (740),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGV++++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVITDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ Q ELF+AAEGMYTGQFVYCGKKA L+VGNVLP+RSIPEGAV+CNVEH V
Sbjct  61   VSFRHPFRYKKQNELFVAAEGMYTGQFVYCGKKATLVVGNVLPIRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFARCSGDYA+VISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARCSGDYAVVISHNPDNDTSRIKLPS  152



>gb|KHG27748.1| 60S ribosomal L8-3 -like protein [Gossypium arboreum]
Length=260

 Score =   289 bits (739),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKG ARFRSLDFGERNGYLKGVV+EVIHDPGRGAPL R
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGAARFRSLDFGERNGYLKGVVTEVIHDPGRGAPLVR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRIKLPS  152



>gb|EMT07940.1| 60S ribosomal protein L8 [Aegilops tauschii]
Length=261

 Score =   289 bits (739),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L VGN LPLRS+PEG V+CNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSVGNGLPLRSVPEGGVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  152



>ref|XP_010413173.1| PREDICTED: 60S ribosomal protein L8-1 isoform X1 [Camelina sativa]
 ref|XP_010413181.1| PREDICTED: 60S ribosomal protein L8-1 isoform X2 [Camelina sativa]
 ref|XP_010413191.1| PREDICTED: 60S ribosomal protein L8-1 [Camelina sativa]
 ref|XP_010467600.1| PREDICTED: 60S ribosomal protein L8-1 isoform X1 [Camelina sativa]
 ref|XP_010467601.1| PREDICTED: 60S ribosomal protein L8-1 isoform X2 [Camelina sativa]
 ref|XP_010489445.1| PREDICTED: 60S ribosomal protein L8-1 [Camelina sativa]
Length=258

 Score =   289 bits (739),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFR++ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRFKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVI+HNPDN TTR+KLPS
Sbjct  121  GDRGVLARASGDYAIVIAHNPDNDTTRVKLPS  152



>gb|KJB40136.1| hypothetical protein B456_007G048200 [Gossypium raimondii]
Length=260

 Score =   289 bits (739),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKG ARFRSLDFGERNGYLKGVV+EVIHDPGRGAPL R
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGAARFRSLDFGERNGYLKGVVTEVIHDPGRGAPLVR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VVFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKATLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTTRIKLPS  152



>ref|XP_006284367.1| hypothetical protein CARUB_v10005539mg [Capsella rubella]
 gb|EOA17265.1| hypothetical protein CARUB_v10005539mg [Capsella rubella]
Length=258

 Score =   289 bits (739),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFR++ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VAFRHPFRFKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVI+HNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVIAHNPDNDTSRIKLPS  152



>ref|XP_010691536.1| PREDICTED: 60S ribosomal protein L8-1 [Beta vulgaris subsp. vulgaris]
Length=260

 Score =   288 bits (738),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKG A+FR+LDFGERNGYLKGV++E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGAAKFRTLDFGERNGYLKGVITEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMY+GQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYSGQFVYCGKKANLMVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_006425513.1| hypothetical protein CICLE_v10026308mg [Citrus clementina]
 ref|XP_006466932.1| PREDICTED: 60S ribosomal protein L8-like [Citrus sinensis]
 gb|ESR38753.1| hypothetical protein CICLE_v10026308mg [Citrus clementina]
Length=260

 Score =   288 bits (738),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAQFRSLDFGERNGYLKGVVAEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY  QKELFIAAEGMYTGQFVYCGKKA L+VGNVLP+RSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYMKQKELFIAAEGMYTGQFVYCGKKATLMVGNVLPVRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYA++ISHNPDN TTR+KLPS
Sbjct  121  GDRGVLARASGDYAVIISHNPDNDTTRVKLPS  152



>emb|CDY38171.1| BnaA07g02120D [Brassica napus]
Length=235

 Score =   288 bits (736),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLD+GERNGYLKGVV+E+IHDPGRG+PLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGVVTEIIHDPGRGSPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLR+IPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRAIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNDTTRIKLPS  152



>ref|XP_002869043.1| 60S ribosomal protein L8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45302.1| 60S ribosomal protein L8 [Arabidopsis lyrata subsp. lyrata]
Length=258

 Score =   288 bits (738),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFR++ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VAFRHPFRFKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVI+HNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVIAHNPDNDTSRIKLPS  152



>ref|XP_003623912.1| 60S ribosomal protein L2 [Medicago truncatula]
 gb|AES80130.1| 60S ribosomal L8-like protein [Medicago truncatula]
 gb|AFK37098.1| unknown [Medicago truncatula]
Length=259

 Score =   288 bits (737),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRYQ QKELF+AAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVE  V
Sbjct  61   VTFRHPFRYQKQKELFVAAEGLYTGQFIYCGKKATLVVGNVLPLRSIPEGAVICNVEGHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>gb|AIS93791.1| 60S ribosomal protein L8-3 [Ziziphus jujuba]
Length=260

 Score =   288 bits (737),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFIYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDN TTR+KLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNDTTRVKLPS  152



>ref|NP_195336.1| 60S ribosomal protein L8-3 [Arabidopsis thaliana]
 sp|Q42064.2|RL83_ARATH RecName: Full=60S ribosomal protein L8-3 [Arabidopsis thaliana]
 gb|AAK32778.1|AF361610_1 AT4g36130/F23E13_20 [Arabidopsis thaliana]
 gb|AAK32922.1|AF367335_1 AT4g36130/F23E13_20 [Arabidopsis thaliana]
 emb|CAA18119.1| putative ribosomal protein L8 [Arabidopsis thaliana]
 emb|CAA18507.1| ribosomal protein L2 [Arabidopsis thaliana]
 emb|CAB81522.1| putative ribosomal protein L8 [Arabidopsis thaliana]
 gb|AAL15395.1| AT4g36130/F23E13_20 [Arabidopsis thaliana]
 gb|AEE86623.1| 60S ribosomal protein L8-3 [Arabidopsis thaliana]
Length=258

 Score =   288 bits (737),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFR++ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   VAFRHPFRFKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVI+HNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVIAHNPDNDTSRIKLPS  152



>ref|XP_007156128.1| hypothetical protein PHAVU_003G261000g [Phaseolus vulgaris]
 ref|XP_007156155.1| hypothetical protein PHAVU_003G262900g [Phaseolus vulgaris]
 gb|ESW28122.1| hypothetical protein PHAVU_003G261000g [Phaseolus vulgaris]
 gb|ESW28149.1| hypothetical protein PHAVU_003G262900g [Phaseolus vulgaris]
Length=260

 Score =   288 bits (737),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ Q ELF+AAEG+YTGQF+YCGKKA L+VGNVLP+RSIPEGAV+CNVEH V
Sbjct  61   VTFRHPFRYKKQNELFVAAEGLYTGQFIYCGKKATLVVGNVLPIRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_010109570.1| 60S ribosomal protein L8 [Morus notabilis]
 gb|EXC23174.1| 60S ribosomal protein L8 [Morus notabilis]
Length=261

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGY+KGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYIKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPL SIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKLQKELFVAAEGMYTGQFVYCGKKANLVVGNVLPLGSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYA+VISHNPDNGTTRIKLPS
Sbjct  121  GDRGVIARASGDYAVVISHNPDNGTTRIKLPS  152



>ref|XP_007157927.1| hypothetical protein PHAVU_002G109700g [Phaseolus vulgaris]
 gb|AGV54405.1| 60S ribosomal protein L8-3-like protein [Phaseolus vulgaris]
 gb|AGV54483.1| 60S ribosomal protein L8-3-like protein [Phaseolus vulgaris]
 gb|ESW29921.1| hypothetical protein PHAVU_002G109700g [Phaseolus vulgaris]
Length=261

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ Q ELF++AEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   VTFRHPFRYKKQTELFVSAEGLYTGQFLYCGKKATLVVGNVLPLRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>ref|NP_179393.1| 60S ribosomal protein L8-1 [Arabidopsis thaliana]
 sp|P46286.2|RL81_ARATH RecName: Full=60S ribosomal protein L8-1; AltName: Full=60S ribosomal 
protein L2; AltName: Full=Protein EMBRYO DEFECTIVE 
2296 [Arabidopsis thaliana]
 gb|AAD20124.1| 60S ribosomal protein L2 [Arabidopsis thaliana]
 gb|AAM91517.1| 60S ribosomal protein L2 [Arabidopsis thaliana]
 gb|AAN65064.1| 60S ribosomal protein L2 [Arabidopsis thaliana]
 gb|AEC06716.1| ribosomal protein L2 family protein [Arabidopsis thaliana]
Length=258

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFR++ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRFKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVI+HNPD+ TTRIKLPS
Sbjct  121  GDRGVLARASGDYAIVIAHNPDSDTTRIKLPS  152



>ref|XP_010446820.1| PREDICTED: 60S ribosomal protein L8-3-like [Camelina sativa]
Length=258

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFR++ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VSFRHPFRFKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVI+HNPDN T+RIKLPS
Sbjct  121  GDRGVLARASGDYAIVIAHNPDNDTSRIKLPS  152



>emb|CDY24796.1| BnaA08g15140D [Brassica napus]
Length=258

 Score =   287 bits (734),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVI+H PDN TTR+KLPS
Sbjct  121  GDRGVFARASGDYAIVIAHIPDNDTTRVKLPS  152



>ref|XP_004512125.1| PREDICTED: 60S ribosomal protein L8-like [Cicer arietinum]
Length=261

 Score =   287 bits (734),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGV++++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVITDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ Q ELF+AAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   VSFRHPFRYKKQSELFVAAEGIYTGQFIYCGKKATLVVGNVLPLRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FARCSGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGAFARCSGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_004492717.1| PREDICTED: 60S ribosomal protein L8-3-like [Cicer arietinum]
Length=260

 Score =   287 bits (734),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ Q ELF+AAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   VTFRHPFRYKKQNELFVAAEGLYTGQFIYCGKKATLVVGNVLPLRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGAFARASGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_007225812.1| hypothetical protein PRUPE_ppa010172mg [Prunus persica]
 gb|EMJ27011.1| hypothetical protein PRUPE_ppa010172mg [Prunus persica]
Length=260

 Score =   287 bits (734),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ Q ELF+AAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VSFRHPFRYKKQNELFVAAEGIYTGQFIYCGKKANLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYA+VISHNPDN T+RIKLPS
Sbjct  121  GDRGVLARASGDYAVVISHNPDNDTSRIKLPS  152



>ref|XP_006409207.1| hypothetical protein EUTSA_v10022820mg [Eutrema salsugineum]
 gb|ESQ50660.1| hypothetical protein EUTSA_v10022820mg [Eutrema salsugineum]
Length=258

 Score =   287 bits (734),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLR+IPEGAVVCNVEH V
Sbjct  61   VSFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRAIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVI+HNPD+ TTRIKLPS
Sbjct  121  GDRGVLARASGDYAIVIAHNPDSDTTRIKLPS  152



>ref|XP_010432197.1| PREDICTED: 60S ribosomal protein L8-3 [Camelina sativa]
 ref|XP_010437373.1| PREDICTED: 60S ribosomal protein L8-3 isoform X1 [Camelina sativa]
 ref|XP_010437374.1| PREDICTED: 60S ribosomal protein L8-3 isoform X2 [Camelina sativa]
Length=258

 Score =   286 bits (733),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFR++ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   VSFRHPFRFKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVI+HNPDN T+RIKLPS
Sbjct  121  GDRGVLARASGDYAIVIAHNPDNDTSRIKLPS  152



>ref|XP_006380799.1| hypothetical protein POPTR_0007s140402g, partial [Populus trichocarpa]
 gb|ERP58596.1| hypothetical protein POPTR_0007s140402g, partial [Populus trichocarpa]
Length=146

 Score =   283 bits (723),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA L+VGNVLPLRS+PEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKANLMVGNVLPLRSVPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTT  522
            GDRGVFAR SGDYAIVISHNPDN TT
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTT  146



>ref|XP_003547944.1| PREDICTED: 60S ribosomal protein L8-3-like [Glycine max]
 gb|KHN34297.1| 60S ribosomal protein L8-3 [Glycine soja]
Length=260

 Score =   286 bits (733),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ Q ELFIAAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   VAFRHPFRYKKQNELFIAAEGLYTGQFIYCGKKATLVVGNVLPLRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>gb|ACU19917.1| unknown [Glycine max]
Length=260

 Score =   286 bits (733),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ Q ELFIAAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   VAFRHPFRYKKQNELFIAAEGLYTGQFIYCGKKATLVVGNVLPLRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_006847902.1| hypothetical protein AMTR_s00029p00109050 [Amborella trichopoda]
 gb|ERN09483.1| hypothetical protein AMTR_s00029p00109050 [Amborella trichopoda]
Length=261

 Score =   286 bits (732),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLD+GERNGYLKGVV++VIHDPGRGAPL +
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDYGERNGYLKGVVTDVIHDPGRGAPLCK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ QKELF+AAEGMYTGQFVYCGKKA LIVGNVLPLRSIPEGAVVCNVEH  
Sbjct  61   VSFRHPFRYKIQKELFVAAEGMYTGQFVYCGKKANLIVGNVLPLRSIPEGAVVCNVEHHA  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FAR SGDY IVISHNPDNGTTRIKLPS
Sbjct  121  GDRGSFARASGDYCIVISHNPDNGTTRIKLPS  152



>ref|XP_009138409.1| PREDICTED: 60S ribosomal protein L8-3-like [Brassica rapa]
Length=258

 Score =   286 bits (731),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERN YLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNVYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLR+IPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRAIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVISHNPDN TTR+KLPS
Sbjct  121  GDRGVLARASGDYAIVISHNPDNDTTRVKLPS  152



>ref|XP_007157930.1| hypothetical protein PHAVU_002G110000g [Phaseolus vulgaris]
 gb|ESW29924.1| hypothetical protein PHAVU_002G110000g [Phaseolus vulgaris]
Length=261

 Score =   286 bits (731),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKG GSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGGGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+ Q ELF++AEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   VTFRHPFRYKKQTELFVSAEGLYTGQFLYCGKKATLVVGNVLPLRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_003517183.1| PREDICTED: 60S ribosomal protein L8-3 [Glycine max]
Length=261

 Score =   285 bits (730),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ Q ELF+AAEG+YTGQFVYCGKKA L+VGNVLP+RSIPEGAV+CNVEH V
Sbjct  61   VAFRHPFRYKKQTELFVAAEGLYTGQFVYCGKKATLVVGNVLPIRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_007213832.1| hypothetical protein PRUPE_ppa010183mg [Prunus persica]
 ref|XP_008225691.1| PREDICTED: 60S ribosomal protein L8-3-like [Prunus mume]
 gb|EMJ15031.1| hypothetical protein PRUPE_ppa010183mg [Prunus persica]
Length=260

 Score =   285 bits (730),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ Q ELF+AAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VSFRHPFRYKKQNELFVAAEGIYTGQFIYCGKKANLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYA+VISHNPDN T+RIKLPS
Sbjct  121  GDRGTLARASGDYAVVISHNPDNDTSRIKLPS  152



>gb|ACU17029.1| unknown [Glycine max]
Length=261

 Score =   285 bits (730),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ Q ELF+AAEG+YTGQFVYCGKKA L+VGNVLP+RSIPEGAV+CNVEH V
Sbjct  61   VAFRHPFRYKKQTELFVAAEGLYTGQFVYCGKKATLVVGNVLPIRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_008383360.1| PREDICTED: 60S ribosomal protein L8-3 [Malus domestica]
 ref|XP_008383361.1| PREDICTED: 60S ribosomal protein L8-3 [Malus domestica]
 ref|XP_008392284.1| PREDICTED: 60S ribosomal protein L8-3 [Malus domestica]
 ref|XP_008349141.1| PREDICTED: 60S ribosomal protein L8-3 [Malus domestica]
 ref|XP_008349142.1| PREDICTED: 60S ribosomal protein L8-3 [Malus domestica]
 ref|XP_009353876.1| PREDICTED: 60S ribosomal protein L8-3 [Pyrus x bretschneideri]
 ref|XP_009353877.1| PREDICTED: 60S ribosomal protein L8-3 [Pyrus x bretschneideri]
 ref|XP_009362167.1| PREDICTED: 60S ribosomal protein L8-3 [Pyrus x bretschneideri]
 ref|XP_009362168.1| PREDICTED: 60S ribosomal protein L8-3 [Pyrus x bretschneideri]
Length=259

 Score =   285 bits (730),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ Q ELF+AAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VSFRHPFRYKKQNELFVAAEGIYTGQFIYCGKKANLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYA+VISHNPDN T+RIKLPS
Sbjct  121  GDRGTLARASGDYAVVISHNPDNDTSRIKLPS  152



>ref|XP_003537629.1| PREDICTED: 60S ribosomal protein L8-3-like [Glycine max]
Length=261

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ Q ELF+AAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   VAFRHPFRYKKQMELFVAAEGLYTGQFIYCGKKATLVVGNVLPLRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>ref|XP_008392283.1| PREDICTED: 60S ribosomal protein L8-3-like [Malus domestica]
Length=259

 Score =   285 bits (728),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ Q ELF+AAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VSFRHPFRYKKQNELFVAAEGIYTGQFIYCGKKANLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYA+VISHNPDN T+R+KLPS
Sbjct  121  GDRGTLARASGDYAVVISHNPDNDTSRVKLPS  152



>ref|NP_001136667.1| hypothetical protein [Zea mays]
 gb|ACF82369.1| unknown [Zea mays]
 tpg|DAA47083.1| TPA: hypothetical protein ZEAMMB73_093162 [Zea mays]
Length=160

 Score =   281 bits (719),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L +GNVLPLR IPEGAVVCNVEH V
Sbjct  61   VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPLRGIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTR  525
            GDRGVFAR SGDYAIVISHNPDNGT+R
Sbjct  121  GDRGVFARASGDYAIVISHNPDNGTSR  147



>gb|ACN40978.1| unknown [Picea sitchensis]
 gb|ACN41095.1| unknown [Picea sitchensis]
 gb|ACN41124.1| unknown [Picea sitchensis]
Length=261

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHTHHRKGPARFRSLD+GERNGY+KG+VS+VIHDPGRGAPL +
Sbjct  1    MGRVIRAQRKGAGSVFRSHTHHRKGPARFRSLDYGERNGYIKGIVSDVIHDPGRGAPLCK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRY+HQKELF+AAEGMYTGQFVYCGKKA LIVGNVLPLRSIPEGA+VCNVE  V
Sbjct  61   VTFRHPFRYRHQKELFVAAEGMYTGQFVYCGKKANLIVGNVLPLRSIPEGAIVCNVEQHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FAR SGDYAIV+SHN DNGT+RIKLPS
Sbjct  121  GDRGSFARASGDYAIVVSHNFDNGTSRIKLPS  152



>ref|XP_009102287.1| PREDICTED: 60S ribosomal protein L8-1 [Brassica rapa]
Length=258

 Score =   284 bits (726),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLD+GERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQF+YCGK+A L+VGNVLPLR+IPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFLYCGKRATLVVGNVLPLRAIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  GDRGGLARASGDYAIVISHNPDNDTTRIKLPS  152



>gb|EMS54696.1| 60S ribosomal protein L8 [Triticum urartu]
Length=270

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 147/161 (91%), Gaps = 9/161 (6%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNG---------YLKGVVSEVIHD  237
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNG         YLKGVV++VIHD
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGSLDFGERNGYLKGVVTDVIHD  60

Query  238  PGRGAPLARVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGA  417
            PGRGAPLA+VTFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L VGNVLPLRS+PEG 
Sbjct  61   PGRGAPLAKVTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSVGNVLPLRSVPEGG  120

Query  418  VVCNVEHKVGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            V+CNVEH VGDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  121  VICNVEHHVGDRGVFARASGDYAIVISHNPDNGTSRIKLPS  161



>ref|XP_004293702.1| PREDICTED: 60S ribosomal protein L8-3 [Fragaria vesca subsp. 
vesca]
 ref|XP_004296511.1| PREDICTED: 60S ribosomal protein L8-3 [Fragaria vesca subsp. 
vesca]
Length=258

 Score =   283 bits (724),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FRHPFRY+ Q ELF+AAEG+YTGQF+YCGKKA L+VGNVLP+RSIPEGAVVCNVEH V
Sbjct  61   VSFRHPFRYKKQNELFVAAEGIYTGQFIYCGKKANLVVGNVLPIRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYA+VISHNPDN T+RIKLPS
Sbjct  121  GDRGTLARASGDYAVVISHNPDNDTSRIKLPS  152



>gb|ABD33430.1| Translation protein SH3-like [Medicago truncatula]
Length=155

 Score =   279 bits (713),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFRYQ QKELF+AAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVE  V
Sbjct  61   VTFRHPFRYQKQKELFVAAEGLYTGQFIYCGKKATLVVGNVLPLRSIPEGAVICNVEGHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRI  528
            GDRGVFAR SGDYAIVISHNPDN T+R 
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRF  148



>ref|XP_008222449.1| PREDICTED: 60S ribosomal protein L8-3 [Prunus mume]
Length=261

 Score =   282 bits (722),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKG-VVSEVIHDPGRGAPLA  261
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKG VV+E+IHDPGRGAPLA
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGGVVTEIIHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RV+FRHPFRY+ Q ELF+AAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH 
Sbjct  61   RVSFRHPFRYKKQNELFVAAEGIYTGQFIYCGKKANLVVGNVLPLRSIPEGAVVCNVEHH  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGDRGV AR SGDYA+VISHNPDN T+RIKLPS
Sbjct  121  VGDRGVLARASGDYAVVISHNPDNDTSRIKLPS  153



>gb|ACN39952.1| unknown [Picea sitchensis]
 gb|ACN40325.1| unknown [Picea sitchensis]
 gb|ACN40729.1| unknown [Picea sitchensis]
Length=259

 Score =   282 bits (721),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF SHTHHRKGPARFRSLD+GERNGY++G+V++VIHDPGRGAPL +
Sbjct  1    MGRVIRAQRKGAGSVFTSHTHHRKGPARFRSLDYGERNGYIRGIVTDVIHDPGRGAPLCK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRH FRY+HQKELF+AAEGMYTGQFVYCGKKA L VGNVLPLRSIPEGAVVCNVE  V
Sbjct  61   VTFRHAFRYRHQKELFVAAEGMYTGQFVYCGKKANLTVGNVLPLRSIPEGAVVCNVEQHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FAR SGDYAIV+SHNPDNGTTR+KLPS
Sbjct  121  GDRGSFARASGDYAIVVSHNPDNGTTRVKLPS  152



>gb|ACU24202.1| unknown [Glycine max]
Length=261

 Score =   281 bits (718),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV+++IHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ Q ELF+AAEG++TGQF+YCGKK  L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   VAFRHPFRYKKQMELFVAAEGLHTGQFIYCGKKTTLVVGNVLPLRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>ref|NP_001236274.1| ribosomal protein L2 [Glycine max]
 emb|CAC20221.1| ribosomal protein L2 [Glycine max]
Length=260

 Score =   280 bits (716),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRA  +GAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAHVEGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ Q ELFIAAEG+YTGQF+YCGKKA L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   VAFRHPFRYKKQNELFIAAEGLYTGQFIYCGKKATLVVGNVLPLRSIPEGAVICNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  152



>gb|ACN40218.1| unknown [Picea sitchensis]
Length=259

 Score =   280 bits (715),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF SHTHHRKGPARFRSLD+GERNGY++G+V++VIHDP RGAPL +
Sbjct  1    MGRVIRAQRKGAGSVFTSHTHHRKGPARFRSLDYGERNGYIRGIVTDVIHDPDRGAPLCK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRH FRY+HQKELF+AAEGMYTGQFVYCGKKA L VGNVLPLRSIPEGAVVCNVE  V
Sbjct  61   VTFRHAFRYRHQKELFVAAEGMYTGQFVYCGKKANLTVGNVLPLRSIPEGAVVCNVEQHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FAR SGDYAIV+SHNPDNGTTR+KLPS
Sbjct  121  GDRGSFARASGDYAIVVSHNPDNGTTRVKLPS  152



>ref|XP_009136602.1| PREDICTED: 60S ribosomal protein L8-1-like [Brassica rapa]
Length=259

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 143/153 (93%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGA-GSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGRVIRAQRKGA GSVFKSHTHHRKGPA+FRSLD+GERNGYLKGVV+E+IHDPGRGAPLA
Sbjct  1    MGRVIRAQRKGAAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGVVTEIIHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RV FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVE  
Sbjct  61   RVDFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVELH  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGDRG  AR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  VGDRGALARASGDYAIVISHNPDNDTTRIKLPS  153



>ref|XP_006403942.1| hypothetical protein EUTSA_v10011106mg [Eutrema salsugineum]
 gb|ESQ45395.1| hypothetical protein EUTSA_v10011106mg [Eutrema salsugineum]
Length=259

 Score =   279 bits (714),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 143/153 (93%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGA-GSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGRVIRAQRKGA GSVFKSHTHHRKGPA+FRSLD+GERNGYLKGVV+E++HDPGRGAPLA
Sbjct  1    MGRVIRAQRKGAAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGVVTEIVHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RV FRHPFRY  QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRS+PEGAVVCNVE K
Sbjct  61   RVDFRHPFRYMKQKELFVAAEGMYTGQFLYCGKKANLVVGNVLPLRSVPEGAVVCNVELK  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGDRG  AR SGDYAIV+SHNPDN TTRIKLPS
Sbjct  121  VGDRGALARASGDYAIVVSHNPDNDTTRIKLPS  153



>emb|CDX90658.1| BnaA03g41230D [Brassica napus]
Length=259

 Score =   278 bits (712),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 143/153 (93%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGA-GSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGRVIRAQRKGA GSVFKSHTHHRKGPA+FRSLD+GERNGYLKGVV+E+IHDPGRGAPLA
Sbjct  1    MGRVIRAQRKGAAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGVVTEIIHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RV FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVE  
Sbjct  61   RVDFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVELH  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGDRG  AR SGDYAIVISHNPDN TTRIKLPS
Sbjct  121  VGDRGALARASGDYAIVISHNPDNDTTRIKLPS  153



>gb|KFK30242.1| hypothetical protein AALP_AA7G236100 [Arabis alpina]
Length=276

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 146/170 (86%), Gaps = 18/170 (11%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEH--  438
            V FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH  
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  439  ----------------KVGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
                             VGDRGVFAR SGDYAIVI+HNPDN T+RIKLPS
Sbjct  121  GDRGVFARASGDYAIDHVGDRGVFARASGDYAIVIAHNPDNDTSRIKLPS  170



>ref|XP_010515511.1| PREDICTED: 60S ribosomal protein L8-2-like [Camelina sativa]
Length=259

 Score =   276 bits (706),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLD+GERNGYLKG+V+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGLVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY  QKELF+AAEGMYTGQ++YCGKKA L+VGNVLPL SIPEGAVVCNVE  V
Sbjct  61   VAFRHPFRYMKQKELFVAAEGMYTGQYLYCGKKANLMVGNVLPLESIPEGAVVCNVELHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYAIVI+HNPD+ TTRIKLPS
Sbjct  121  GDRGALARASGDYAIVIAHNPDSKTTRIKLPS  152



>emb|CDY35456.1| BnaC03g62040D [Brassica napus]
Length=265

 Score =   276 bits (705),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 145/160 (91%), Gaps = 9/160 (6%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY+ QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VAFRHPFRYKKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDY--------AIVISHNPDNGTTRIKLPS  540
            GDRGVFAR S D+        AIVI+HNPDN TTR+KLPS
Sbjct  121  GDRGVFARAS-DFRSPEFIAAAIVIAHNPDNDTTRVKLPS  159



>emb|CDY29006.1| BnaC07g32120D [Brassica napus]
Length=259

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGA-GSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGRVIRAQRKGA GSVFKSHTHHRKGPA+FRSLD+ ERNGYLKGVV+E+IHDPGRGAPLA
Sbjct  1    MGRVIRAQRKGAAGSVFKSHTHHRKGPAKFRSLDYSERNGYLKGVVTEIIHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RV FRHPFRY+ QKELF+AAEGMYTGQ +YCGKKA L+VGNVLPLRSIPEGAVVCNVE  
Sbjct  61   RVDFRHPFRYKKQKELFVAAEGMYTGQLLYCGKKATLVVGNVLPLRSIPEGAVVCNVELH  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGDRG  AR SGDYAIVISHNPDN TTR+KLPS
Sbjct  121  VGDRGAMARASGDYAIVISHNPDNDTTRVKLPS  153



>ref|XP_002877791.1| 60S ribosomal protein L8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54050.1| 60S ribosomal protein L8 [Arabidopsis lyrata subsp. lyrata]
Length=258

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLD+GERNGYLKG+V+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGLVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY  QKELF+AAEGMYTGQ++YCGKKA L+VGNVLPL SIPEGAVVCNVE  V
Sbjct  61   VAFRHPFRYMKQKELFVAAEGMYTGQYLYCGKKANLMVGNVLPLGSIPEGAVVCNVELHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYAIVI+HNPD+ TTR+KLPS
Sbjct  121  GDRGALARASGDYAIVIAHNPDSNTTRVKLPS  152



>ref|XP_010426664.1| PREDICTED: 60S ribosomal protein L8-2-like [Camelina sativa]
Length=258

 Score =   275 bits (702),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLD+GERNGYLKG+V+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGLVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY  QKELF+AAEGMYTGQ++YCGKKA L+VGNVLPL SIPEGAVVCNVE  V
Sbjct  61   VAFRHPFRYMKQKELFVAAEGMYTGQYLYCGKKANLMVGNVLPLGSIPEGAVVCNVELHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYAIVI+HNPD+ TTRIKLPS
Sbjct  121  GDRGALARASGDYAIVIAHNPDSKTTRIKLPS  152



>ref|XP_006292747.1| hypothetical protein CARUB_v10019000mg [Capsella rubella]
 gb|EOA25645.1| hypothetical protein CARUB_v10019000mg [Capsella rubella]
Length=259

 Score =   272 bits (696),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLD+GERNGYLKG+V+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGMVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY  QKELF+AAEGMYTGQ++YCGKKA L+VGNVLPL SIPEGAVVCNVE  V
Sbjct  61   VAFRHPFRYMKQKELFVAAEGMYTGQYLYCGKKANLMVGNVLPLGSIPEGAVVCNVELHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYAIVI+HN D+ TTRIKLPS
Sbjct  121  GDRGALARASGDYAIVIAHNLDSNTTRIKLPS  152



>ref|XP_010503802.1| PREDICTED: 60S ribosomal protein L8-2 [Camelina sativa]
Length=259

 Score =   272 bits (696),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLD+GERNGYLKG+V+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGLVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRHPFRY  QKELF+AAEGMYTGQ++YCGKKA L+VGNVLPL SIPEGAVVCNVE  V
Sbjct  61   VAFRHPFRYMKQKELFVAAEGMYTGQYLYCGKKANLMVGNVLPLGSIPEGAVVCNVELHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYAIVI+HN D+ TTRIKLPS
Sbjct  121  GDRGALARASGDYAIVIAHNSDSKTTRIKLPS  152



>ref|XP_002969950.1| hypothetical protein SELMODRAFT_170971 [Selaginella moellendorffii]
 ref|XP_002981420.1| hypothetical protein SELMODRAFT_154469 [Selaginella moellendorffii]
 gb|EFJ17608.1| hypothetical protein SELMODRAFT_154469 [Selaginella moellendorffii]
 gb|EFJ29074.1| hypothetical protein SELMODRAFT_170971 [Selaginella moellendorffii]
Length=260

 Score =   270 bits (690),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGR IRAQRKG GSVFKSHTHHRKGPAR R LDF ERNGY+KGVV++VIHD GRGAPL +
Sbjct  1    MGRAIRAQRKGRGSVFKSHTHHRKGPARLRKLDFAERNGYIKGVVTDVIHDSGRGAPLCK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFR++HQKEL IAAEG+Y+GQF+YCGKKA L +GN+LPLRS+PEGAVVCNVEH+V
Sbjct  61   VTFRHPFRFKHQKELMIAAEGIYSGQFMYCGKKAQLAIGNILPLRSVPEGAVVCNVEHRV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FAR SGDYAIV+SHNPD GT+RIKLPS
Sbjct  121  GDRGAFARASGDYAIVVSHNPDMGTSRIKLPS  152



>ref|XP_001759367.1| predicted protein [Physcomitrella patens]
 ref|XP_001759425.1| predicted protein [Physcomitrella patens]
 ref|XP_001767203.1| predicted protein [Physcomitrella patens]
 ref|XP_001767259.1| predicted protein [Physcomitrella patens]
 ref|XP_001785992.1| predicted protein [Physcomitrella patens]
 ref|XP_001785993.1| predicted protein [Physcomitrella patens]
 gb|EDQ49197.1| predicted protein [Physcomitrella patens]
 gb|EDQ49198.1| predicted protein [Physcomitrella patens]
 gb|EDQ67884.1| predicted protein [Physcomitrella patens]
 gb|EDQ67940.1| predicted protein [Physcomitrella patens]
 gb|EDQ75669.1| predicted protein [Physcomitrella patens]
 gb|EDQ75727.1| predicted protein [Physcomitrella patens]
Length=260

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGS+F+SHTH RKGPA+FRSLD+ ERNGY+KGVVSEV+HD GRGAPL +
Sbjct  1    MGRVIRAQRKGAGSIFRSHTHRRKGPAQFRSLDYAERNGYIKGVVSEVVHDSGRGAPLCK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFR++ QKE FIAAEGMY+GQFVYCGKKA L +GNVLPLRS+PEGAVVCNVEH++
Sbjct  61   VTFRHPFRFKRQKERFIAAEGMYSGQFVYCGKKATLSIGNVLPLRSVPEGAVVCNVEHRM  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FAR SGDYAIV+SHN D+GTTRIKLPS
Sbjct  121  GDRGAFARASGDYAIVVSHNVDSGTTRIKLPS  152



>ref|XP_009150832.1| PREDICTED: 60S ribosomal protein L8-1-like [Brassica rapa]
Length=260

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +1

Query  112  KGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLARVTFRHPFRY  291
            KGAGSVFKSHTHHRKGPA+FRSLD+GERNGYLK VV+E+IHDPGRGAPLARV FRHPFRY
Sbjct  12   KGAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKDVVTEIIHDPGRGAPLARVAFRHPFRY  71

Query  292  QHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKVGDRGVFARC  471
            + QKELF+AAEGMYTGQF+YCGKKA L+VGNVLPLR+IPEGAVVCNVEH VGDRGV AR 
Sbjct  72   KKQKELFVAAEGMYTGQFLYCGKKATLVVGNVLPLRAIPEGAVVCNVEHHVGDRGVLARA  131

Query  472  SGDYAIVISHNPDNGTTRIKLPS  540
            SGDYAIVISHNPDN TTRIKLPS
Sbjct  132  SGDYAIVISHNPDNDTTRIKLPS  154



>gb|AEX91926.1| ribosomal protein L2, partial [Aegiceras corniculatum]
Length=195

 Score =   266 bits (680),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +1

Query  130  FKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLARVTFRHPFRYQHQKEL  309
            FKSHTHHRKGPAR RSLDFGERNGY KGV++E+IHDPGRGAPLARVTFRHPFRY+HQKEL
Sbjct  1    FKSHTHHRKGPARLRSLDFGERNGYTKGVITEIIHDPGRGAPLARVTFRHPFRYKHQKEL  60

Query  310  FIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKVGDRGVFARCSGDYAI  489
            F+AAEGMYTGQFVYCGKKA L+VGNVLPLRSIPEGAVVCNVEH VGDRGVFAR SGDYAI
Sbjct  61   FVAAEGMYTGQFVYCGKKANLMVGNVLPLRSIPEGAVVCNVEHHVGDRGVFARASGDYAI  120

Query  490  VISHNPDNGTTRIKLPS  540
            VISHNPDNGT+R+KLPS
Sbjct  121  VISHNPDNGTSRVKLPS  137



>gb|KFK34361.1| hypothetical protein AALP_AA5G135500 [Arabis alpina]
Length=259

 Score =   268 bits (685),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGA-GSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGRVIRAQRKGA GSVFKSHTHHRKGPA+FRSLD+GERNGYLKG+V+E+IHDPGRGAPLA
Sbjct  1    MGRVIRAQRKGAAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGLVTEIIHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RV F HPFRY+ QKELF+AAEGMYTGQF+YCG+KA L+VGNVLPLRSIPEGAVVCNVE  
Sbjct  61   RVEFPHPFRYKKQKELFVAAEGMYTGQFLYCGRKANLVVGNVLPLRSIPEGAVVCNVELH  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
             GDRG  AR SGDYAIVISHN D+GT+RIKLPS
Sbjct  121  AGDRGALARASGDYAIVISHNHDDGTSRIKLPS  153



>ref|NP_190687.2| 60S ribosomal protein L8-2 [Arabidopsis thaliana]
 sp|Q4PSL7.3|RL82_ARATH RecName: Full=60S ribosomal protein L8-2 [Arabidopsis thaliana]
 gb|AAY78767.1| 60S ribosomal protein L8 [Arabidopsis thaliana]
 gb|AEE78761.1| 60S ribosomal protein L8-2 [Arabidopsis thaliana]
Length=260

 Score =   268 bits (684),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGA-GSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGRVIRAQRKGA GSVFKSHTHHRKGPA+FRSLD+GERNGYLKG+V+E+IHDPGRGAPLA
Sbjct  1    MGRVIRAQRKGAAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGLVTEIIHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RV FRHPFRY  QKELF+AAEGMYTGQ++YCGKKA L+VGNVLPL SIPEGAV+CNVE  
Sbjct  61   RVAFRHPFRYMKQKELFVAAEGMYTGQYLYCGKKANLMVGNVLPLGSIPEGAVICNVELH  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGDRG  AR SGDYAIVI+HNP++ TTR+KLPS
Sbjct  121  VGDRGALARASGDYAIVIAHNPESNTTRVKLPS  153



>emb|CAB62641.1| ribosomal protein L8 homolog [Arabidopsis thaliana]
Length=260

 Score =   267 bits (683),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGA-GSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGRVIRAQRKGA GSVFKSHTHHRKGPA+FRSLD+GERNGYLKG+V+E+IHDPGRGAPLA
Sbjct  1    MGRVIRAQRKGAAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGLVTEIIHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RV FRHPFRY  QKELF+AAEGMYTGQ++YCGKKA L+VGNVLPL SIPEGAV+CNVE  
Sbjct  61   RVAFRHPFRYMKQKELFVAAEGMYTGQYLYCGKKANLMVGNVLPLGSIPEGAVICNVELH  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGDRG  AR SGDYAIVI+HNP++ TTR+KLPS
Sbjct  121  VGDRGALARASGDYAIVIAHNPESNTTRVKLPS  153



>ref|XP_002440105.1| hypothetical protein SORBIDRAFT_09g026110 [Sorghum bicolor]
 gb|EES18535.1| hypothetical protein SORBIDRAFT_09g026110 [Sorghum bicolor]
Length=260

 Score =   266 bits (680),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGA-GSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGRVIRAQRKGA GSVFKSHTHHRKGPARFR+LD GER+GYLKGVV++++HDPGRGAPLA
Sbjct  1    MGRVIRAQRKGAAGSVFKSHTHHRKGPARFRALDVGERSGYLKGVVTDIVHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RVTFRHPFRY+ QKELF+AAEGMYTGQ +YCG++A L +GNVLP+ ++PEG V+CNVE +
Sbjct  61   RVTFRHPFRYRQQKELFLAAEGMYTGQLIYCGRRANLSIGNVLPVGTLPEGTVICNVESR  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGDRG  ARCSGDYAIVISHN DNGTTR+KLPS
Sbjct  121  VGDRGALARCSGDYAIVISHNTDNGTTRVKLPS  153



>emb|CAA60445.1| 60S ribosomal protein L2 [Arabidopsis thaliana]
Length=258

 Score =   265 bits (678),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPA+FRSLDFGERNGYLKGVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRHPFR++ QKELF+AAE       +YCGKKA L+VGNVLPLRSIPEGAVVCNVEH V
Sbjct  61   VTFRHPFRFKKQKELFVAAEVCTPVSSLYCGKKATLVVGNVLPLRSIPEGAVVCNVEHHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV AR SGDYAIVI+ NPD+ TTRIKLPS
Sbjct  121  GDRGVLARASGDYAIVIAENPDSDTTRIKLPS  152



>ref|XP_004963645.1| PREDICTED: 60S ribosomal protein L8-like [Setaria italica]
Length=260

 Score =   264 bits (675),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGA-GSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGRVIRAQRKGA GSVFKSHTHHRKGPARFRSLD GER GYLKG+V++++HDPGRGAPLA
Sbjct  1    MGRVIRAQRKGAAGSVFKSHTHHRKGPARFRSLDVGERRGYLKGLVTDIVHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RVTFRHPFRY  QKELF+AAEGMYTGQ +YCG++A+L +GNVLP+ ++PEG V CNVE  
Sbjct  61   RVTFRHPFRYGQQKELFLAAEGMYTGQLIYCGRRASLSIGNVLPVGTLPEGTVTCNVESH  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGDRG  ARCSGDYAIVISHN DNGTTR+KLPS
Sbjct  121  VGDRGALARCSGDYAIVISHNTDNGTTRVKLPS  153



>ref|XP_003559105.1| PREDICTED: 60S ribosomal protein L8-like [Brachypodium distachyon]
Length=261

 Score =   260 bits (664),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGA-GSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGRVIRAQRKGA GSVFKSHTHHRKGPARFR+LD+GER+GYLKGVV+E++HDPGRGAPLA
Sbjct  1    MGRVIRAQRKGAAGSVFKSHTHHRKGPARFRALDYGERHGYLKGVVTEIVHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RV FR P RY+H+KELF+AAEGMYTGQ +YCG++AAL VGNVLPL ++PEG+VVCNVE +
Sbjct  61   RVDFREPVRYKHRKELFVAAEGMYTGQSLYCGRRAALSVGNVLPLAALPEGSVVCNVEER  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGDRG  AR SGDYAIV+SHN D GTTRIKLPS
Sbjct  121  VGDRGALARASGDYAIVVSHNSDAGTTRIKLPS  153



>gb|EMT02913.1| 60S ribosomal protein L8 [Aegilops tauschii]
Length=269

 Score =   258 bits (658),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 139/160 (87%), Gaps = 8/160 (5%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHR+GPARFR+LD+GERNGYLKGVV++++HDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRQGPARFRALDYGERNGYLKGVVTDIVHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P RY+H+KELF+AAEGMYTGQ VYCG++A + +GNVLPL S+PEGAVVCNVE  V
Sbjct  61   LDFRDPVRYKHRKELFVAAEGMYTGQSVYCGRRAVVAIGNVLPLASLPEGAVVCNVEQHV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTR--------IKLPS  540
            GDRG  AR SGDYAIVISHN +NGTTR        IKLPS
Sbjct  121  GDRGALARASGDYAIVISHNSENGTTRQVSEASDWIKLPS  160



>tpg|DAA47081.1| TPA: hypothetical protein ZEAMMB73_093162 [Zea mays]
 tpg|DAA55199.1| TPA: hypothetical protein ZEAMMB73_180651 [Zea mays]
Length=245

 Score =   255 bits (651),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 131/152 (86%), Gaps = 16/152 (11%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV               
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV---------------  45

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
             TFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L +GNVLPLR IPEGAVVCNVEH V
Sbjct  46   -TFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPLRGIPEGAVVCNVEHHV  104

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  105  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  136



>tpg|DAA60348.1| TPA: hypothetical protein ZEAMMB73_760140 [Zea mays]
Length=244

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 131/152 (86%), Gaps = 16/152 (11%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV               
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV---------------  45

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
             TFRHPFRY+HQKELF+AAEGMYTGQFVYCG++A L +GNVLPLR IPEGAVVCNVEH V
Sbjct  46   -TFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPLRGIPEGAVVCNVEHHV  104

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDNGT+RIKLPS
Sbjct  105  GDRGVFARASGDYAIVISHNPDNGTSRIKLPS  136



>ref|XP_001692985.1| ribosomal protein L8, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP03554.1| ribosomal protein L8 [Chlamydomonas reinhardtii]
Length=259

 Score =   245 bits (626),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKG G +FKSH  HRKG A+ R +D  ERN Y+KGVV+EVIHDPGRGAPLAR
Sbjct  1    MGRVIRSQRKGRGGIFKSHNTHRKGAAQHRVMDSAERNHYIKGVVAEVIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFR P RY+HQKELFIAAEG+Y+GQF+YCG+KAAL +GNV PL  +PEG +VCNVE K 
Sbjct  61   VTFRDPIRYKHQKELFIAAEGIYSGQFIYCGRKAALSIGNVKPLGDMPEGTIVCNVEEKA  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  ARCSGDYAIV++HNPD G TRIKLPS
Sbjct  121  GDRGALARCSGDYAIVVAHNPDTGITRIKLPS  152



>ref|XP_002950895.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ48210.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=259

 Score =   242 bits (618),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKG G +FKSH  HRKG A+ R LD  ERN Y+KGVVSEV+HDPGRGAPLAR
Sbjct  1    MGRVIRSQRKGRGGIFKSHNTHRKGAAKHRVLDAAERNHYIKGVVSEVLHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFR P RY+HQK LF+AAEG+YTGQF+YCG+KA L +GNV PL  +PEG ++CNVE K 
Sbjct  61   VTFRDPIRYKHQKSLFVAAEGVYTGQFIYCGRKATLSIGNVKPLGDMPEGTIICNVEEKA  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  ARCSGDYAIV++HNPD G TRIKLPS
Sbjct  121  GDRGALARCSGDYAIVVAHNPDAGITRIKLPS  152



>gb|EPZ33659.1| 60S ribosomal protein L8 [Rozella allomycis CSF55]
Length=255

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKGAG +FKSH  HRKG A+ R++DF ER GY++G+V E+IHDPGRGAPLAR
Sbjct  1    MGRVIRSQRKGAGGIFKSHNKHRKGAAKLRAVDFAERRGYIRGLVKEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ ++ LFIA+EGMYTGQFVYCGKKA+L VGNVLPL S+PEG V+CNVE K 
Sbjct  61   VIFRDPYRYKQREALFIASEGMYTGQFVYCGKKASLTVGNVLPLASMPEGTVICNVEEKA  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA +I HNPD G TR+KLPS
Sbjct  121  GDRGALARASGNYATIIGHNPDEGKTRVKLPS  152



>gb|KFM82783.1| 60S ribosomal protein L8, partial [Stegodyphus mimosarum]
Length=258

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKGAGSVFKSHT HRKG  + R++DF ER+GY+KG+V E+IHDPGRGAPLA 
Sbjct  1    MGRVIRSQRKGAGSVFKSHTKHRKGAPKLRAVDFAERHGYIKGIVKEIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELFIAAEGMYTGQF+YCGKKA L VGNVLP+ ++PEG ++CN+E K 
Sbjct  61   VVFRDPYRYKQKKELFIAAEGMYTGQFIYCGKKAVLQVGNVLPVGTMPEGTIICNLEEKS  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNPD+  TR+KLPS
Sbjct  121  GDRGRLARGSGNYATVISHNPDSKKTRVKLPS  152



>ref|XP_005191848.1| PREDICTED: 60S ribosomal protein L8 [Musca domestica]
Length=256

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+H HHRKG A+ RSLDF ERNGY++GVV E+IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKAHVHHRKGAAKLRSLDFAERNGYIRGVVKEIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELFIA EGM+TGQFVYCG+KA L +GNV+P+ ++PEG ++CN+E K 
Sbjct  61   VHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPIATMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNPDTKKTRVKLPS  152



>ref|XP_005848475.1| hypothetical protein CHLNCDRAFT_35106 [Chlorella variabilis]
 gb|EFN56373.1| hypothetical protein CHLNCDRAFT_35106 [Chlorella variabilis]
Length=257

 Score =   236 bits (603),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF+SH  HRKG A+ R LD  ERNGY+KGVV+EV+HDPGRGAPLAR
Sbjct  1    MGRVIRGQRKGAGSVFRSHNTHRKGAAKIRKLDAAERNGYIKGVVTEVLHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FRH  RY   K+LFIAAEG+Y+GQ++YCGKKA L +GNV P+  +PEG ++CNVE K 
Sbjct  61   VHFRHTVRYATDKQLFIAAEGVYSGQYIYCGKKATLNIGNVKPVGDMPEGTIICNVEEKA  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  ARCSGDYAIV++HNPD G TRIKLPS
Sbjct  121  GDRGSLARCSGDYAIVVAHNPDAGITRIKLPS  152



>ref|XP_796001.1| PREDICTED: 60S ribosomal protein L8-like [Strongylocentrotus 
purpuratus]
Length=257

 Score =   236 bits (603),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF+SH  HRKG  R RS+D+ ER+GYLKG+V E+IHDPGRGAPLAR
Sbjct  1    MGRVIRGQRKGAGSVFRSHNKHRKGAPRLRSIDYAERHGYLKGIVKEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P+RY+ + EL IA EGMYTGQF+YCGK+A L +GNVLPL S+PEG V+C+VE K 
Sbjct  61   IQFRDPYRYKKRTELMIAPEGMYTGQFIYCGKRATLNIGNVLPLGSMPEGTVICSVEEKA  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  ARCSG+YA V+SHNPD   +RIKLPS
Sbjct  121  GDRGKLARCSGNYATVVSHNPDTKKSRIKLPS  152



>ref|XP_002740227.1| PREDICTED: 60S ribosomal protein L8-like isoform X1 [Saccoglossus 
kowalevskii]
 ref|XP_006823433.1| PREDICTED: 60S ribosomal protein L8-like isoform X2 [Saccoglossus 
kowalevskii]
Length=256

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKG GS+FK+HT HRKG AR RSLD+ ER GYLKGVV+E++HDPGRGAPL R
Sbjct  1    MGRVIRGQRKGPGSIFKAHTKHRKGAARLRSLDYAERMGYLKGVVTEILHDPGRGAPLCR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ + E FIAAEGMYTGQF+YCGKKA+L +GNVLP+  +PEG +VCNVE K 
Sbjct  61   VMFRDPYRYKKRVETFIAAEGMYTGQFIYCGKKASLQIGNVLPVSQMPEGTIVCNVEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA V+SHNPD   +R+KLPS
Sbjct  121  GDRGKLARASGNYATVVSHNPDTRKSRVKLPS  152



>ref|XP_003060681.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55450.1| predicted protein [Micromonas pusilla CCMP1545]
Length=262

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGR+IR QRKGAGS+F S+T  RKG A+ R  DF ER+GY+KGVV+++IHDPGRGAPLA+
Sbjct  1    MGRIIRGQRKGAGSIFTSNTSKRKGAAKHRQSDFAERHGYIKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFRH  R+QHQKELF+AAEG YTGQF+YCGKKA L+VGN+LP+  +PEG V+CNVE K+
Sbjct  61   VTFRHTKRFQHQKELFVAAEGTYTGQFLYCGKKAQLVVGNILPIGQMPEGTVICNVEAKL  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV A+ SG+Y I+ISHNPD G +RIKLPS
Sbjct  121  GDRGVLAKASGEYCILISHNPDTGFSRIKLPS  152



>gb|KFH72591.1| 60S ribosomal protein L8 [Mortierella verticillata NRRL 6337]
 gb|KFH73719.1| 60S ribosomal protein L8 [Mortierella verticillata NRRL 6337]
Length=254

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKG G +FKSHT  RKG A+ RSLDF ER GY++G+V EVIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGPGGIFKSHTRLRKGAAKLRSLDFAERTGYIRGIVKEVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ + E FIA EG YTGQF+YCGKKAAL +GNVLPL S+PEG VVCNVE  V
Sbjct  61   VQFRDPYRYKMKTETFIATEGTYTGQFIYCGKKAALTIGNVLPLGSMPEGTVVCNVEETV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG YA VI HN D+G TRIKLPS
Sbjct  121  GDRGALARTSGGYATVIGHNTDDGKTRIKLPS  152



>ref|XP_002593183.1| hypothetical protein BRAFLDRAFT_277869 [Branchiostoma floridae]
 gb|EEN49194.1| hypothetical protein BRAFLDRAFT_277869 [Branchiostoma floridae]
Length=255

 Score =   235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF +HT HRKG A+ R+LDF ER+GY+KG+V ++IHDPGRGAPLAR
Sbjct  1    MGRVIRGQRKGAGSVFTAHTKHRKGAAKLRALDFAERHGYIKGLVKDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ + E FIAAEGMYTG FVYCGKKA L VGN LP+  +PEG ++CNVE K 
Sbjct  61   VMFRDPYRYKKRTETFIAAEGMYTGMFVYCGKKAILKVGNTLPVSQMPEGTIICNVEEKG  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  ARCSG+YA VISHN +N TTRI+LPS
Sbjct  121  GDRGSLARCSGNYATVISHNLENKTTRIRLPS  152



>ref|XP_002504932.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66190.1| predicted protein [Micromonas sp. RCC299]
Length=261

 Score =   234 bits (598),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGR+IR QRKGAGS+F SHT  RKG A+ R  DF ER+GY+KGVV+++IHDPGRGAPLA+
Sbjct  1    MGRIIRGQRKGAGSIFTSHTDKRKGAAKHRQQDFAERHGYVKGVVTDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFR+  R+QH KELF+AAEG YTGQF+YCGKKA L+VGN+LP+ S+PEG ++CNVE K+
Sbjct  61   VTFRNTKRFQHDKELFVAAEGTYTGQFLYCGKKAQLVVGNILPVGSMPEGTIICNVEQKL  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGV A+ SG+Y I+ISHNPD G +RIKLPS
Sbjct  121  GDRGVLAKASGEYCILISHNPDTGFSRIKLPS  152



>ref|XP_003385674.1| PREDICTED: 60S ribosomal protein L8-like [Amphimedon queenslandica]
Length=258

 Score =   234 bits (597),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKG GS+FKSHT HRKGPAR R+LDF ER GY+KG+V ++IHDPGRGAPLAR
Sbjct  1    MGRVIRGQRKGRGSIFKSHTKHRKGPARLRALDFAERKGYIKGIVKDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFR  ++Y+  KELF+A EGMYTGQFVYCGKKA L VGN LPL  +PEG VVC VE K 
Sbjct  61   VTFRDAYKYRQHKELFVATEGMYTGQFVYCGKKAQLSVGNCLPLGVMPEGTVVCQVEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  A+ SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGKIAKTSGNYATVIAHNPDTKKTRVKLPS  152



>gb|ACO13132.1| 60S ribosomal protein L8 [Lepeophtheirus salmonis]
 gb|ADD38826.1| 60S ribosomal protein L8 [Lepeophtheirus salmonis]
Length=256

 Score =   234 bits (597),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHT HRKG  + R++D+ ERNGY+KG V ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKSHTKHRKGAPKLRAVDYSERNGYIKGTVKKIIHDPGRGAPLAE  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELF+AAEGMYTGQF+YCGKKA L VGNV+P+ S+PEG ++ N+E K 
Sbjct  61   VHFRDPYRYKTRKELFVAAEGMYTGQFIYCGKKAQLTVGNVMPIGSMPEGTIISNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRIARGSGNYATVIAHNPDTKRTRVKLPS  152



>gb|KDR10917.1| 60S ribosomal protein L8 [Zootermopsis nevadensis]
Length=258

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF+SHT HRKG  R RSLDF ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRGQRKGAGSVFRSHTKHRKGAPRLRSLDFAERHGYIKGVVKDIIHDPGRGAPLAL  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ +KELFIA EGMYTGQFVYCGKKA L +GNV+P+ S+PEG +VCN+E K 
Sbjct  61   VHFRDPYRFKTRKELFIAPEGMYTGQFVYCGKKANLQIGNVMPVGSMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDTKKTRVKLPS  152



>tpg|DAA34056.1| TPA_exp: putative ribosomal protein L8e [Amblyomma variegatum]
Length=192

 Score =   232 bits (591),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SH  HRKG  + R++D+ ER+GY+KG++ E++HDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFRSHNKHRKGAPKLRAVDYAERHGYIKGIIKEILHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELF+AAEGM+TGQFVYCGKKAAL VGNVLP+  +PEG V+CNVE K 
Sbjct  61   VVFRDPYRYKLKKELFLAAEGMHTGQFVYCGKKAALQVGNVLPVGVMPEGTVICNVEEKA  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HN D   TRIKLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNADTRKTRIKLPS  152



>gb|KIY97177.1| 60S ribosomal protein L8 [Monoraphidium neglectum]
Length=257

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKG GSVFKSH  HRKG A+ R  D  ER+ Y+KGVV+E+IHDPGRGAPLA+
Sbjct  1    MGRVIRTQRKGRGSVFKSHNTHRKGAAKHRVYDSAERHAYIKGVVAEIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V +R P RY+ QKEL IAAEG+Y+GQFVY GKKA L +GN LPL  +PEG +VCNVE KV
Sbjct  61   VVYRDPVRYKLQKELTIAAEGLYSGQFVYAGKKAVLSIGNTLPLGEMPEGTIVCNVEAKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  ARCSGDYAIV++HNPD+G TRIKLPS
Sbjct  121  GDRGTLARCSGDYAIVVAHNPDSGITRIKLPS  152



>gb|AFY52355.1| ribosomal protein L2, partial [Cyrtandra longifolia]
 gb|AFY52356.1| ribosomal protein L2, partial [Cyrtandra longifolia]
Length=117

 Score =   228 bits (581),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  127  VFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLARVTFRHPFRYQHQKE  306
            VFKSHTHHRKGPARFRSLDFGERNGYLKGV+++VIHDPGRGAPLARVTFRHPFRY+HQKE
Sbjct  1    VFKSHTHHRKGPARFRSLDFGERNGYLKGVITDVIHDPGRGAPLARVTFRHPFRYKHQKE  60

Query  307  LFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKVGDRGVFARCSG  477
            LFIAAEGMYTGQFVYCGKKA LIVGNVLP+RSIPEGAV+CNVEH VGDRGVFAR SG
Sbjct  61   LFIAAEGMYTGQFVYCGKKANLIVGNVLPIRSIPEGAVICNVEHHVGDRGVFARASG  117



>ref|XP_002998398.1| 60S ribosomal protein L8, putative [Phytophthora infestans T30-4]
 gb|EEY69751.1| 60S ribosomal protein L8, putative [Phytophthora infestans T30-4]
Length=256

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGS+FKSHTH RKGPA FR+LDF ER GY+KGVV E+IHD GRGAPLAR
Sbjct  1    MGRVIRGQRKGAGSIFKSHTHLRKGPAAFRALDFVERTGYIKGVVKEIIHDSGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VT+R P+R+Q   EL IAAEGMYTG F+Y G KA L VGN LPL ++PEG +VCNVE KV
Sbjct  61   VTYRDPYRFQLNHELLIAAEGMYTGMFIYSGPKATLAVGNTLPLSALPEGTIVCNVEAKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FAR SGDYA++++H+ D G T+++LPS
Sbjct  121  GDRGSFARASGDYAVIVTHDEDKGKTKLRLPS  152



>gb|AFY52348.1| ribosomal protein L2, partial [Cyrtandra hashimotoi]
 gb|AFY52349.1| ribosomal protein L2, partial [Cyrtandra hashimotoi]
 gb|AFY52350.1| ribosomal protein L2, partial [Cyrtandra platyphylla]
 gb|AFY52351.1| ribosomal protein L2, partial [Cyrtandra platyphylla]
 gb|AFY52352.1| ribosomal protein L2, partial [Cyrtandra sp. Puu Pili 1]
 gb|AFY52353.1| ribosomal protein L2, partial [Cyrtandra platyphylla var. platyphylla]
 gb|AFY52354.1| ribosomal protein L2, partial [Cyrtandra platyphylla var. platyphylla]
 gb|AFY52357.1| ribosomal protein L2, partial [Cyrtandra kauaiensis]
 gb|AFY52358.1| ribosomal protein L2, partial [Cyrtandra kauaiensis]
 gb|AFY52359.1| ribosomal protein L2, partial [Cyrtandra platyphylla var. parviflora]
 gb|AFY52360.1| ribosomal protein L2, partial [Cyrtandra platyphylla var. parviflora]
 gb|AFY52361.1| ribosomal protein L2, partial [Cyrtandra giffardii]
 gb|AFY52362.1| ribosomal protein L2, partial [Cyrtandra giffardii]
 gb|AFY52363.1| ribosomal protein L2, partial [Cyrtandra sp. Puu Pili 2]
 gb|AFY52364.1| ribosomal protein L2, partial [Cyrtandra sp. Pololu]
 gb|AFY52365.1| ribosomal protein L2, partial [Cyrtandra sp. Pololu]
 gb|AFY52366.1| ribosomal protein L2, partial [Cyrtandra nanawaleensis]
 gb|AFY52367.1| ribosomal protein L2, partial [Cyrtandra nanawaleensis]
 gb|AFY52368.1| ribosomal protein L2, partial [Cyrtandra paludosa var. microcarpa]
 gb|AFY52369.1| ribosomal protein L2, partial [Cyrtandra paludosa var. microcarpa]
 gb|AFY52370.1| ribosomal protein L2, partial [Cyrtandra confertiflora subsp. 
obovata]
 gb|AFY52371.1| ribosomal protein L2, partial [Cyrtandra confertiflora subsp. 
obovata]
 gb|AFY52373.1| ribosomal protein L2, partial [Cyrtandra kealiae subsp. kealiae]
 gb|AFY52374.1| ribosomal protein L2, partial [Cyrtandra paludosa var. paludosa]
 gb|AFY52375.1| ribosomal protein L2, partial [Cyrtandra paludosa var. paludosa]
 gb|AFY52376.1| ribosomal protein L2, partial [Cyrtandra lysiosepala]
 gb|AFY52377.1| ribosomal protein L2, partial [Cyrtandra lysiosepala]
 gb|AFY52378.1| ribosomal protein L2, partial [Cyrtandra sandwicensis]
 gb|AFY52379.1| ribosomal protein L2, partial [Cyrtandra sandwicensis]
 gb|AFY52380.1| ribosomal protein L2, partial [Cyrtandra grandiflora]
 gb|AFY52381.1| ribosomal protein L2, partial [Cyrtandra grandiflora]
 gb|AFY52382.1| ribosomal protein L2, partial [Cyrtandra sp. Kului 1]
 gb|AFY52383.1| ribosomal protein L2, partial [Cyrtandra cordifolia]
 gb|AFY52384.1| ribosomal protein L2, partial [Cyrtandra cordifolia]
 gb|AFY52385.1| ribosomal protein L2, partial [Cyrtandra paludosa var. paludosa]
 gb|AFY52386.1| ribosomal protein L2, partial [Cyrtandra paludosa var. paludosa]
 gb|AFY52387.1| ribosomal protein L2, partial [Cyrtandra sp. Kului 2]
 gb|AFY52389.1| ribosomal protein L2, partial [Cyrtandra cordifolia]
 gb|AFY52390.1| ribosomal protein L2, partial [Cyrtandra calpidicarpa]
 gb|AFY52391.1| ribosomal protein L2, partial [Cyrtandra calpidicarpa]
 gb|AFY52392.1| ribosomal protein L2, partial [Cyrtandra laxiflora]
 gb|AFY52393.1| ribosomal protein L2, partial [Cyrtandra laxiflora]
 gb|AFY52394.1| ribosomal protein L2, partial [Cyrtandra sp. Pia]
 gb|AFY52395.1| ribosomal protein L2, partial [Cyrtandra sp. Kaiwilahilahi]
 gb|AFY52396.1| ribosomal protein L2, partial [Cyrtandra tintinnabula]
 gb|AFY52397.1| ribosomal protein L2, partial [Cyrtandra tintinnabula]
 gb|AFY52398.1| ribosomal protein L2, partial [Cyrtandra hawaiensis]
 gb|AFY52399.1| ribosomal protein L2, partial [Cyrtandra wagneri]
 gb|AFY52400.1| ribosomal protein L2, partial [Cyrtandra wagneri]
 gb|AFY52401.1| ribosomal protein L2, partial [Cyrtandra sp. Kilau]
 gb|AFY52402.1| ribosomal protein L2, partial [Cyrtandra wawrae]
 gb|AFY52403.1| ribosomal protein L2, partial [Cyrtandra wawrae]
 gb|AFY52404.1| ribosomal protein L2, partial [Cyrtandra lydgatei]
 gb|AFY52405.1| ribosomal protein L2, partial [Cyrtandra sp. Mananole]
Length=117

 Score =   228 bits (580),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  127  VFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLARVTFRHPFRYQHQKE  306
            VFKSHTHHRKGPARFRSLDFGERNGYLKGV++++IHDPGRGAPLARVTFRHPFRY+HQKE
Sbjct  1    VFKSHTHHRKGPARFRSLDFGERNGYLKGVITDIIHDPGRGAPLARVTFRHPFRYKHQKE  60

Query  307  LFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKVGDRGVFARCSG  477
            LFIAAEGMYTGQFVYCGKKA LIVGNVLP+RSIPEGAV+CNVEH VGDRGVFAR SG
Sbjct  61   LFIAAEGMYTGQFVYCGKKANLIVGNVLPIRSIPEGAVICNVEHHVGDRGVFARASG  117



>ref|XP_005646819.1| ribosomal protein L8 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE22275.1| ribosomal protein L8 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=256

 Score =   233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKG GS+F SHT  RKGPAR R+LD  ERNGY++GVV+E+IHDPGRGAPLAR
Sbjct  1    MGRVIRSQRKGRGSIFTSHTRTRKGPARHRTLDAAERNGYIRGVVTEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFR+P RY  +KELFIA EG+Y+GQ VY GKKA L +GN+ P+  +PEGA++CNVE K 
Sbjct  61   VTFRNPIRYGLKKELFIAPEGLYSGQAVYAGKKATLSIGNIKPVGEMPEGAIICNVEEKA  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYAIV++HNP+ G TRIKLPS
Sbjct  121  GDRGALARASGDYAIVVAHNPEAGITRIKLPS  152



>ref|XP_004341437.1| ribosomal proteins l2, RNA binding domain containing protein 
[Acanthamoeba castellanii str. Neff]
 gb|ELR19352.1| ribosomal proteins l2, RNA binding domain containing protein 
[Acanthamoeba castellanii str. Neff]
Length=257

 Score =   232 bits (592),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKG GSVFKSHT HRKG A+ R LDF ER GY+KGVV ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGKGSVFKSHTFHRKGAAQHRKLDFAERKGYIKGVVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V F++P++Y   KELF+AAEGM+TGQFVYCGKKA L VGNVLP+ S+PEG ++CNVE + 
Sbjct  61   VQFKNPYKYGLDKELFVAAEGMHTGQFVYCGKKAQLSVGNVLPVGSMPEGTIICNVETRP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA ++SHNPD G +RIKLPS
Sbjct  121  GDRGSLARTSGNYATLVSHNPDEGVSRIKLPS  152



>ref|XP_008909337.1| 60S ribosomal protein [Phytophthora parasitica INRA-310]
 gb|ETI40795.1| 60S ribosomal protein [Phytophthora parasitica P1569]
 gb|ETK80907.1| 60S ribosomal protein [Phytophthora parasitica]
 gb|ETL34322.1| 60S ribosomal protein [Phytophthora parasitica]
 gb|ETL87599.1| 60S ribosomal protein [Phytophthora parasitica]
 gb|ETM40832.1| 60S ribosomal protein [Phytophthora parasitica]
 gb|ETN05362.1| 60S ribosomal protein [Phytophthora parasitica INRA-310]
 gb|ETO69496.1| 60S ribosomal protein [Phytophthora parasitica P1976]
 gb|ETP10571.1| 60S ribosomal protein [Phytophthora parasitica CJ01A1]
 gb|ETP38738.1| 60S ribosomal protein [Phytophthora parasitica P10297]
Length=256

 Score =   232 bits (591),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGS+FKSHTH RKGPA FR+LDF ER GY+KGV+ E+IHD GRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSIFKSHTHLRKGPAAFRALDFVERTGYIKGVIKEIIHDSGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VT+R P+R+Q + EL IAAEGMYTG F+Y G KA L VGN LPL ++PEG +VCNVE KV
Sbjct  61   VTYRDPYRFQLKHELLIAAEGMYTGMFIYSGPKATLTVGNTLPLSALPEGTIVCNVEAKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FAR SGDYA++++H+ D G T+++LPS
Sbjct  121  GDRGSFARASGDYAVIVTHDEDKGKTKLRLPS  152



>gb|ELU14121.1| hypothetical protein CAPTEDRAFT_224611 [Capitella teleta]
Length=260

 Score =   231 bits (590),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVFK+H+ HRKGPA+ R+LDF ER GY+KGVV ++IHDPGRGAPLA+
Sbjct  1    MGRVIRCQRKGAGSVFKAHSKHRKGPAKLRTLDFAERRGYIKGVVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ + E FIAAEGMYTGQF+Y GK+A L VGN+LP+  +PEG +VC VE K 
Sbjct  61   VAFRDPYRYKQRMETFIAAEGMYTGQFLYAGKRATLTVGNILPVGQMPEGTIVCAVEEKS  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  A+ SG+YA VISHNPD   TR+KLPS
Sbjct  121  GDRGKLAKTSGNYATVISHNPDAKKTRVKLPS  152



>ref|XP_011401819.1| 60S ribosomal protein L8 [Auxenochlorella protothecoides]
 gb|KFM28774.1| 60S ribosomal protein L8 [Auxenochlorella protothecoides]
Length=256

 Score =   231 bits (590),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVFKSH  HRKG A+ R+LD  ER+GY+KGVV+EVIHD GRGAPLAR
Sbjct  1    MGRVIRGQRKGAGSVFKSHNTHRKGAAKLRTLDASERHGYVKGVVTEVIHDSGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFR   RY H K+LFIAAEG++TGQ++YCG+KA L +GNV P+  +PEG V+CNVE KV
Sbjct  61   VTFRDTVRYMHDKQLFIAAEGIHTGQYIYCGQKATLNIGNVKPVGELPEGTVICNVEEKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYAI+++HNPD   TRIKLPS
Sbjct  121  GDRGAMARASGDYAIIVAHNPDAQITRIKLPS  152



>gb|AFY52372.1| ribosomal protein L2, partial [Cyrtandra kealiae subsp. kealiae]
Length=117

 Score =   226 bits (577),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  127  VFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLARVTFRHPFRYQHQKE  306
            VFKSHTHHRKGPARFRSLDFGERNGYLKGV++ +IHDPGRGAPLARVTFRHPFRY+HQKE
Sbjct  1    VFKSHTHHRKGPARFRSLDFGERNGYLKGVITXIIHDPGRGAPLARVTFRHPFRYKHQKE  60

Query  307  LFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKVGDRGVFARCSG  477
            LFIAAEGMYTGQFVYCGKKA LIVGNVLP+RSIPEGAV+CNVEH VGDRGVFAR SG
Sbjct  61   LFIAAEGMYTGQFVYCGKKANLIVGNVLPIRSIPEGAVICNVEHHVGDRGVFARASG  117



>gb|ABM55545.1| putative ribosomal protein L8e [Maconellicoccus hirsutus]
Length=258

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHT HRKG  R R+LD+ E++GY+KGVV +++HDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKSHTKHRKGAPRLRTLDYAEKHGYIKGVVKDILHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V F+ P+RY+ +KELFIA EGMYTGQF+YCGKKA L +GNV+P+ ++PEG+++CN+E K 
Sbjct  61   VHFKDPYRYKTRKELFIAPEGMYTGQFLYCGKKATLQIGNVIPVGNMPEGSIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD+  TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDSKRTRVKLPS  152



>emb|CAJ17248.1| ribosomal protein L8e [Meladema coriacea]
Length=237

 Score =   230 bits (587),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHT  RKG  + RSLDF ER+GY+KGVV  +IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKSHTKRRKGAPKLRSLDFAERHGYIKGVVKNIIHDPGRGAPLAM  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+++Q +KELFIA EGMYTGQF+YCGKKA L +GNV+P+ ++PEG +VCN+E K 
Sbjct  61   VHFRDPYKFQTRKELFIAPEGMYTGQFLYCGKKANLQIGNVMPVGAMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDTKKTRVKLPS  152



>gb|ACD65160.1| putative 60S ribosomal protein RPL8 [Phoronis muelleri]
Length=234

 Score =   230 bits (587),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKG GSVFK+HT +RKG A+ R++DF ER+GY+KGVV ++IHDPGRGAPLAR
Sbjct  1    MGRVIRSQRKGPGSVFKAHTKNRKGAAKLRAVDFAERHGYIKGVVKDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++Y+ ++E FIA EGMYTGQFVYCG+KA L +GNVLP+ ++PEG +VCNVE K 
Sbjct  61   VVFRDPYKYKLRRETFIACEGMYTGQFVYCGRKATLQIGNVLPVGTMPEGTIVCNVEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNPD   TRIKLPS
Sbjct  121  GDRGRIARASGNYATVISHNPDTKRTRIKLPS  152



>ref|XP_008478127.1| PREDICTED: 60S ribosomal protein L8 [Diaphorina citri]
 ref|XP_008478128.1| PREDICTED: 60S ribosomal protein L8 [Diaphorina citri]
Length=257

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SH  HRKG  + RSLDF ER+GYLKGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFRSHNKHRKGAPKLRSLDFAERHGYLKGVVRDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR+P++++  KELFIA EGMYTGQFVYCGKKA L +GNV+P+  +PEG +VCN+E K 
Sbjct  61   VHFRNPYKFKTNKELFIAPEGMYTGQFVYCGKKATLQIGNVMPVGGMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDTKRTRVKLPS  152



>gb|AFG29037.1| ribosomal protein L8, partial [Merizodus soledadinus]
Length=244

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+HT  RKG  + RSLD+ ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKAHTKKRKGAPKLRSLDYAERHGYIKGVVKDIIHDPGRGAPLAM  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+++Q +KELFIA EGMYTGQF+YCGKKA L +GNV+P+ ++PEG +VCN+E K 
Sbjct  61   VNFRDPYKFQTRKELFIAPEGMYTGQFLYCGKKANLQIGNVMPVGTMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDTRKTRVKLPS  152



>ref|XP_009534555.1| hypothetical protein PHYSODRAFT_338451 [Phytophthora sojae]
 gb|EGZ09694.1| hypothetical protein PHYSODRAFT_338451 [Phytophthora sojae]
Length=256

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGS+FKSHTH RKG A FR+LDF ER GY+KGVV E++HD GRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSIFKSHTHLRKGAAGFRALDFVERTGYIKGVVKEIVHDSGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTFR P+R+Q + EL IAAEGMYTG FVY G KA+L VGN LPL S+PEG +VCNVE KV
Sbjct  61   VTFRDPYRFQLKHELMIAAEGMYTGMFVYQGPKASLTVGNTLPLSSLPEGTIVCNVEAKV  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG FAR SGDYA++++H+ D G T+++LPS
Sbjct  121  GDRGSFARASGDYAVIVTHDEDKGKTKLRLPS  152



>ref|XP_003740440.1| PREDICTED: 60S ribosomal protein L8-like [Metaseiulus occidentalis]
Length=257

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKGAGSVF+SH  HRKG  + RS+DF ER+GY+KG+V +++HDPGRGAPLAR
Sbjct  1    MGRVIRSQRKGAGSVFRSHNKHRKGAPKLRSIDFAERHGYIKGIVKDILHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELF+A EGMYTGQ+VYCG+KA L VGNVLP+ ++PEG VVCN+E K 
Sbjct  61   VFFRDPYRYKQRKELFLACEGMYTGQYVYCGRKAQLQVGNVLPVGNMPEGTVVCNLEEKS  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA +I+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATIIAHNPDTKKTRVKLPS  152



>gb|AFY52388.1| ribosomal protein L2, partial [Cyrtandra sp. Kului 2]
Length=117

 Score =   226 bits (575),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  127  VFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLARVTFRHPFRYQHQKE  306
            VFKSHTHHRKGPARFRSLDFGERNGYLKGV++++IHDPGRGAPLARVTFRHPFRY+HQKE
Sbjct  1    VFKSHTHHRKGPARFRSLDFGERNGYLKGVITDIIHDPGRGAPLARVTFRHPFRYKHQKE  60

Query  307  LFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKVGDRGVFARCSG  477
            LFIAAEGMYTGQFVYCGKKA L VGNVLP+RSIPEGAV+CNVEH VGDRGVFAR SG
Sbjct  61   LFIAAEGMYTGQFVYCGKKANLXVGNVLPIRSIPEGAVICNVEHHVGDRGVFARASG  117



>gb|ABR27873.1| 60S ribosomal protein L8 [Triatoma infestans]
Length=258

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHT HRKG  + RSLDF ER+GY+KGVV E+IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFRSHTKHRKGAPKLRSLDFAERHGYIKGVVKEIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ +KELFIA EG+YTGQF+YCGKKA L +GNV+P+ ++PEG ++CN+E K 
Sbjct  61   VHFRDPYRFKTRKELFIAPEGIYTGQFLYCGKKANLHIGNVMPVGTMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDTKRTRVKLPS  152



>ref|XP_005832116.1| large subunit ribosomal protein L8e, cytoplasmic [Guillardia 
theta CCMP2712]
 gb|EKX45136.1| large subunit ribosomal protein L8e, cytoplasmic [Guillardia 
theta CCMP2712]
Length=263

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MG  IRAQR+GAGSVFKSHT HRKG    R+LDF ERNGY+KGV+ E+IHDPGRGAPLA+
Sbjct  1    MGVGIRAQRRGAGSVFKSHTKHRKGAVSLRTLDFAERNGYIKGVIKEIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+ Y+ +KELF AAEGMYTGQF+YCGKKA L VGNVLPL  +PEG V+CNVEH  
Sbjct  61   VQFRSPYSYKVEKELFAAAEGMYTGQFIYCGKKAQLTVGNVLPLSEMPEGTVICNVEHAA  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            G+ G  AR SGDY  +++ +PD G TRIKLPS
Sbjct  121  GNGGTMARASGDYCTIMTQDPDAGKTRIKLPS  152



>ref|XP_011207468.1| PREDICTED: 60S ribosomal protein L8 [Bactrocera dorsalis]
Length=256

 Score =   230 bits (586),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+H   RKG A+ R LDF ERNGY++GVV E+IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKAHVKRRKGAAKLRPLDFSERNGYIRGVVKEIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELFIA EGM+TGQFVYCG+KA L +GNV+PL  +PEG ++CN+E K 
Sbjct  61   VHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSVMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNPDTKKTRVKLPS  152



>gb|ADQ73877.1| 60S ribosomal protein L8 [Laodelphax striatella]
Length=258

 Score =   230 bits (586),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHT HRKG  + R LD+ ER+GYLKGVV  +IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFRSHTKHRKGAPKLRPLDYAERHGYLKGVVKNIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ +KELFIA EGMY+GQF+YCGKKA L +GNVLP+ ++PEG ++CN+E K 
Sbjct  61   VHFRDPYRFKTRKELFIAPEGMYSGQFIYCGKKATLQIGNVLPIGTMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVIAHNPDTKRTRVKLPS  152



>ref|XP_008554954.1| PREDICTED: 60S ribosomal protein L8 [Microplitis demolitor]
 ref|XP_008554955.1| PREDICTED: 60S ribosomal protein L8 [Microplitis demolitor]
Length=257

 Score =   229 bits (585),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHT  RKG  + RSLD+ E++GY+KGVV E++HDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKSHTKRRKGAPKLRSLDYSEKHGYIKGVVKEILHDPGRGAPLAW  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EGMYTGQF+YCGKKA L +GNV+P+ ++PEG +VCN+E K 
Sbjct  61   VHFRDPYKFKTRKELFIAPEGMYTGQFLYCGKKATLQIGNVMPVGTMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD+  TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDSKKTRVKLPS  152



>ref|XP_011305008.1| PREDICTED: 60S ribosomal protein L8 [Fopius arisanus]
Length=257

 Score =   229 bits (584),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHT  RKG  + RSLDF ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFRSHTKRRKGAPKLRSLDFSERHGYIKGVVKDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EGMYTGQF+YCGKKA L +GNV+P+ ++PEG +VCN+E K 
Sbjct  61   VHFRDPYKFKTRKELFIAPEGMYTGQFLYCGKKATLQIGNVMPVGTMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD+  TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDSKKTRVKLPS  152



>ref|XP_002046631.1| GJ12374 [Drosophila virilis]
 gb|EDW68973.1| GJ12374 [Drosophila virilis]
Length=256

 Score =   229 bits (584),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+H   RKG A+ RSLDF ER+GY++GVV +++HDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIVHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELFIA EGM+TGQFVYCG+KA L +GNV+PL  +PEG ++CN+E K 
Sbjct  61   VHFRDPYRYKLRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNPDTKKTRVKLPS  152



>gb|ABO26687.1| ribosomal protein l [Haliotis discus discus]
Length=259

 Score =   229 bits (584),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKG GSVFK+HT HRKG A+ R++D+ ER+GY+KG++ ++IHDPGRGAPL +
Sbjct  1    MGRVIRSQRKGPGSVFKAHTKHRKGAAKLRAVDYAERHGYIKGIIKDIIHDPGRGAPLCK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ + E FIAAEGMYTGQFVYCGKKA L VGNVLP+ S+PEG  +C++E K 
Sbjct  61   VVFRDPYRYKMKNETFIAAEGMYTGQFVYCGKKANLQVGNVLPVGSMPEGTTICSLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNPD   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPDTRRTRVKLPS  152



>ref|XP_002067839.1| GK12506 [Drosophila willistoni]
 gb|EDW78825.1| GK12506 [Drosophila willistoni]
Length=256

 Score =   229 bits (584),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+H   RKG A+ RSLDF ER+GY++GVV +++HDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIVHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELFIA EGM+TGQFVYCG+KA L +GNV+PL  +PEG ++CN+E K 
Sbjct  61   VHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNPDTKKTRVKLPS  152



>gb|AGM32497.1| 60S ribosomal protein L8 [Coptotermes formosanus]
Length=258

 Score =   229 bits (584),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKG GSVF+SHT HRKG  R R+LDF ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGRGSVFRSHTKHRKGAPRLRALDFAERHGYIKGVVKDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ +KELFIA EGMYTGQFVYCGKKA L +GNV+P+ S+PEG +VCN+E K 
Sbjct  61   VHFRDPYRFKTRKELFIAPEGMYTGQFVYCGKKANLQIGNVMPVGSMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KL S
Sbjct  121  GDRGRLARASGNYATVIAHNPDTKKTRVKLSS  152



>ref|XP_001354294.1| GA11728 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL31347.1| GA11728 [Drosophila pseudoobscura pseudoobscura]
Length=256

 Score =   229 bits (584),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+H   RKG A+ RSLDF ER+GY++GVV +++HDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIVHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELFIA EGM+TGQFVYCG+KA L +GNV+PL  +PEG ++CN+E K 
Sbjct  61   VHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNPDTKKTRVKLPS  152



>ref|XP_011195824.1| PREDICTED: 60S ribosomal protein L8 [Bactrocera cucurbitae]
Length=256

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+H   RKG A+ R LDF ERNGY++GVV E+IHDPGRGAPL+ 
Sbjct  1    MGRVIRAQRKGAGSVFKAHVKRRKGAAKLRPLDFSERNGYIRGVVKEIIHDPGRGAPLSV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELFIA EGM+TGQFVYCG+KA L +GNV+PL  +PEG ++CN+E K 
Sbjct  61   VHFRDPYRYKVRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSVMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNPDTKKTRVKLPS  152



>ref|XP_004525368.1| PREDICTED: 60S ribosomal protein L8-like [Ceratitis capitata]
Length=256

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+H   RKG A+ R LDF ERNGY++GVV E+IHDPGRGAPL+ 
Sbjct  1    MGRVIRAQRKGAGSVFKAHVKRRKGAAKLRPLDFSERNGYIRGVVKEIIHDPGRGAPLSV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELFIA EGM+TGQFVYCG+KA L +GNV+PL  +PEG ++CN+E K 
Sbjct  61   VHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSVMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNPDTKKTRVKLPS  152



>ref|XP_003699499.1| PREDICTED: 60S ribosomal protein L8-like [Megachile rotundata]
Length=257

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHT  RKG  + RSLDF ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFRSHTKRRKGAPKLRSLDFSERHGYIKGVVKDIIHDPGRGAPLAM  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EGMYTGQF+YCGKKA L +GNV+P+  +PEG +VCN+E K 
Sbjct  61   VHFRDPYKFKTRKELFIAPEGMYTGQFLYCGKKANLQIGNVMPVGQMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDTKKTRVKLPS  152



>ref|XP_002007266.1| GI12472 [Drosophila mojavensis]
 gb|EDW17742.1| GI12472 [Drosophila mojavensis]
Length=256

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+H   RKG A+ RSLDF ER+GY++GVV +++HDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIVHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KE+FIA EGM+TGQFVYCG+KA L +GNV+PL  +PEG ++CN+E K 
Sbjct  61   VHFRDPYRYKIRKEMFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNPDTKKTRVKLPS  152



>ref|XP_011154371.1| PREDICTED: 60S ribosomal protein L8 [Harpegnathos saltator]
 ref|XP_011145583.1| PREDICTED: 60S ribosomal protein L8 [Harpegnathos saltator]
 gb|EFN80472.1| 60S ribosomal protein L8 [Harpegnathos saltator]
 gb|EFN88141.1| 60S ribosomal protein L8 [Harpegnathos saltator]
Length=257

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHT  RKG  + RSLDF ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFRSHTKRRKGAPKLRSLDFSERHGYIKGVVKDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EGMYTGQF+YCGKKA L +GNV+P+ ++PEG +VCN+E K 
Sbjct  61   VHFRDPYKFKTRKELFIAPEGMYTGQFLYCGKKANLQIGNVMPVGTMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDTKKTRVKLPS  152



>ref|XP_967983.1| PREDICTED: 60S ribosomal protein L8 [Tribolium castaneum]
 ref|XP_008193915.1| PREDICTED: 60S ribosomal protein L8 [Tribolium castaneum]
 gb|EFA03346.1| hypothetical protein TcasGA2_TC013327 [Tribolium castaneum]
Length=257

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHT+ RKG  + R LDF ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKSHTNRRKGAPKLRYLDFSERHGYIKGVVKDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+++Q +KELFIA EGMYTGQFVYCGKKA L +GNVLP+ S+PEG +VCN+E K 
Sbjct  61   VHFRDPYKFQTRKELFIAPEGMYTGQFVYCGKKANLQIGNVLPIGSMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HN D   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNHDTKKTRVKLPS  152



>gb|AGF71018.1| Ribosomol Protein L2, partial [Cyrtandra schizocalyx]
Length=117

 Score =   223 bits (568),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  127  VFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLARVTFRHPFRYQHQKE  306
            VFKSHTHHRKGPARFRSLDFGERNGYLKGV++++IHDPGRGAPLARVTFRHPFRY+ QKE
Sbjct  1    VFKSHTHHRKGPARFRSLDFGERNGYLKGVITDIIHDPGRGAPLARVTFRHPFRYKQQKE  60

Query  307  LFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKVGDRGVFARCSG  477
            LFIAAEG+YTGQF+YCGKKA LIVGNVLP+RSIPEGAV+CNVEH VGDRGVFAR SG
Sbjct  61   LFIAAEGLYTGQFLYCGKKANLIVGNVLPIRSIPEGAVICNVEHHVGDRGVFARASG  117



>ref|XP_393671.2| PREDICTED: 60S ribosomal protein L8 [Apis mellifera]
 ref|XP_003692736.1| PREDICTED: 60S ribosomal protein L8-like [Apis florea]
 ref|XP_006607973.1| PREDICTED: 60S ribosomal protein L8-like [Apis dorsata]
Length=257

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHT  RKG  + RSLDF ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFRSHTKRRKGAPKLRSLDFSERHGYIKGVVKDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EGMYTGQF+YCGKKA L +GNV+P+  +PEG +VCN+E K 
Sbjct  61   VHFRDPYKFKTRKELFIAPEGMYTGQFLYCGKKANLQIGNVMPVGQMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDTKKTRVKLPS  152



>gb|KDO30353.1| 60S ribosomal protein L8 [Saprolegnia parasitica CBS 223.65]
Length=256

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGS+F+SHT  RKG A FR  D+ ER GY+KGV+ E+IHDPGRGAPLAR
Sbjct  1    MGRVIRGQRKGAGSIFRSHTKTRKGAAAFRVNDYVEREGYIKGVIKEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FR P+RY+ Q EL IAAEGMYTG F+Y GKKA + VGN+LPL  +PEG +VCNVE ++
Sbjct  61   VSFRDPYRYRIQHELMIAAEGMYTGMFIYAGKKANMAVGNILPLSQLPEGTIVCNVESRI  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GD+G +ARCSGDYA+++SH+ D G T+I+LPS
Sbjct  121  GDKGKYARCSGDYAVIVSHDEDKGKTKIRLPS  152



>gb|EDL29627.1| mCG131128, isoform CRA_c [Mus musculus]
Length=178

 Score =   225 bits (573),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKG AR R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   VVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>ref|XP_003003318.1| 60S ribosomal protein L2 [Verticillium alfalfae VaMs.102]
 ref|XP_009653632.1| 60S ribosomal protein L2 [Verticillium dahliae VdLs.17]
 gb|EEY20770.1| 60S ribosomal protein L2 [Verticillium alfalfae VaMs.102]
 gb|EGY14776.1| 60S ribosomal protein L2 [Verticillium dahliae VdLs.17]
Length=254

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKG GS+F ++T   K PA+FR+LD+ ERNGYL+G+V E+IHDPGRGAPLA+
Sbjct  1    MGRVIRNQRKGRGSIFTANTRLNKAPAKFRTLDYAERNGYLRGIVKEIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            VTF+ P++++   E FIA EGMYTGQFVY GK AAL VGN+LPL S+PEG V+ NVE K+
Sbjct  61   VTFKDPYKFKQHTETFIANEGMYTGQFVYAGKNAALTVGNILPLSSMPEGTVISNVEEKI  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+Y  +I HNPD G TRIKLPS
Sbjct  121  GDRGTLARTSGNYITIIGHNPDEGKTRIKLPS  152



>ref|XP_003488525.1| PREDICTED: 60S ribosomal protein L8-like [Bombus impatiens]
Length=257

 Score =   228 bits (580),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHT  RKG  + RSLDF ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFRSHTKRRKGAPKLRSLDFSERHGYIKGVVKDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EGMYTGQF+YCGKKA L +GNV+P+  +PEG ++CN+E K 
Sbjct  61   VHFRDPYKFKTRKELFIAPEGMYTGQFLYCGKKANLQIGNVMPVGQMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDTKKTRVKLPS  152



>ref|NP_001080465.1| 60S ribosomal protein L8 [Xenopus laevis]
 sp|P41116.3|RL8_XENLA RecName: Full=60S ribosomal protein L8 [Xenopus laevis]
 gb|AAA18911.1| ribosomal protein L8 [Xenopus laevis]
 gb|AAH43823.1| Rpl8 protein [Xenopus laevis]
Length=257

 Score =   227 bits (579),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVFK+H  HRKG A+ R++DF ERNGY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFKAHVKHRKGAAKLRAIDFAERNGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + ELF+AAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC VE K 
Sbjct  61   VAFRDPYRFKKRTELFVAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCVEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>ref|XP_004648827.1| PREDICTED: 60S ribosomal protein L8-like, partial [Octodon degus]
Length=166

 Score =   224 bits (571),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKG AR R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   VVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>gb|KIK45298.1| hypothetical protein CY34DRAFT_801802 [Suillus luteus UH-Slu-Lm8-n1]
Length=254

 Score =   227 bits (579),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQR+ + ++FK+HTHH K PA+ R+LDF ERNGY++G+V E+IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRR-SHAIFKAHTHHNKAPAKLRTLDFAERNGYVRGIVKEIIHDPGRGAPLAR  59

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KE FIA EGM+TG FVYCGKKAAL VGNVLP+   PEG +VCNVE KV
Sbjct  60   VVFRDPYRYKLRKETFIATEGMHTGSFVYCGKKAALTVGNVLPVSQCPEGTIVCNVEEKV  119

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI H+P++  TRI+LPS
Sbjct  120  GDRGALARTSGNYATVIGHSPEDNKTRIRLPS  151



>ref|XP_002158217.1| PREDICTED: 60S ribosomal protein L8-like [Hydra vulgaris]
Length=259

 Score =   227 bits (579),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++HTH RKG A+ R+LDF ERNGY+KGVV +++HD GRGAPLA 
Sbjct  1    MGRVIRGQRKGAGSVFRAHTHKRKGAAKLRALDFAERNGYIKGVVRDIVHDSGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EGM+TGQFVYCGKKAAL +GNVLP+  +PEG +VCN+E K 
Sbjct  61   VVFRDPYKFKLRKELFIATEGMHTGQFVYCGKKAALTIGNVLPVGVMPEGTIVCNLEEKS  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SGDYA V+SHN ++  TR+KLPS
Sbjct  121  GDRGKLARASGDYATVVSHNKESNVTRVKLPS  152



>ref|XP_001984329.1| GH16390 [Drosophila grimshawi]
 gb|EDV96677.1| GH16390 [Drosophila grimshawi]
Length=256

 Score =   227 bits (579),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+H   RKG A+ RSLDF ER+GY++GVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELFIA EGM+TGQFVYCG+KA L +GNV+PL  +PEG +VCN+E K 
Sbjct  61   VHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HN D   TR+KLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNQDTKKTRVKLPS  152



>gb|EAW82047.1| ribosomal protein L8, isoform CRA_a [Homo sapiens]
Length=167

 Score =   224 bits (571),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKG AR R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   VVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>gb|KHN00487.1| 60S ribosomal protein L8-3 [Glycine soja]
Length=234

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 122/152 (80%), Gaps = 26/152 (17%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVV++VIHDPGRGAPLA+
Sbjct  1    MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
                                      F+YCGKKA L+VGNVLPLRSIPEGAV+CNVEH V
Sbjct  61   --------------------------FIYCGKKATLVVGNVLPLRSIPEGAVICNVEHHV  94

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRGVFAR SGDYAIVISHNPDN T+RIKLPS
Sbjct  95   GDRGVFARASGDYAIVISHNPDNDTSRIKLPS  126



>ref|XP_005613443.1| PREDICTED: 60S ribosomal protein L8 [Equus caballus]
Length=256

 Score =   227 bits (579),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPAR R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGPARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   VVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>gb|AAX62427.1| ribosomal protein L8 [Lysiphlebus testaceipes]
Length=257

 Score =   227 bits (579),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF++HT  RKG  + RSLDF ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFRAHTKKRKGAPKLRSLDFSERHGYIKGVVRDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EGMYTGQF+YCGKKA L +GNV+P+ ++PEG +VCN+E K 
Sbjct  61   VHFRDPYKFKTRKELFIAPEGMYTGQFLYCGKKANLQIGNVMPVGTMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD+  TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDSKKTRVKLPS  152



>gb|ACD65115.1| putative 60S ribosomal protein RPL8 [Novocrania anomala]
Length=206

 Score =   225 bits (574),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKG GS+FK+HT HRKG AR R++DF ER+GY+KGVV +++HDPGRGAPLAR
Sbjct  1    MGRVIRGQRKGPGSIFKAHTKHRKGAARLRAVDFAERHGYIKGVVKDILHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++Y+ + E FIA EG+YTGQF+YCGKKA L +GNVLP+ ++PEG +VC++E K 
Sbjct  61   VVFRDPYKYKLRMETFIACEGLYTGQFIYCGKKANLQIGNVLPVGTMPEGTIVCSLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNPD   +R+KLPS
Sbjct  121  GDRGKIARASGNYATVISHNPDTKRSRVKLPS  152



>dbj|BAG62679.1| unnamed protein product [Homo sapiens]
Length=188

 Score =   224 bits (572),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKG AR R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   VVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>gb|KIK65760.1| hypothetical protein GYMLUDRAFT_159153 [Gymnopus luxurians FD-317 
M1]
Length=254

 Score =   226 bits (577),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQR+ + ++FKSHTHH K PA+ R LDF ERNGY++G+V E+IHD GRGAPLAR
Sbjct  1    MGRVIRAQRR-SHAIFKSHTHHNKAPAQLRKLDFAERNGYVRGIVKEIIHDAGRGAPLAR  59

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RYQ +KE F+A EG++TG FVYCGKKA L VGNVLPL   PEG +VCNVE KV
Sbjct  60   VVFRDPYRYQLRKETFVATEGLHTGAFVYCGKKAQLTVGNVLPLSQCPEGTIVCNVEEKV  119

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA +ISH+PD+  TRI+LPS
Sbjct  120  GDRGALARTSGNYATIISHSPDDNKTRIRLPS  151



>gb|EFA79851.1| 60S ribosomal protein L8 [Polysphondylium pallidum PN500]
Length=254

 Score =   226 bits (577),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKG-AGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGR+IRAQRKG AGSVF +HTHHRKG   FR+LD+ ERNGY+KGVVSE+IHDPGRGAPLA
Sbjct  1    MGRIIRAQRKGKAGSVFGAHTHHRKGAPSFRALDYAERNGYIKGVVSEIIHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RV FR    ++  K+LFIA EGMYTGQFV+ GKKA L +GN+LP+  +PEG +VCN+E +
Sbjct  61   RVVFRDTSSFKQDKQLFIAPEGMYTGQFVFAGKKATLTIGNILPVGKLPEGTIVCNLEER  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGD G  ARCSG+YA ++SHN D+G TRIKLPS
Sbjct  121  VGDCGAIARCSGNYATIVSHNTDDGITRIKLPS  153



>ref|XP_004443046.1| PREDICTED: 60S ribosomal protein L8 [Ceratotherium simum simum]
Length=257

 Score =   227 bits (578),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPAR R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGPARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   VVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>gb|AHB20200.1| ribosomal protein L8 [Pelophylax nigromaculatus]
Length=257

 Score =   227 bits (578),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC VE K 
Sbjct  61   VAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCVEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>gb|AAW51390.1| GekBS074P [Gekko japonicus]
Length=162

 Score =   223 bits (569),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MG VIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGFVIRGQRKGAGSVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   IVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCRLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>ref|XP_002083372.1| GD13692 [Drosophila simulans]
 gb|EDX08957.1| GD13692 [Drosophila simulans]
Length=256

 Score =   226 bits (577),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+H   RKG A+ RSLDF ER+GY++GVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELFIA EGM+TGQFVYCG+KA L +GNV+PL  +PEG ++CN+E K 
Sbjct  61   VHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HN D   TR+KLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNQDTKKTRVKLPS  152



>ref|XP_011344215.1| PREDICTED: 60S ribosomal protein L8 [Cerapachys biroi]
 ref|XP_011344216.1| PREDICTED: 60S ribosomal protein L8 [Cerapachys biroi]
 gb|EZA50948.1| 60S ribosomal protein L8 [Cerapachys biroi]
Length=257

 Score =   226 bits (577),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHT  RKG  + RSLDF ER+G++KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFRSHTKRRKGAPKLRSLDFSERHGFIKGVVKDIIHDPGRGAPLAM  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EGMYTGQF+YCGKKA L +GNV+P+  +PEG +VCN+E K 
Sbjct  61   VHFRDPYKFKTRKELFIAPEGMYTGQFLYCGKKANLQIGNVMPVGMMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVITHNPDTKKTRVKLPS  152



>ref|NP_524726.1| ribosomal protein L8, isoform A [Drosophila melanogaster]
 ref|NP_728756.1| ribosomal protein L8, isoform B [Drosophila melanogaster]
 ref|XP_001971290.1| GG14870 [Drosophila erecta]
 ref|XP_002035075.1| GM14495 [Drosophila sechellia]
 ref|XP_002094207.1| GE20324 [Drosophila yakuba]
 sp|Q9V3G1.1|RL8_DROME RecName: Full=60S ribosomal protein L8 [Drosophila melanogaster]
 pdb|3J39|A Chain A, Structure Of The D. Melanogaster 60s Ribosomal Proteins
 gb|AAF06828.1|AF098520_1 ribosomal protein L8 [Drosophila melanogaster]
 gb|AAF47659.1| ribosomal protein L8, isoform A [Drosophila melanogaster]
 gb|AAF47660.1| ribosomal protein L8, isoform B [Drosophila melanogaster]
 gb|AAL48964.1| RE37829p [Drosophila melanogaster]
 gb|AAT47764.1| RH21963p [Drosophila melanogaster]
 gb|EDV50316.1| GG14870 [Drosophila erecta]
 gb|EDW50211.1| GM14495 [Drosophila sechellia]
 gb|EDW93919.1| GE20324 [Drosophila yakuba]
 gb|ACL86762.1| RpL8-PA, partial [synthetic construct]
 gb|ACL92757.1| RpL8-PA [synthetic construct]
Length=256

 Score =   226 bits (577),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFK+H   RKG A+ RSLDF ER+GY++GVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ +KELFIA EGM+TGQFVYCG+KA L +GNV+PL  +PEG ++CN+E K 
Sbjct  61   VHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HN D   TR+KLPS
Sbjct  121  GDRGRLARTSGNYATVIAHNQDTKKTRVKLPS  152



>ref|XP_008606117.1| 60S ribosomal protein L8 [Saprolegnia diclina VS20]
 gb|EQC40418.1| 60S ribosomal protein L8 [Saprolegnia diclina VS20]
Length=256

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGS+F+SHT  RKG A FR  D+ ER GY+KGV+ E+IHDPGRGAPLAR
Sbjct  1    MGRVIRGQRKGAGSIFRSHTKTRKGAAAFRVNDYVEREGYIKGVIKEIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V+FR P+RY+ Q EL IAAEGMYTG F+Y GKKA + VGN+LPL  +PEG +VCNVE ++
Sbjct  61   VSFRDPYRYRIQHELMIAAEGMYTGMFIYAGKKANMAVGNILPLSQLPEGTIVCNVECRI  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GD+G +ARCSGDYA+++SH+ D G T+I+LPS
Sbjct  121  GDKGKYARCSGDYAVIVSHDEDKGKTKIRLPS  152



>gb|ABW23214.1| ribosomal protein rpl8 [Eurythoe complanata]
Length=260

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKG GSVF +HT HRKG AR R++D+ ER+GY+KGVV ++IHDPGRGAPLA+
Sbjct  1    MGRVIRSQRKGPGSVFTAHTKHRKGAARLRAVDYAERHGYIKGVVRDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+RY+ + E F+AAEGMYTGQF+YCGKKA L +GN+LP+ S+PEG +VC +E K 
Sbjct  61   VVFRDPYRYKLKTETFVAAEGMYTGQFLYCGKKANLQIGNILPVGSMPEGTIVCCMEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVISHNPDAKRTRVKLPS  152



>emb|CDI97033.1| 60S ribosomal protein L8 [Echinococcus multilocularis]
Length=259

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKGAGSVF++H  HRKGPA+ R +D+ ER+GY++GVV E++HDPGRGAPLAR
Sbjct  1    MGRVIRSQRKGAGSVFRAHVKHRKGPAKLRPVDYSERHGYIRGVVREIVHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR  + Y+H K+LFIAAEGM+TGQFVYCGKKAAL +GNVLPL S+PEG V+CNVE K 
Sbjct  61   VDFRDMYSYRHIKQLFIAAEGMHTGQFVYCGKKAALQIGNVLPLGSMPEGTVICNVEEKN  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR  G YA ++SHN D   TR+KLPS
Sbjct  121  GDRGRLARAGGTYATIVSHNHDTNKTRVKLPS  152



>ref|XP_007064510.1| PREDICTED: 60S ribosomal protein L8-like isoform X1 [Chelonia 
mydas]
Length=259

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAIDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   VAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>gb|AAM94272.1| ribosomal protein L8 [Azumapecten farreri]
Length=193

 Score =   224 bits (570),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKG G +FK+HT  RKG A  R +DF ER+GY+KGV+ ++IHDPGRGAPLA+
Sbjct  1    MGRVIRSQRKGPGCIFKAHTRTRKGKAALRPVDFAERHGYIKGVIRDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++Y+H+ E F+AAEGMYTGQFVYCGKKA+L +GN+LP+ S+PEG +VC +E K 
Sbjct  61   VAFRDPYKYRHKTETFVAAEGMYTGQFVYCGKKASLQIGNILPVGSMPEGTIVCCLEEKA  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNPD   +R+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPDTKKSRVKLPS  152



>ref|XP_005301814.1| PREDICTED: 60S ribosomal protein L8 [Chrysemys picta bellii]
 ref|XP_006134020.1| PREDICTED: 60S ribosomal protein L8-like [Pelodiscus sinensis]
 ref|XP_007064511.1| PREDICTED: 60S ribosomal protein L8-like isoform X2 [Chelonia 
mydas]
 ref|XP_007064512.1| PREDICTED: 60S ribosomal protein L8-like isoform X3 [Chelonia 
mydas]
 gb|EMP31499.1| 60S ribosomal protein L8, partial [Chelonia mydas]
Length=257

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAIDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   VAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>ref|XP_003398066.1| PREDICTED: 60S ribosomal protein L8-like [Bombus terrestris]
Length=257

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF+SHT  RKG  + RSLDF ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFRSHTKRRKGAPKLRSLDFSERHGYIKGVVKDIIHDPGRGAPLAV  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EGMYTGQF+YCG+KA L +GNV+P+  +PEG ++CN+E K 
Sbjct  61   VHFRDPYKFKTRKELFIAPEGMYTGQFLYCGRKANLQIGNVMPVGQMPEGTIICNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNPDTKKTRVKLPS  152



>ref|XP_005688829.1| PREDICTED: 60S ribosomal protein L8 [Capra hircus]
Length=257

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKG AR R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   VVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+  TTR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKTTRVKLPS  152



>gb|ABZ04222.1| ribosomal protein rpl8 [Lineus viridis]
Length=218

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHT  RKG A+ R++D+ ER+GY+KGVV ++IHDPGRGAPLAR
Sbjct  1    MGRVIRAQRKGAGSVFKSHTKTRKGAAKLRAVDYAERHGYIKGVVKDIIHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++Y+ + E F+A+EG+YTGQF+YCGKKA+L  GN+LP+ S+PEG ++C +E K 
Sbjct  61   VVFRDPYKYKLRTETFLASEGLYTGQFIYCGKKASLQTGNILPVGSMPEGTIICCLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNPD   +R+KLPS
Sbjct  121  GDRGRLARTSGNYATVISHNPDTKRSRVKLPS  152



>gb|ACR24945.1| ribosomal protein L8 [Lepidochitona cinerea]
Length=258

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKG GSVFK+HT+HRKG AR R++DF ER+GY+KGV+ ++IHD GRGAPLA+
Sbjct  1    MGRVIRSQRKGPGSVFKAHTNHRKGAARLRAVDFAERHGYIKGVIRDIIHDSGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P+R++ + E FIA EGMYTGQF+YCGKKA L +GN+LP+ S+PEG +VC++E K 
Sbjct  61   VMFRDPYRFRQKTETFIACEGMYTGQFIYCGKKATLQIGNILPVGSMPEGTIVCSMEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  A+ SG+YA VISHNPD   TR+K+PS
Sbjct  121  GDRGKIAKASGNYATVISHNPDTRRTRVKMPS  152



>gb|EUB59723.1| 60S ribosomal protein L8 [Echinococcus granulosus]
 emb|CDS21885.1| 60S ribosomal protein L8 [Echinococcus granulosus]
Length=259

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR+QRKGAGSVF++H  HRKGPA+ R +D+ ER+GY++GVV E++HDPGRGAPLAR
Sbjct  1    MGRVIRSQRKGAGSVFRAHVKHRKGPAKLRPVDYSERHGYIRGVVREIVHDPGRGAPLAR  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR  + Y+H K+LFIAAEGM+TGQFVYCGKKAAL +GNVLPL S+PEG V+CNVE K 
Sbjct  61   VDFRDMYSYRHIKQLFIAAEGMHTGQFVYCGKKAALQIGNVLPLGSMPEGTVICNVEEKN  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR  G YA ++SHN D   TR+KLPS
Sbjct  121  GDRGRLARAGGTYATIVSHNHDTNRTRVKLPS  152



>ref|XP_009556955.1| PREDICTED: 60S ribosomal protein L8 [Cuculus canorus]
Length=257

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   IAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>ref|XP_008498553.1| PREDICTED: 60S ribosomal protein L8 isoform X1 [Calypte anna]
Length=260

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   IAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>gb|ACH43811.1| putative ribosomal protein L8 [Taeniopygia guttata]
Length=257

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   IAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>gb|KFO69777.1| 60S ribosomal protein L8, partial [Cuculus canorus]
Length=260

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  4    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  63

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  64   IAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  123

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  124  GDRGKLARASGNYATVISHNPETKKTRVKLPS  155



>ref|NP_001232342.1| putative ribosomal protein L8 [Taeniopygia guttata]
 ref|NP_001264657.1| 60S ribosomal protein L8 [Gallus gallus]
 ref|XP_003203061.1| PREDICTED: 60S ribosomal protein L8 [Meleagris gallopavo]
 ref|XP_005037306.1| PREDICTED: 60S ribosomal protein L8-like isoform X2 [Ficedula 
albicollis]
 ref|XP_005151782.1| PREDICTED: 60S ribosomal protein L8-like [Melopsittacus undulatus]
 ref|XP_005526549.1| PREDICTED: 60S ribosomal protein L8-like isoform X1 [Pseudopodoces 
humilis]
 ref|XP_005526550.1| PREDICTED: 60S ribosomal protein L8-like isoform X2 [Pseudopodoces 
humilis]
 ref|XP_008498554.1| PREDICTED: 60S ribosomal protein L8 isoform X2 [Calypte anna]
 ref|XP_008631246.1| PREDICTED: 60S ribosomal protein L8 [Corvus brachyrhynchos]
 ref|XP_009073686.1| PREDICTED: 60S ribosomal protein L8 isoform X2 [Acanthisitta 
chloris]
 ref|XP_009087869.1| PREDICTED: 60S ribosomal protein L8 [Serinus canaria]
 ref|XP_009874582.1| PREDICTED: 60S ribosomal protein L8 [Apaloderma vittatum]
 ref|XP_009902549.1| PREDICTED: 60S ribosomal protein L8 [Picoides pubescens]
 ref|XP_009982046.1| PREDICTED: 60S ribosomal protein L8 [Tauraco erythrolophus]
 ref|XP_009996077.1| PREDICTED: 60S ribosomal protein L8 [Chaetura pelagica]
 ref|XP_010221839.1| PREDICTED: 60S ribosomal protein L8 [Tinamus guttatus]
 ref|XP_010289620.1| PREDICTED: 60S ribosomal protein L8 [Phaethon lepturus]
 ref|XP_010392869.1| PREDICTED: 60S ribosomal protein L8 [Corvus cornix cornix]
 ref|XP_010569659.1| PREDICTED: 60S ribosomal protein L8 [Haliaeetus leucocephalus]
 ref|XP_010569660.1| PREDICTED: 60S ribosomal protein L8 [Haliaeetus leucocephalus]
 gb|ACH46357.1| putative ribosomal protein L8 [Taeniopygia guttata]
 gb|ACH46385.1| putative ribosomal protein L8 [Taeniopygia guttata]
 gb|KFU84089.1| 60S ribosomal protein L8 [Chaetura pelagica]
 gb|KFV61945.1| 60S ribosomal protein L8 [Picoides pubescens]
Length=257

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   IAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>gb|KFV15691.1| 60S ribosomal protein L8, partial [Tauraco erythrolophus]
Length=259

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  3    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  62

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  63   IAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  122

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  123  GDRGKLARASGNYATVISHNPETKKTRVKLPS  154



>gb|KFP05901.1| 60S ribosomal protein L8, partial [Calypte anna]
Length=260

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  4    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  63

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  64   IAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  123

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  124  GDRGKLARASGNYATVISHNPETKKTRVKLPS  155



>ref|XP_005037305.1| PREDICTED: 60S ribosomal protein L8-like isoform X1 [Ficedula 
albicollis]
Length=266

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   IAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



>gb|AEE62804.1| unknown [Dendroctonus ponderosae]
 gb|ENN77183.1| hypothetical protein YQE_06321, partial [Dendroctonus ponderosae]
Length=257

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVFKSHT  RKG  + R LDF ER+GY+KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFKSHTKKRKGAPKLRYLDFSERHGYIKGVVKDIIHDPGRGAPLAT  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EG+YTGQFVYCGKKA+L +GNVLP+ ++PEG +VCN+E K 
Sbjct  61   VHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKASLQIGNVLPIGTMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HN D   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVIAHNHDTKKTRVKLPS  152



>dbj|GAM25974.1| hypothetical protein SAMD00019534_091490, partial [Acytostelium 
subglobosum LB1]
Length=254

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  85   MGRVIRAQRKG-AGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLA  261
            MGR+IRAQRKG +GSVF +HTH RKG   FR+LD+ ERNGY+KGVVSE+IHDPGRGAPLA
Sbjct  1    MGRIIRAQRKGKSGSVFGAHTHGRKGSPSFRALDYAERNGYIKGVVSEIIHDPGRGAPLA  60

Query  262  RVTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHK  441
            RV FR   R+++ K+LFIA EGMYTGQFV+ GKKA L +GNVLP+  +PEG +VCN+E K
Sbjct  61   RVIFRDTTRFRNDKQLFIAPEGMYTGQFVFAGKKATLTIGNVLPIGKLPEGTIVCNLEEK  120

Query  442  VGDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            VGD G  ARCSG+YA V+SHN D G TR+KLPS
Sbjct  121  VGDCGSLARCSGNYATVVSHNTDEGVTRVKLPS  153



>ref|XP_011160596.1| PREDICTED: 60S ribosomal protein L8 [Solenopsis invicta]
 gb|EFZ17738.1| hypothetical protein SINV_06691 [Solenopsis invicta]
Length=257

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIRAQRKGAGSVF SHT  RKG  + RSLDF ER+G++KGVV ++IHDPGRGAPLA 
Sbjct  1    MGRVIRAQRKGAGSVFASHTKRRKGAPKLRSLDFSERHGFIKGVVKDIIHDPGRGAPLAL  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            V FR P++++ +KELFIA EGMYTGQF+YCGKKA L +GNV+P+  +PEG +VCN+E K 
Sbjct  61   VHFRDPYKFKTRKELFIAPEGMYTGQFLYCGKKANLQIGNVMPVGMMPEGTIVCNLEEKT  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VI+HNPD   TR+KLPS
Sbjct  121  GDRGRLARASGNYATVITHNPDTKKTRVKLPS  152



>ref|XP_006015707.1| PREDICTED: 60S ribosomal protein L8-like [Alligator sinensis]
 ref|XP_006266737.1| PREDICTED: 60S ribosomal protein L8-like [Alligator mississippiensis]
Length=257

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +1

Query  85   MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVSEVIHDPGRGAPLAR  264
            MGRVIR QRKGAGSVF++H  HRKGPA+ R++DF ER+GY+KG+V ++IHDPGRGAPLA+
Sbjct  1    MGRVIRGQRKGAGSVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAK  60

Query  265  VTFRHPFRYQHQKELFIAAEGMYTGQFVYCGKKAALIVGNVLPLRSIPEGAVVCNVEHKV  444
            + FR P+R++ + ELFIAAEG++TGQFVYCGKKA L +GNVLP+ ++PEG +VC +E K 
Sbjct  61   IVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKP  120

Query  445  GDRGVFARCSGDYAIVISHNPDNGTTRIKLPS  540
            GDRG  AR SG+YA VISHNP+   TR+KLPS
Sbjct  121  GDRGKLARASGNYATVISHNPETKKTRVKLPS  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645