BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H08

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009784151.1|  PREDICTED: ferrochelatase-2, chloroplastic       84.7    8e-16   Nicotiana sylvestris
gb|AEB38782.1|  ferrochelatase isoform I                              82.0    8e-15   Nicotiana tabacum [American tobacco]
ref|XP_009626129.1|  PREDICTED: ferrochelatase-2, chloroplastic       79.3    7e-14   Nicotiana tomentosiformis
ref|XP_006355325.1|  PREDICTED: ferrochelatase-2, chloroplastic-like  74.3    3e-12   Solanum tuberosum [potatoes]
ref|XP_004249490.1|  PREDICTED: ferrochelatase-2, chloroplastic i...  73.2    7e-12   Solanum lycopersicum
ref|XP_004245114.1|  PREDICTED: ferrochelatase-2, chloroplastic-l...  70.9    4e-11   Solanum lycopersicum
ref|XP_010312259.1|  PREDICTED: ferrochelatase-2, chloroplastic i...  65.5    3e-09   Solanum lycopersicum
ref|XP_010325044.1|  PREDICTED: ferrochelatase-2, chloroplastic-l...  62.8    2e-08   Solanum lycopersicum
emb|CDP08238.1|  unnamed protein product                              51.2    1e-04   Coffea canephora [robusta coffee]



>ref|XP_009784151.1| PREDICTED: ferrochelatase-2, chloroplastic [Nicotiana sylvestris]
Length=487

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +2

Query  335  CPQTRLTPTLNLSYGESQMNCSSHEASVSICSKSAANKSHVFGGLSLHCTLQKREPIGKT  514
            CP+TRL P  ++S+G  +MN +  E S+ + S++   KS VFGGLSLH  + KR+P+GK 
Sbjct  30   CPRTRLMPACHVSHGGREMNPTEQELSLVLSSEN--KKSSVFGGLSLHRPVHKRDPVGKM  87

Query  515  FCSVGVCTYPGSVIE  559
            FCSVGV TYPGS+ E
Sbjct  88   FCSVGVYTYPGSIAE  102



>gb|AEB38782.1| ferrochelatase isoform I [Nicotiana tabacum]
Length=487

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +2

Query  335  CPQTRLTPTLNLSYGESQMNCSSHEASVSICSKSAANKSHVFGGLSLHCTLQKREPIGKT  514
            CP+TRL P  ++S+G  +MN +  E S+ + S++   KS VFGG SLH  + KR+P+GKT
Sbjct  30   CPRTRLMPACHVSHGGREMNPTEQELSLVLSSEN--KKSSVFGGSSLHRPVHKRDPVGKT  87

Query  515  FCSVGVCTYPGSVIE  559
            FCSVG  TYPGS+ E
Sbjct  88   FCSVGAYTYPGSIAE  102



>ref|XP_009626129.1| PREDICTED: ferrochelatase-2, chloroplastic [Nicotiana tomentosiformis]
Length=488

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  335  CPQTRLTPTLNLSYGESQMNCSSHEASVSICSKSAANKSHVFGGLSLHCTLQKREPIGKT  514
            CP+TRL P  ++S+G  + N +  E S+ + S++   KS VFGG SLH  + KR+P+GKT
Sbjct  31   CPRTRLMPACHVSHGGQETNPTEQELSMVLSSEN--KKSSVFGGSSLHRPVHKRDPVGKT  88

Query  515  FCSVGVCTYPGSVIE  559
            FCSVG  TYPGS+ E
Sbjct  89   FCSVGAYTYPGSIAE  103



>ref|XP_006355325.1| PREDICTED: ferrochelatase-2, chloroplastic-like [Solanum tuberosum]
Length=489

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  335  CPQTRLTPTLNLSYGESQMNCSSHEASVSICSKSAANKSHVFGGLSLHCTLQKREPIGKT  514
            C Q RL P  + S+G  +MN    E +V + S+    KS V GGLSLH  + KR+ +GKT
Sbjct  31   CSQKRLMPACHSSHGGREMNSDEREITV-LSSEPTLKKSSVVGGLSLHRPVHKRDVVGKT  89

Query  515  FCSVGVCTYPGSVIE  559
            FCSVG+ TYPGS++E
Sbjct  90   FCSVGLSTYPGSIVE  104



>ref|XP_004249490.1| PREDICTED: ferrochelatase-2, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=488

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +2

Query  335  CPQTRLTPTLNLSYGESQMNCSSHEASVSICSKSAANKSHVFGGLSLHCTLQKREPIGKT  514
            C +TRL P  + S+G  +MN    E +V + S+    +S V GGLSLH  L KR+ +GKT
Sbjct  31   CTRTRLMPACHSSHGGREMNSDEREITV-LSSELTLKRSSVGGGLSLHRPLHKRDVVGKT  89

Query  515  FCSVGVCTYPGSVIE  559
            FCSVG+ TYPGS++E
Sbjct  90   FCSVGLSTYPGSIVE  104



>ref|XP_004245114.1| PREDICTED: ferrochelatase-2, chloroplastic-like isoform X1 [Solanum 
lycopersicum]
Length=489

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  335  CPQTRLTPTLNLSYGESQMNCSSHEASVSICSKSAANKSHVFGGLSLHCTLQKREPIGKT  514
            C +TRL P  + S+G  +MN    E ++ + S+    KS V  GLSLH  + KR+ +GKT
Sbjct  31   CSRTRLMPPFHSSHGGREMNSDEREITI-LSSELTLKKSSVVEGLSLHRPVHKRDVVGKT  89

Query  515  FCSVGVCTYPGSVIE  559
            FCSVG+ T+PGS++E
Sbjct  90   FCSVGLSTFPGSIVE  104



>ref|XP_010312259.1| PREDICTED: ferrochelatase-2, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=452

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +2

Query  371  SYGESQMNCSSHEASVSICSKSAANKSHVFGGLSLHCTLQKREPIGKTFCSVGVCTYPGS  550
            S+G  +MN    E +V + S+    +S V GGLSLH  L KR+ +GKTFCSVG+ TYPGS
Sbjct  7    SHGGREMNSDEREITV-LSSELTLKRSSVGGGLSLHRPLHKRDVVGKTFCSVGLSTYPGS  65

Query  551  VIE  559
            ++E
Sbjct  66   IVE  68



>ref|XP_010325044.1| PREDICTED: ferrochelatase-2, chloroplastic-like isoform X2 [Solanum 
lycopersicum]
Length=453

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +2

Query  356  PTLNLSYGESQMNCSSHEASVSICSKSAANKSHVFGGLSLHCTLQKREPIGKTFCSVGVC  535
            P  + S+G  +MN    E ++ + S+    KS V  GLSLH  + KR+ +GKTFCSVG+ 
Sbjct  2    PPFHSSHGGREMNSDEREITI-LSSELTLKKSSVVEGLSLHRPVHKRDVVGKTFCSVGLS  60

Query  536  TYPGSVIE  559
            T+PGS++E
Sbjct  61   TFPGSIVE  68



>emb|CDP08238.1| unnamed protein product [Coffea canephora]
Length=491

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = +2

Query  353  TPTLNLSYGESQMNCSSHEASVSICSKSAANKSHVFGGLSLHCTLQKREPIGKTFCSVGV  532
             P+   S+   Q+ C S+EAS +    S A KS+V GGLSL      R+ +GKTFCS G 
Sbjct  40   APSFKASHDGKQIYCQSNEASATQSCGSTAQKSNVLGGLSLKS---HRQTVGKTFCSAGE  96

Query  533  CTYPGSVI  556
              Y G  I
Sbjct  97   YAYSGGAI  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840