BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H07

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004171648.1|  PREDICTED: serine/threonine-protein phosphat...    157   9e-45   
ref|XP_010112705.1|  Serine/threonine-protein phosphatase BSL1          164   5e-43   
ref|XP_004290707.1|  PREDICTED: serine/threonine-protein phosphat...    163   6e-43   Fragaria vesca subsp. vesca
gb|KHG21886.1|  Serine/threonine-protein phosphatase BSL1               163   6e-43   Gossypium arboreum [tree cotton]
gb|KHG21887.1|  Serine/threonine-protein phosphatase BSL1               163   7e-43   Gossypium arboreum [tree cotton]
ref|XP_007050742.1|  BRI1 suppressor 1 (BSU1)-like 1                    163   8e-43   
gb|EYU44112.1|  hypothetical protein MIMGU_mgv1a025841mg                153   1e-42   Erythranthe guttata [common monkey flower]
ref|XP_003591564.1|  Serine/threonine protein phosphatase               152   2e-42   
ref|NP_001266004.1|  Hop-interacting protein THI129                     162   2e-42   Solanum lycopersicum
gb|AFN44700.1|  Ser/Thr phosphatase-containing Kelch repeat domai...    162   2e-42   Solanum tuberosum [potatoes]
emb|CDP03570.1|  unnamed protein product                                161   3e-42   Coffea canephora [robusta coffee]
ref|XP_007201214.1|  hypothetical protein PRUPE_ppa001177mg             161   4e-42   Prunus persica
ref|XP_008234964.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    161   4e-42   Prunus mume [ume]
gb|EYU38113.1|  hypothetical protein MIMGU_mgv1a0013161mg               159   5e-42   Erythranthe guttata [common monkey flower]
ref|XP_009778415.1|  PREDICTED: serine/threonine-protein phosphat...    160   1e-41   Nicotiana sylvestris
ref|XP_010556800.1|  PREDICTED: serine/threonine-protein phosphat...    159   1e-41   
ref|XP_002520710.1|  bsu-protein phosphatase, putative                  159   1e-41   Ricinus communis
ref|XP_008449460.1|  PREDICTED: serine/threonine-protein phosphat...    159   2e-41   Cucumis melo [Oriental melon]
ref|XP_004140092.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    159   2e-41   
ref|XP_008386603.1|  PREDICTED: serine/threonine-protein phosphat...    159   3e-41   
ref|XP_008368903.1|  PREDICTED: serine/threonine-protein phosphat...    159   3e-41   
ref|XP_010556798.1|  PREDICTED: serine/threonine-protein phosphat...    158   4e-41   Tarenaya hassleriana [spider flower]
ref|XP_011082512.1|  PREDICTED: serine/threonine-protein phosphat...    158   4e-41   Sesamum indicum [beniseed]
gb|KDP21537.1|  hypothetical protein JCGZ_22008                         158   5e-41   Jatropha curcas
ref|XP_009347104.1|  PREDICTED: serine/threonine-protein phosphat...    158   6e-41   Pyrus x bretschneideri [bai li]
gb|EPS69063.1|  serine/threonine-protein phosphatase                    151   1e-40   Genlisea aurea
ref|XP_009593091.1|  PREDICTED: serine/threonine-protein phosphat...    157   1e-40   Nicotiana tomentosiformis
gb|KDO87445.1|  hypothetical protein CISIN_1g002713mg                   156   2e-40   Citrus sinensis [apfelsine]
emb|CDX90906.1|  BnaA03g25860D                                          156   3e-40   
emb|CDY17964.1|  BnaC03g30360D                                          156   3e-40   Brassica napus [oilseed rape]
ref|XP_009134374.1|  PREDICTED: serine/threonine-protein phosphat...    156   3e-40   Brassica rapa
ref|XP_004496005.1|  PREDICTED: serine/threonine-protein phosphat...    156   3e-40   
ref|XP_004496006.1|  PREDICTED: serine/threonine-protein phosphat...    155   3e-40   Cicer arietinum [garbanzo]
gb|KJB22560.1|  hypothetical protein B456_004G054500                    155   3e-40   Gossypium raimondii
gb|KJB42021.1|  hypothetical protein B456_007G132700                    155   4e-40   Gossypium raimondii
ref|XP_006444191.1|  hypothetical protein CICLE_v10018791mg             155   6e-40   Citrus clementina [clementine]
ref|XP_010279479.1|  PREDICTED: serine/threonine-protein phosphat...    155   6e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006444192.1|  hypothetical protein CICLE_v10018791mg             155   6e-40   Citrus clementina [clementine]
ref|XP_006286760.1|  hypothetical protein CARUB_v10003201mg             155   8e-40   Capsella rubella
ref|XP_010522672.1|  PREDICTED: serine/threonine-protein phosphat...    154   8e-40   Tarenaya hassleriana [spider flower]
ref|XP_002872798.1|  kelch repeat-containing serine/threonine pho...    154   9e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_002270638.2|  PREDICTED: serine/threonine-protein phosphat...    154   1e-39   Vitis vinifera
ref|XP_010455968.1|  PREDICTED: serine/threonine-protein phosphat...    154   1e-39   
ref|XP_010422504.1|  PREDICTED: serine/threonine-protein phosphat...    154   1e-39   
ref|XP_006575099.1|  PREDICTED: serine/threonine-protein phosphat...    153   1e-39   
ref|XP_010430668.1|  PREDICTED: serine/threonine-protein phosphat...    154   2e-39   Camelina sativa [gold-of-pleasure]
gb|KHG15629.1|  Serine/threonine-protein phosphatase BSL1 -like p...    153   2e-39   Gossypium arboreum [tree cotton]
ref|NP_192217.2|  serine/threonine-protein phosphatase BSL1             154   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008368904.1|  PREDICTED: serine/threonine-protein phosphat...    154   2e-39   
gb|AAC79097.1|  putative phospho-ser/thr phosphatase                    154   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AES61845.2|  serine/threonine-protein phosphatase                    153   2e-39   Medicago truncatula
gb|AAM83219.1|  AT4g03080/T4I9_4                                        153   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002321044.2|  phosphatase family protein                         153   3e-39   
gb|AFY26889.1|  kelch repeat-containing serine/threonine phosphoe...    152   4e-39   Morella rubra [Chinese arbutus]
ref|XP_003518942.1|  PREDICTED: serine/threonine-protein phosphat...    152   5e-39   Glycine max [soybeans]
ref|XP_007144577.1|  hypothetical protein PHAVU_007G167400g             152   5e-39   Phaseolus vulgaris [French bean]
gb|KFK30905.1|  hypothetical protein AALP_AA6G041300                    152   9e-39   Arabis alpina [alpine rockcress]
ref|XP_010070326.1|  PREDICTED: serine/threonine-protein phosphat...    151   1e-38   Eucalyptus grandis [rose gum]
ref|XP_011033645.1|  PREDICTED: serine/threonine-protein phosphat...    150   2e-38   Populus euphratica
ref|XP_011033646.1|  PREDICTED: serine/threonine-protein phosphat...    150   2e-38   Populus euphratica
ref|XP_006396534.1|  hypothetical protein EUTSA_v10028417mg             150   2e-38   Eutrema salsugineum [saltwater cress]
emb|CDY62088.1|  BnaC02g46770D                                          150   3e-38   Brassica napus [oilseed rape]
ref|XP_003536338.1|  PREDICTED: serine/threonine-protein phosphat...    150   3e-38   Glycine max [soybeans]
gb|KJB22562.1|  hypothetical protein B456_004G054500                    150   4e-38   Gossypium raimondii
emb|CDX97296.1|  BnaA02g20870D                                          150   5e-38   
ref|XP_009144526.1|  PREDICTED: serine/threonine-protein phosphat...    150   5e-38   Brassica rapa
ref|XP_010244624.1|  PREDICTED: serine/threonine-protein phosphat...    149   9e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010244625.1|  PREDICTED: serine/threonine-protein phosphat...    149   9e-38   Nelumbo nucifera [Indian lotus]
ref|XP_002301559.1|  phosphatase family protein                         147   3e-37   
ref|XP_008813651.1|  PREDICTED: serine/threonine-protein phosphat...    142   3e-37   
ref|XP_008813652.1|  PREDICTED: serine/threonine-protein phosphat...    142   3e-37   
ref|XP_008813653.1|  PREDICTED: serine/threonine-protein phosphat...    142   3e-37   Phoenix dactylifera
ref|XP_011011094.1|  PREDICTED: serine/threonine-protein phosphat...    147   4e-37   Populus euphratica
gb|AEK86563.1|  serine/threonine-protein phosphatase                    147   6e-37   Camellia sinensis [black tea]
ref|XP_011011092.1|  PREDICTED: serine/threonine-protein phosphat...    146   9e-37   Populus euphratica
ref|XP_011011093.1|  PREDICTED: serine/threonine-protein phosphat...    146   9e-37   Populus euphratica
emb|CAN67846.1|  hypothetical protein VITISV_016669                     135   8e-36   Vitis vinifera
ref|XP_010910522.1|  PREDICTED: serine/threonine-protein phosphat...    137   1e-35   Elaeis guineensis
ref|XP_010684726.1|  PREDICTED: serine/threonine-protein phosphat...    141   4e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009385028.1|  PREDICTED: serine/threonine-protein phosphat...    140   7e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846753.1|  hypothetical protein AMTR_s00276p00018700          118   3e-29   
ref|XP_010904839.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    124   4e-29   Elaeis guineensis
ref|XP_004960470.1|  PREDICTED: serine/threonine-protein phosphat...    121   5e-28   Setaria italica
gb|AFW82656.1|  hypothetical protein ZEAMMB73_760112                    118   8e-28   
ref|XP_002439264.1|  hypothetical protein SORBIDRAFT_09g003440          120   1e-27   Sorghum bicolor [broomcorn]
ref|XP_008795124.1|  PREDICTED: serine/threonine-protein phosphat...    119   3e-27   Phoenix dactylifera
ref|XP_008655295.1|  PREDICTED: uncharacterized protein LOC100383...    118   8e-27   Zea mays [maize]
ref|XP_008655294.1|  PREDICTED: uncharacterized protein LOC100383...    118   8e-27   Zea mays [maize]
gb|EEE62303.1|  hypothetical protein OsJ_17091                          117   8e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054625.1|  Os05g0144400                                       117   9e-27   
ref|XP_003568959.1|  PREDICTED: serine/threonine-protein phosphat...    115   6e-26   Brachypodium distachyon [annual false brome]
ref|NP_171844.6|  serine/threonine-protein phosphatase BSU1             111   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010231726.1|  PREDICTED: serine/threonine-protein phosphat...    110   4e-24   Brachypodium distachyon [annual false brome]
ref|XP_010231727.1|  PREDICTED: serine/threonine-protein phosphat...    110   4e-24   Brachypodium distachyon [annual false brome]
ref|XP_002892160.1|  Serine/threonine-protein phosphatase BSU1          104   3e-22   
gb|KGN66599.1|  hypothetical protein Csa_1G638460                     96.3    2e-19   Cucumis sativus [cucumbers]
ref|XP_006367867.1|  PREDICTED: serine/threonine-protein phosphat...  93.2    3e-19   
gb|KHG00523.1|  Serine/threonine-protein phosphatase BSL3 -like p...  92.8    3e-19   Gossypium arboreum [tree cotton]
ref|XP_010045170.1|  PREDICTED: serine/threonine-protein phosphat...  95.5    4e-19   Eucalyptus grandis [rose gum]
dbj|BAH19666.1|  AT1G08420                                            95.5    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172318.1|  serine/threonine-protein phosphatase BSL2           95.5    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008450272.1|  PREDICTED: serine/threonine-protein phosphat...  95.5    5e-19   
ref|XP_004139147.1|  PREDICTED: serine/threonine-protein phosphat...  95.5    5e-19   
ref|NP_001184935.1|  serine/threonine-protein phosphatase BSL2        95.5    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010263036.1|  PREDICTED: serine/threonine-protein phosphat...  95.5    5e-19   Nelumbo nucifera [Indian lotus]
gb|EYU25964.1|  hypothetical protein MIMGU_mgv1a0006242mg             92.0    6e-19   Erythranthe guttata [common monkey flower]
ref|XP_010247574.1|  PREDICTED: serine/threonine-protein phosphat...  95.1    7e-19   Nelumbo nucifera [Indian lotus]
gb|EYU41291.1|  hypothetical protein MIMGU_mgv1a0202661mg             92.0    7e-19   Erythranthe guttata [common monkey flower]
gb|ABV91338.1|  kelch repeat-containing protein /serine/threonine...  95.1    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001760494.1|  predicted protein                                94.7    8e-19   
dbj|BAK03675.1|  predicted protein                                    92.0    9e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007150014.1|  hypothetical protein PHAVU_005G118700g           94.7    1e-18   Phaseolus vulgaris [French bean]
ref|XP_001781021.1|  predicted protein                                94.4    1e-18   
ref|XP_002889692.1|  kelch repeat-containing protein                  94.4    1e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_007015657.1|  BRI1 suppressor 1 (BSU1)-like 2 isoform 1        94.4    1e-18   
ref|XP_010488844.1|  PREDICTED: serine/threonine-protein phosphat...  94.4    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009373887.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_008385576.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    1e-18   
gb|KFK43163.1|  hypothetical protein AALP_AA1G088000                  94.0    1e-18   Arabis alpina [alpine rockcress]
ref|XP_008361620.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    1e-18   
ref|XP_009368358.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_006369377.1|  hypothetical protein POPTR_0001s22320g           94.0    1e-18   
ref|XP_009336399.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_008230041.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    1e-18   Prunus mume [ume]
ref|XP_007208428.1|  hypothetical protein PRUPE_ppa000783mg           94.0    1e-18   Prunus persica
ref|XP_008230036.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    2e-18   Prunus mume [ume]
ref|XP_009398342.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398341.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010101992.1|  Serine/threonine-protein phosphatase BSL2        94.0    2e-18   
ref|XP_011044597.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    2e-18   Populus euphratica
ref|XP_006594918.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    2e-18   Glycine max [soybeans]
gb|KHG29076.1|  Serine/threonine-protein phosphatase BSL3 -like p...  94.0    2e-18   Gossypium arboreum [tree cotton]
emb|CDY22684.1|  BnaC08g43180D                                        94.0    2e-18   Brassica napus [oilseed rape]
dbj|BAF00990.1|  putative phosphoprotein phosphatase                  93.6    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KJB55556.1|  hypothetical protein B456_009G082300                  94.0    2e-18   Gossypium raimondii
ref|XP_003543410.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    2e-18   Glycine max [soybeans]
ref|XP_007132502.1|  hypothetical protein PHAVU_011G099600g           94.0    2e-18   Phaseolus vulgaris [French bean]
ref|XP_010419412.1|  PREDICTED: serine/threonine-protein phosphat...  94.0    2e-18   Camelina sativa [gold-of-pleasure]
emb|CDY06313.1|  BnaA09g48900D                                        93.6    2e-18   
ref|XP_010473113.1|  PREDICTED: serine/threonine-protein phosphat...  93.6    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009118376.1|  PREDICTED: serine/threonine-protein phosphat...  93.6    2e-18   Brassica rapa
ref|XP_004291538.1|  PREDICTED: serine/threonine-protein phosphat...  93.6    2e-18   Fragaria vesca subsp. vesca
gb|KDO46578.1|  hypothetical protein CISIN_1g001895mg                 93.6    2e-18   Citrus sinensis [apfelsine]
ref|XP_006826448.1|  hypothetical protein AMTR_s00004p00175690        94.0    2e-18   
ref|XP_006408677.1|  hypothetical protein EUTSA_v10001894mg           93.6    2e-18   Eutrema salsugineum [saltwater cress]
gb|AFW68154.1|  hypothetical protein ZEAMMB73_166373                  89.0    2e-18   
ref|XP_006424082.1|  hypothetical protein CICLE_v10027742mg           93.6    2e-18   
ref|XP_006424083.1|  hypothetical protein CICLE_v10027742mg           93.6    2e-18   Citrus clementina [clementine]
ref|XP_002879075.1|  kelch repeat-containing serine/threonine pho...  93.2    3e-18   
ref|XP_003596905.1|  Serine/threonine protein phosphatase             93.2    3e-18   Medicago truncatula
ref|XP_006303893.1|  hypothetical protein CARUB_v10008182mg           93.2    3e-18   Capsella rubella
ref|NP_001266022.1|  Hop-interacting protein THI140                   93.2    3e-18   Solanum lycopersicum
gb|KJB35473.1|  hypothetical protein B456_006G116600                  93.2    3e-18   Gossypium raimondii
gb|KJB35474.1|  hypothetical protein B456_006G116600                  93.2    3e-18   Gossypium raimondii
ref|XP_010513312.1|  PREDICTED: serine/threonine-protein phosphat...  93.2    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004487445.1|  PREDICTED: serine/threonine-protein phosphat...  93.2    3e-18   Cicer arietinum [garbanzo]
ref|XP_010474966.1|  PREDICTED: serine/threonine-protein phosphat...  92.8    3e-18   
gb|KJB35470.1|  hypothetical protein B456_006G116600                  92.8    4e-18   Gossypium raimondii
ref|XP_010458078.1|  PREDICTED: serine/threonine-protein phosphat...  92.8    4e-18   
ref|XP_006295510.1|  hypothetical protein CARUB_v10024614mg           92.8    4e-18   
gb|KHG22818.1|  Serine/threonine-protein phosphatase BSL3 -like p...  92.8    4e-18   Gossypium arboreum [tree cotton]
ref|XP_008681503.1|  PREDICTED: uncharacterized protein LOC100192...  92.8    4e-18   Zea mays [maize]
ref|XP_008681453.1|  PREDICTED: uncharacterized protein LOC100192...  92.8    4e-18   
ref|XP_002976889.1|  hypothetical protein SELMODRAFT_175932           92.8    4e-18   
ref|XP_009388972.1|  PREDICTED: serine/threonine-protein phosphat...  92.8    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002980607.1|  hypothetical protein SELMODRAFT_268371           92.8    4e-18   
ref|XP_010557449.1|  PREDICTED: serine/threonine-protein phosphat...  92.8    4e-18   Tarenaya hassleriana [spider flower]
gb|KDP42962.1|  hypothetical protein JCGZ_23904                       92.8    4e-18   Jatropha curcas
ref|XP_010475640.1|  PREDICTED: serine/threonine-protein phosphat...  92.8    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006417691.1|  hypothetical protein EUTSA_v10006669mg           92.8    4e-18   Eutrema salsugineum [saltwater cress]
ref|XP_002264614.1|  PREDICTED: serine/threonine-protein phosphat...  92.8    5e-18   Vitis vinifera
ref|XP_009770254.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    5e-18   Nicotiana sylvestris
emb|CBI24435.3|  unnamed protein product                              92.4    5e-18   Vitis vinifera
ref|XP_009412503.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009770255.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    5e-18   Nicotiana sylvestris
ref|XP_010544321.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_003539489.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    5e-18   Glycine max [soybeans]
ref|XP_009770253.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    5e-18   Nicotiana sylvestris
ref|XP_006592783.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    5e-18   
ref|XP_009788953.1|  PREDICTED: serine/threonine-protein phosphat...  92.0    5e-18   Nicotiana sylvestris
ref|XP_006591057.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    5e-18   Glycine max [soybeans]
ref|XP_004963199.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    5e-18   Setaria italica
ref|XP_003538088.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    6e-18   Glycine max [soybeans]
ref|XP_010544322.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    6e-18   Tarenaya hassleriana [spider flower]
ref|NP_001189614.1|  serine/threonine-protein phosphatase BSL3        92.4    6e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002443577.1|  hypothetical protein SORBIDRAFT_08g021850        92.4    6e-18   Sorghum bicolor [broomcorn]
ref|XP_006592360.1|  PREDICTED: serine/threonine-protein phosphat...  92.0    6e-18   
ref|NP_180289.3|  serine/threonine-protein phosphatase BSL3           92.4    6e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008674098.1|  PREDICTED: serine/threonine-protein phosphat...  92.0    7e-18   Zea mays [maize]
ref|XP_006592359.1|  PREDICTED: serine/threonine-protein phosphat...  92.0    7e-18   
ref|XP_003540821.1|  PREDICTED: serine/threonine-protein phosphat...  92.0    7e-18   Glycine max [soybeans]
ref|XP_011008746.1|  PREDICTED: serine/threonine-protein phosphat...  92.0    7e-18   Populus euphratica
ref|XP_011008648.1|  PREDICTED: serine/threonine-protein phosphat...  92.0    7e-18   Populus euphratica
ref|XP_006361106.1|  PREDICTED: serine/threonine-protein phosphat...  91.7    8e-18   Solanum tuberosum [potatoes]
emb|CDX97481.1|  BnaC08g13460D                                        91.7    9e-18   
ref|XP_009110896.1|  PREDICTED: serine/threonine-protein phosphat...  91.7    9e-18   Brassica rapa
ref|XP_002313501.2|  kelch repeat-containing family protein           91.7    9e-18   
ref|NP_001275238.1|  serine/threonine-protein phosphatase BSL3-like   91.7    9e-18   Solanum tuberosum [potatoes]
ref|XP_009587053.1|  PREDICTED: serine/threonine-protein phosphat...  91.7    9e-18   
ref|XP_011090290.1|  PREDICTED: serine/threonine-protein phosphat...  91.7    9e-18   Sesamum indicum [beniseed]
emb|CDY31148.1|  BnaA08g26980D                                        91.7    9e-18   Brassica napus [oilseed rape]
ref|XP_004241349.1|  PREDICTED: serine/threonine-protein phosphat...  91.7    9e-18   Solanum lycopersicum
ref|XP_010322449.1|  PREDICTED: serine/threonine-protein phosphat...  91.7    1e-17   Solanum lycopersicum
ref|XP_009587040.1|  PREDICTED: serine/threonine-protein phosphat...  91.7    1e-17   Nicotiana tomentosiformis
ref|XP_011090289.1|  PREDICTED: serine/threonine-protein phosphat...  91.7    1e-17   Sesamum indicum [beniseed]
ref|XP_009587046.1|  PREDICTED: serine/threonine-protein phosphat...  91.7    1e-17   Nicotiana tomentosiformis
ref|XP_009587594.1|  PREDICTED: serine/threonine-protein phosphat...  91.7    1e-17   Nicotiana tomentosiformis
ref|XP_011090288.1|  PREDICTED: serine/threonine-protein phosphat...  91.7    1e-17   Sesamum indicum [beniseed]
gb|EYU36016.1|  hypothetical protein MIMGU_mgv1a000720mg              91.7    1e-17   Erythranthe guttata [common monkey flower]
emb|CDP15567.1|  unnamed protein product                              91.7    1e-17   Coffea canephora [robusta coffee]
gb|KJB21740.1|  hypothetical protein B456_004G011600                  91.3    1e-17   Gossypium raimondii
gb|AES88189.2|  serine/threonine-protein phosphatase BSL2-like pr...  91.3    1e-17   Medicago truncatula
ref|XP_006340328.1|  PREDICTED: serine/threonine-protein phosphat...  91.3    1e-17   Solanum tuberosum [potatoes]
ref|XP_006340327.1|  PREDICTED: serine/threonine-protein phosphat...  91.3    1e-17   Solanum tuberosum [potatoes]
ref|XP_009598633.1|  PREDICTED: serine/threonine-protein phosphat...  87.8    2e-17   Nicotiana tomentosiformis
ref|XP_010658896.1|  PREDICTED: serine/threonine-protein phosphat...  90.9    2e-17   
emb|CDY57791.1|  BnaCnng32470D                                        90.9    2e-17   Brassica napus [oilseed rape]
ref|XP_010658894.1|  PREDICTED: serine/threonine-protein phosphat...  90.9    2e-17   
ref|XP_009598634.1|  PREDICTED: serine/threonine-protein phosphat...  87.8    2e-17   Nicotiana tomentosiformis
ref|XP_010658895.1|  PREDICTED: serine/threonine-protein phosphat...  90.5    2e-17   
ref|XP_002262846.2|  PREDICTED: serine/threonine-protein phosphat...  90.5    2e-17   Vitis vinifera
emb|CBI24997.3|  unnamed protein product                              90.5    2e-17   Vitis vinifera
ref|XP_009795596.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...  90.5    2e-17   Nicotiana sylvestris
ref|XP_009140775.1|  PREDICTED: serine/threonine-protein phosphat...  90.5    2e-17   Brassica rapa
emb|CDY57485.1|  BnaAnng14650D                                        90.5    2e-17   Brassica napus [oilseed rape]
gb|ABF97885.1|  kelch repeat-containing serine/threonine phosphoe...  90.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75832.1|  hypothetical protein OsI_12812                        90.5    3e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010457353.1|  PREDICTED: serine/threonine-protein phosphat...  90.1    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_008449600.1|  PREDICTED: serine/threonine-protein phosphat...  90.5    3e-17   Cucumis melo [Oriental melon]
ref|XP_001765008.1|  predicted protein                                90.1    3e-17   
ref|XP_010685448.1|  PREDICTED: serine/threonine-protein phosphat...  90.1    3e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004506226.1|  PREDICTED: serine/threonine-protein phosphat...  90.1    3e-17   Cicer arietinum [garbanzo]
ref|XP_008811284.1|  PREDICTED: serine/threonine-protein phosphat...  90.1    4e-17   Phoenix dactylifera
ref|XP_008811285.1|  PREDICTED: serine/threonine-protein phosphat...  90.1    4e-17   Phoenix dactylifera
ref|XP_008811286.1|  PREDICTED: serine/threonine-protein phosphat...  90.1    4e-17   Phoenix dactylifera
ref|XP_010313488.1|  PREDICTED: serine/threonine-protein phosphat...  89.7    4e-17   Solanum lycopersicum
ref|XP_011088984.1|  PREDICTED: serine/threonine-protein phosphat...  89.7    4e-17   Sesamum indicum [beniseed]
ref|XP_011088983.1|  PREDICTED: serine/threonine-protein phosphat...  89.7    4e-17   Sesamum indicum [beniseed]
gb|AAD26883.1|  putative phosphoprotein phosphatase                   89.4    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941606.1|  PREDICTED: serine/threonine-protein phosphat...  89.7    4e-17   
ref|XP_004251224.1|  PREDICTED: serine/threonine-protein phosphat...  89.7    4e-17   Solanum lycopersicum
gb|EPS70499.1|  hypothetical protein M569_04238                       89.7    5e-17   Genlisea aurea
ref|XP_006651637.1|  PREDICTED: serine/threonine-protein phosphat...  89.4    6e-17   Oryza brachyantha
ref|XP_001769730.1|  predicted protein                                89.0    7e-17   
ref|XP_009418973.1|  PREDICTED: serine/threonine-protein phosphat...  89.4    7e-17   Musa acuminata subsp. malaccensis [pisang utan]
pir||T00913  probable phosphoprotein phosphatase (EC 3.1.3.16) F2...  88.6    9e-17
ref|XP_004140171.1|  PREDICTED: serine/threonine-protein phosphat...  88.6    1e-16   Cucumis sativus [cucumbers]
ref|XP_003561867.1|  PREDICTED: serine/threonine-protein phosphat...  88.6    1e-16   Brachypodium distachyon [annual false brome]
ref|XP_010232097.1|  PREDICTED: serine/threonine-protein phosphat...  88.6    1e-16   Brachypodium distachyon [annual false brome]
ref|XP_010907354.1|  PREDICTED: serine/threonine-protein phosphat...  88.6    1e-16   Elaeis guineensis
gb|EPS67556.1|  serine/threonine-protein phosphatase                  85.1    1e-16   Genlisea aurea
ref|XP_010907353.1|  PREDICTED: serine/threonine-protein phosphat...  88.6    1e-16   Elaeis guineensis
ref|XP_008643918.1|  PREDICTED: uncharacterized protein LOC100381...  87.8    1e-16   
ref|XP_006664752.1|  PREDICTED: serine/threonine-protein phosphat...  87.0    3e-16   
ref|NP_001067290.1|  Os12g0617900                                     87.0    3e-16   
tpg|DAA50299.1|  TPA: putative kelch repeat-containing protein co...  87.0    3e-16   
gb|KHN47652.1|  Serine/threonine-protein phosphatase BSL1             80.5    3e-16   Glycine soja [wild soybean]
ref|XP_004982314.1|  PREDICTED: serine/threonine-protein phosphat...  86.7    4e-16   Setaria italica
ref|XP_002464169.1|  hypothetical protein SORBIDRAFT_01g013460        86.7    4e-16   Sorghum bicolor [broomcorn]
gb|KHN17986.1|  Serine/threonine-protein phosphatase BSL2             85.5    1e-15   Glycine soja [wild soybean]
ref|XP_010031570.1|  PREDICTED: serine/threonine-protein phosphat...  85.1    2e-15   Eucalyptus grandis [rose gum]
ref|XP_006304779.1|  hypothetical protein CARUB_v10012319mg           84.7    2e-15   
gb|AAF22889.1|AC006932_6  T27G7.10                                    84.7    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003577251.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    6e-15   Brachypodium distachyon [annual false brome]
ref|XP_002499734.1|  predicted protein                                75.1    3e-12   Micromonas commoda
gb|KFK42698.1|  hypothetical protein AALP_AA1G028300                  74.7    5e-12   Arabis alpina [alpine rockcress]
ref|XP_006418234.1|  hypothetical protein EUTSA_v10009980mg           74.3    5e-12   
gb|KFK42699.1|  hypothetical protein AALP_AA1G028300                  74.7    5e-12   Arabis alpina [alpine rockcress]
gb|AAF86539.1|AC002560_32  F21B7.7                                    72.4    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KGN47885.1|  hypothetical protein Csa_6G409910                     70.1    6e-11   Cucumis sativus [cucumbers]
ref|XP_003058098.1|  predicted protein                                70.1    1e-10   Micromonas pusilla CCMP1545
emb|CDY29598.1|  BnaA05g15720D                                        69.3    2e-10   Brassica napus [oilseed rape]
ref|XP_009144944.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    2e-10   Brassica rapa
gb|KHN03760.1|  Serine/threonine-protein phosphatase BSL1             63.5    2e-10   Glycine soja [wild soybean]
gb|KDD72504.1|  hypothetical protein H632_c3260p0                     65.1    4e-10   Helicosporidium sp. ATCC 50920
ref|XP_006654987.1|  PREDICTED: serine/threonine-protein phosphat...  67.0    1e-09   
ref|XP_001689767.1|  protein phosphatase 1 beta                       66.2    2e-09   Chlamydomonas reinhardtii
gb|AFW82657.1|  hypothetical protein ZEAMMB73_760112                  63.5    2e-09   
ref|XP_010098907.1|  hypothetical protein L484_006545                 60.8    4e-09   
ref|XP_002958148.1|  hypothetical protein VOLCADRAFT_84366            65.5    5e-09   
ref|XP_002963377.1|  hypothetical protein SELMODRAFT_438528           64.7    6e-09   
ref|XP_002974662.1|  hypothetical protein SELMODRAFT_442608           64.7    7e-09   
ref|XP_007510268.1|  predicted protein                                64.7    8e-09   
gb|EMS55151.1|  Serine/threonine-protein phosphatase BSL1-like pr...  63.9    1e-08   
ref|XP_005846245.1|  hypothetical protein CHLNCDRAFT_135536           63.5    2e-08   
tpg|DAA48783.1|  TPA: hypothetical protein ZEAMMB73_808698            58.9    5e-07   
ref|XP_005645525.1|  protein phosphatase 1 beta                       58.5    7e-07   
ref|XP_001782643.1|  predicted protein                                58.2    7e-07   
gb|EMS59471.1|  Serine/threonine-protein phosphatase BSL2-like pr...  57.8    1e-06   
gb|EEE59591.1|  hypothetical protein OsJ_11899                        57.0    2e-06   
ref|XP_002513729.1|  hypothetical protein RCOM_1754260                53.9    2e-06   
gb|EMT33719.1|  Serine/threonine-phosphatase BSL2-like protein        57.0    2e-06   
ref|XP_004166313.1|  PREDICTED: serine/threonine-protein phosphat...  54.3    3e-06   
ref|XP_004164757.1|  PREDICTED: serine/threonine-protein phosphat...  56.6    3e-06   
gb|KEH38997.1|  serine/threonine-protein phosphatase BSL2-like pr...  56.2    4e-06   
ref|XP_003605992.1|  Serine/threonine protein phosphatase             55.8    6e-06   
gb|KHN36505.1|  Serine/threonine-protein phosphatase BSL2             55.8    6e-06   
ref|XP_002513730.1|  bsu-protein phosphatase, putative                55.5    7e-06   
ref|XP_001785960.1|  predicted protein                                55.1    8e-06   
gb|EEE65895.1|  hypothetical protein OsJ_21718                        54.7    1e-05   
gb|KIY99882.1|  hypothetical protein MNEG_8078                        54.3    1e-05   
ref|XP_004173418.1|  PREDICTED: serine/threonine-protein phosphat...  52.8    4e-05   
ref|XP_010106779.1|  hypothetical protein L484_020801                 49.3    7e-05   
ref|XP_003605990.1|  Serine/threonine protein phosphatase             50.1    3e-04   



>ref|XP_004171648.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like, partial 
[Cucumis sativus]
Length=173

 Score =   157 bits (397),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 104/112 (93%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_010112705.1| Serine/threonine-protein phosphatase BSL1 [Morus notabilis]
 gb|EXC34663.1| Serine/threonine-protein phosphatase BSL1 [Morus notabilis]
Length=883

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR LET+WDTDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAA VGTMV
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAATVGTMV  112



>ref|XP_004290707.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Fragaria 
vesca subsp. vesca]
Length=883

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 105/112 (94%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M++KPWLYPAPTYR+LET+WDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MSSKPWLYPAPTYRTLETYWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>gb|KHG21886.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=854

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>gb|KHG21887.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=827

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_007050742.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
 gb|EOX94899.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
Length=887

 Score =   163 bits (413),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>gb|EYU44112.1| hypothetical protein MIMGU_mgv1a025841mg [Erythranthe guttata]
Length=207

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAP YR+LE+FWDTD+DAPGPRCGHTLTAVAATKT GPRLILFGGATAIE G
Sbjct  1    MGSKPWLYPAPAYRNLESFWDTDDDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIESG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +GG    + LAGVTN IHSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVG+MV
Sbjct  61   SGGLSPFLGLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPRAAHAAAAVGSMV  112



>ref|XP_003591564.1| Serine/threonine protein phosphatase, partial [Medicago truncatula]
Length=203

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTY+ +E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYKPIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN++H+YDV ++KWTR++PAG+PPSPRAAHAAA VGTMV
Sbjct  61   STSAPGIRLAGVTNSVHAYDVDSKKWTRIKPAGDPPSPRAAHAAATVGTMV  111



>ref|NP_001266004.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 ref|XP_010326541.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326542.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69819.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 gb|AFU48608.1| BSL1, partial [Solanum lycopersicum]
Length=878

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 105/111 (95%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRLLETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            NG   GIRLAGVTN IHSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NGAAPGIRLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPRAAHAAAAVGTMV  111



>gb|AFN44700.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=878

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 105/111 (95%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRLLETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            NG   GIRLAGVTN IHSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NGAAPGIRLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPRAAHAAAAVGTMV  111



>emb|CDP03570.1| unnamed protein product [Coffea canephora]
Length=883

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 106/111 (95%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYRSLETFW TD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRSLETFWATDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            NGG  GIRLAGVTN+IHSYDVLTRKW RL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NGGAPGIRLAGVTNSIHSYDVLTRKWIRLRPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_007201214.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
 gb|EMJ02413.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
Length=887

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR+LET+WDTD+D PGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDTDDDGPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_008234964.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 [Prunus mume]
Length=873

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR+LET+WDTD+D PGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDTDDDGPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPRAAHAAAAVGTMV  112



>gb|EYU38113.1| hypothetical protein MIMGU_mgv1a0013161mg, partial [Erythranthe 
guttata]
Length=696

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 104/111 (94%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAP YR+LE+FWDTD+DAPGPRCGHTLTAVAATKT GPRLILFGGATAIE G
Sbjct  1    MGSKPWLYPAPAYRNLESFWDTDDDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIESG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +GG  GIRLAGVTN IHSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVG+MV
Sbjct  61   SGGAPGIRLAGVTNCIHSYDVLTRKWTRLRPAGEPPSPRAAHAAAAVGSMV  111



>ref|XP_009778415.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778416.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778417.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778418.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
Length=879

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 105/111 (95%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRILETFWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +G   GIRLAGVTN +HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SGAAPGIRLAGVTNCVHSYDVLTRKWTRVRPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_010556800.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X3 [Tarenaya hassleriana]
Length=756

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP YR+LETFWDT++DAPGPRCGHTLT VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYRALETFWDTEDDAPGPRCGHTLTVVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            N    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_002520710.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF41672.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=885

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR LET+WDTDEDAPGPRCGHTLTAVAAT THGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATNTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   GSSSAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_008449460.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Cucumis 
melo]
Length=883

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 104/112 (93%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_004140092.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1-like [Cucumis sativus]
Length=905

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 104/112 (93%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            MA+KPWLYPAP+YR+LET+WDTD+DAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MASKPWLYPAPSYRALETYWDTDDDAPGPRCGHTLTAVAATKSFGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_008386603.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
 ref|XP_008350076.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
Length=886

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR+LETFWD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLFPAPTYRTLETFWDCDDDAPGPRCSHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYD+LTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   AASSAPGIRLAGVTNSVHSYDILTRKWTRMRPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_008368903.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
 ref|XP_008363688.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
Length=884

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR+LET+WD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                 GIRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   AASAPGIRLAGVTNSVHSYDVLTRKWTRMRPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_010556798.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010556799.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=887

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP YR+LETFWDT++DAPGPRCGHTLT VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYRALETFWDTEDDAPGPRCGHTLTVVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            N    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_011082512.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Sesamum 
indicum]
Length=882

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 107/111 (96%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL PAPTYR+LE++WDTD+DAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLCPAPTYRTLESYWDTDDDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            NGG  GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NGGAPGIRLAGVTNSVHSYDVLTRKWTRLRPAGEPPSPRAAHAAAAVGTMV  111



>gb|KDP21537.1| hypothetical protein JCGZ_22008 [Jatropha curcas]
Length=886

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR LET+WDTDEDAPGPRCGHTLTAVAAT +HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLETYWDTDEDAPGPRCGHTLTAVAATNSHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   GSSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_009347104.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Pyrus x 
bretschneideri]
Length=885

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 105/112 (94%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR+LETFWD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLFPAPTYRTLETFWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  --nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
              +  PGIRLAGVTN++HSYD+LTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   GPSSAPGIRLAGVTNSVHSYDILTRKWTRMRPAGEPPSPRAAHAAAAVGTMV  112



>gb|EPS69063.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=348

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 105/112 (94%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR LE+FWD ++D+PGPRCGHTLTAV+ATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRPLESFWDAEDDSPGPRCGHTLTAVSATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWT-RLQPAGEPPSPRaahaaaaVGTMV  563
            NG   GIRLAGVTN++HSYDVLTRKWT RLQPAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NGAAPGIRLAGVTNSVHSYDVLTRKWTSRLQPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_009593091.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
tomentosiformis]
Length=879

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR LETFWDTD+DAPGPRCGHTLTAVAATK HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRILETFWDTDDDAPGPRCGHTLTAVAATKIHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +G   GIRLAGVTN +HSYDVLTRKWTR++PAG+PPSPRAAHAAAAVGTMV
Sbjct  61   SGAAPGIRLAGVTNCVHSYDVLTRKWTRVRPAGDPPSPRAAHAAAAVGTMV  111



>gb|KDO87445.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=769

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++H YDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   ATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>emb|CDX90906.1| BnaA03g25860D [Brassica napus]
Length=886

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            N    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>emb|CDY17964.1| BnaC03g30360D [Brassica napus]
Length=886

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            N    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_009134374.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Brassica 
rapa]
Length=878

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            MAAKPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MAAKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            N    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_004496005.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Cicer arietinum]
Length=885

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 104/111 (94%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR++E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRAIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN++HSYD+ T+KWTR++PAG+PPSPRAAHAAA VGTMV
Sbjct  61   SSSAPGIRLAGVTNSVHSYDLQTKKWTRIKPAGDPPSPRAAHAAATVGTMV  111



>ref|XP_004496006.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Cicer arietinum]
Length=876

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 104/111 (94%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR++E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRAIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN++HSYD+ T+KWTR++PAG+PPSPRAAHAAA VGTMV
Sbjct  61   SSSAPGIRLAGVTNSVHSYDLQTKKWTRIKPAGDPPSPRAAHAAATVGTMV  111



>gb|KJB22560.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=887

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +K  LYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKLLLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>gb|KJB42021.1| hypothetical protein B456_007G132700 [Gossypium raimondii]
Length=878

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPW  PAPTYR+LETFWDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWQSPAPTYRTLETFWDTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLT+KWTR++PAG+PPSPRAAHAA  VGTMV
Sbjct  61   ASSSSPGIRLAGVTNSVHSYDVLTKKWTRIRPAGDPPSPRAAHAATVVGTMV  112



>ref|XP_006444191.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479835.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Citrus sinensis]
 gb|ESR57431.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87437.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87438.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=885

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++H YDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   ATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_010279479.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Nelumbo 
nucifera]
Length=885

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYRS+ET W+TDEDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRSVETSWETDEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  n-ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                PGIRLAGVT+++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   GPSAPGIRLAGVTSSVHSYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_006444192.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006444193.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479834.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Citrus sinensis]
 gb|ESR57432.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|ESR57433.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87439.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=889

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M AKPWL+PAP+YR+LET+WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MNAKPWLHPAPSYRTLETYWDTDEDAPGPRCGHTLTAVAATKTTGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++H YDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   ATSSAPGIRLAGVTNSVHLYDVLTRKWTRIRPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_006286760.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
 gb|EOA19658.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
Length=881

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN++HSYDVLTRKWTRL PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SSSVPGIRLAGVTNSVHSYDVLTRKWTRLVPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_010522672.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
Length=887

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP Y++LETFWDT+EDAPGPRC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPMYQALETFWDTEEDAPGPRCAHTLTAVAATKTRGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            N    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NSSTPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_002872798.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49057.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=881

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_002270638.2| PREDICTED: serine/threonine-protein phosphatase BSL1 [Vitis vinifera]
 emb|CBI32287.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 2/110 (2%)
 Frame = +3

Query  240  AKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggng  419
            +KPWLYPAPTYR+LE++WDTD+DAPGPRCGHTLTA+A TKTHGPRLILFGGATAIEGG  
Sbjct  4    SKPWLYPAPTYRTLESYWDTDDDAPGPRCGHTLTAIAPTKTHGPRLILFGGATAIEGGAS  63

Query  420  gpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                 IRLAGVTN++HSYDVLTRKWTRL+PAGEPPS RAAHAAAAVGTMV
Sbjct  64   SSAPGIRLAGVTNSVHSYDVLTRKWTRLRPAGEPPSVRAAHAAAAVGTMV  113



>ref|XP_010455968.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Camelina sativa]
 ref|XP_010455970.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Camelina sativa]
Length=882

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKALETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   GSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_010422504.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=881

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKALETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   GSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_006575099.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Glycine max]
Length=753

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR++ETFW TDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETFWVTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN +HSYDV +RKWT ++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SSSAPGIRLAGVTNTVHSYDVQSRKWTSIKPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_010430668.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=882

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP Y++LETFWD +EDAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEEDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      IRLAGVTN++HSYDVLTR+WTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   STSSVPGIRLAGVTNSVHSYDVLTRRWTRLKPAGEPPSPRAAHAAAAVGTMV  112



>gb|KHG15629.1| Serine/threonine-protein phosphatase BSL1 -like protein [Gossypium 
arboreum]
Length=838

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPW  PAPTYR+LETFWDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWQPPAPTYRTLETFWDTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      IRLAGVTN++HSYDVLT+KWTR++PAG+PPSPRAAHAA  VGTMV
Sbjct  61   SSSSSPGIRLAGVTNSVHSYDVLTKKWTRIRPAGDPPSPRAAHAATVVGTMV  112



>ref|NP_192217.2| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
 sp|Q8L7U5.2|BSL1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL1; AltName: 
Full=BSU1-like protein 1 [Arabidopsis thaliana]
 gb|AEE82268.1| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
Length=881

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN +HSYD+LTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_008368904.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
 ref|XP_008363689.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
Length=882

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 99/110 (90%), Gaps = 1/110 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR+LET+WD D+DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTLETYWDCDDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   + GVTN++HSYDVLTRKWTR++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   AASAPG-ITGVTNSVHSYDVLTRKWTRMRPAGEPPSPRAAHAAAAVGTMV  109



>gb|AAC79097.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
 emb|CAB77793.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
Length=894

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN +HSYD+LTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>gb|AES61845.2| serine/threonine-protein phosphatase [Medicago truncatula]
Length=879

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTY+ +E+FWDTDEDAPGPRCGHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYKPIESFWDTDEDAPGPRCGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN++H+YDV ++KWTR++PAG+PPSPRAAHAAA VGTMV
Sbjct  61   STSAPGIRLAGVTNSVHAYDVDSKKWTRIKPAGDPPSPRAAHAAATVGTMV  111



>gb|AAM83219.1| AT4g03080/T4I9_4 [Arabidopsis thaliana]
Length=881

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN +HSYD+LTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SSSVPGIRLAGVTNTVHSYDILTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_002321044.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE99359.2| phosphatase family protein [Populus trichocarpa]
Length=892

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAPTYR+LET+WD+D+DAPG RC HTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLHPAPTYRTLETYWDSDDDAPGSRCAHTLTAVAATKSQGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                 GIRLAGVTN++HSYDVLTRKWTR+QPAGEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAGEPPSPRAAHAAAAVGTMV  111



>gb|AFY26889.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Morella rubra]
Length=887

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL PAPTYR+LET+WDTDEDAPGPRCGHTLTAVAATK+HG RLILFGGATAIEGG
Sbjct  1    MGSKPWLSPAPTYRTLETYWDTDEDAPGPRCGHTLTAVAATKSHGARLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR++PAG+PPS RAAHAAAAVGTMV
Sbjct  61   ASSSAPGIRLAGVTNSVHSYDVLTRKWTRIRPAGDPPSLRAAHAAAAVGTMV  112



>ref|XP_003518942.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Glycine max]
Length=881

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR++ETFW TDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETFWVTDEDAPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN +HSYDV +RKWT ++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SSSAPGIRLAGVTNTVHSYDVQSRKWTSIKPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_007144577.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
 gb|ESW16571.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
Length=878

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 99/111 (89%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPA TYR+LETFWDTDED PGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPASTYRNLETFWDTDEDGPGPRCGHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN +HSYDV TRKW  ++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SSSAPGIRLAGVTNTVHSYDVQTRKWISIKPAGEPPSPRAAHAAAAVGTMV  111



>gb|KFK30905.1| hypothetical protein AALP_AA6G041300 [Arabis alpina]
Length=878

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            MA KP+L+PAP Y+SLETFWD ++DAPGPRC HTLT+VAATKTHGPRLILFGGATAIEGG
Sbjct  1    MATKPFLHPAPQYKSLETFWDEEDDAPGPRCAHTLTSVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SSSVPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_010070326.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Eucalyptus 
grandis]
 gb|KCW58989.1| hypothetical protein EUGRSUZ_H01613 [Eucalyptus grandis]
Length=887

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR+LET+WD DEDAP PR GHTLTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRNLETYWDADEDAPLPRVGHTLTAVAATKSHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYD+LT+KWTR++PAG+PPSPRAAHAAAAVGTMV
Sbjct  61   AASSAPGIRLAGVTNSVHSYDILTKKWTRMKPAGDPPSPRAAHAAAAVGTMV  112



>ref|XP_011033645.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Populus euphratica]
Length=886

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL PAPTYR+L T+WD+D+DAPG RC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLQPAPTYRTLATYWDSDDDAPGSRCAHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                 GIRLAGVTN++HSYDVLTRKWTR+QPAGEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_011033646.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Populus euphratica]
Length=885

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL PAPTYR+L T+WD+D+DAPG RC HTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLQPAPTYRTLATYWDSDDDAPGSRCAHTLTAVAATKTQGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                 GIRLAGVTN++HSYDVLTRKWTR+QPAGEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAPGIRLAGVTNSVHSYDVLTRKWTRVQPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_006396534.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
 gb|ESQ37987.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
Length=881

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M  K WL+PAP Y++LETFWD ++DAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKQWLHPAPQYKTLETFWDDEDDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN +HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SSSLPGIRLAGVTNTVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  111



>emb|CDY62088.1| BnaC02g46770D [Brassica napus]
Length=877

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            N      IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NSSSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_003536338.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Glycine 
max]
Length=881

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWLYPAPTYR++ET WDTDEDAPGPRCGHTLTAVAATKT GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLYPAPTYRTIETVWDTDEDAPGPRCGHTLTAVAATKTLGPRLILFGGATAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +    GIRLAGVTN +H+YDV +RKWT ++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   SSSAPGIRLAGVTNTVHAYDVQSRKWTSVKPAGEPPSPRAAHAAAAVGTMV  111



>gb|KJB22562.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=891

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 6/116 (5%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +K  LYPAPTYR+LET+WD+DEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGSKLLLYPAPTYRTLETYWDSDEDAPGPRCGHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTR----LQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLTRKWTR    ++PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   AASSAPGIRLAGVTNSVHSYDVLTRKWTRFLLIIRPAGEPPSPRAAHAAAAVGTMV  116



>emb|CDX97296.1| BnaA02g20870D [Brassica napus]
Length=874

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            N      IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NSPSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_009144526.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Brassica 
rapa]
Length=880

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M  KP+++PAP Y+++ETFWD +EDAPGPRC HTLTAVAATKTHGPRLILFGGATAIEGG
Sbjct  1    MGTKPFVHPAPQYKTIETFWDEEEDAPGPRCAHTLTAVAATKTHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            N      IRLAGVTN++HSYDVLTRKWTRL+PAGEPPSPRAAHAAAAVGTMV
Sbjct  61   NSPSVPGIRLAGVTNSVHSYDVLTRKWTRLKPAGEPPSPRAAHAAAAVGTMV  112



>ref|XP_010244624.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Nelumbo nucifera]
Length=897

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +3

Query  231  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieg  410
            G  +KPWLYPAPTYRS+ET W+TD DAPGPRC HTLTAVAATK+HG RLILFGG TAIEG
Sbjct  2    GSNSKPWLYPAPTYRSVETSWETDRDAPGPRCAHTLTAVAATKSHGHRLILFGGTTAIEG  61

Query  411  g--nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            G  +  PGIRLAGVTN++HSYDVLTRKWTR+QP GEPPSPRAAHAAAAVG+MV
Sbjct  62   GGPSSVPGIRLAGVTNSVHSYDVLTRKWTRIQPVGEPPSPRAAHAAAAVGSMV  114



>ref|XP_010244625.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Nelumbo nucifera]
Length=888

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +3

Query  231  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieg  410
            G  +KPWLYPAPTYRS+ET W+TD DAPGPRC HTLTAVAATK+HG RLILFGG TAIEG
Sbjct  2    GSNSKPWLYPAPTYRSVETSWETDRDAPGPRCAHTLTAVAATKSHGHRLILFGGTTAIEG  61

Query  411  g--nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            G  +  PGIRLAGVTN++HSYDVLTRKWTR+QP GEPPSPRAAHAAAAVG+MV
Sbjct  62   GGPSSVPGIRLAGVTNSVHSYDVLTRKWTRIQPVGEPPSPRAAHAAAAVGSMV  114



>ref|XP_002301559.1| phosphatase family protein [Populus trichocarpa]
 gb|EEE80832.1| phosphatase family protein [Populus trichocarpa]
Length=890

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 96/113 (85%), Gaps = 3/113 (3%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRALETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  414  nggp---giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                     RL G TN++HSYDVLTRKWTR+Q AGEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAPGISYRLDGATNSVHSYDVLTRKWTRIQAAGEPPSPRAAHAAAAVGTMV  113



>ref|XP_008813651.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Phoenix dactylifera]
Length=351

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN+IHSYDV TRKWTRL P GEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPVGEPPSPRAAHAAAAVGTMV  112



>ref|XP_008813652.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Phoenix dactylifera]
Length=350

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN+IHSYDV TRKWTRL P GEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPVGEPPSPRAAHAAAAVGTMV  112



>ref|XP_008813653.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Phoenix dactylifera]
Length=349

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M  KPW  PAPTYR L+  WDTD+DAPGPRCGH+LTAVAATK+HGPRLILFGGATAIEGG
Sbjct  1    MDTKPWPIPAPTYRPLDASWDTDDDAPGPRCGHSLTAVAATKSHGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN+IHSYDV TRKWTRL P GEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAVPGIRLAGVTNSIHSYDVETRKWTRLHPVGEPPSPRAAHAAAAVGTMV  112



>ref|XP_011011094.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X3 [Populus euphratica]
Length=781

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                 GIRL G TN++HSYDVLTRKW R+Q AGEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAGEPPSPRAAHAAAAVGTMV  111



>gb|AEK86563.1| serine/threonine-protein phosphatase [Camellia sinensis]
Length=888

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 95/113 (84%), Gaps = 3/113 (3%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +    YPAPTYR+LET+WD+D+D+PGPRC HTLTAV+ATK+ GPRLILFGGATAIEGG
Sbjct  1    MGSNRQFYPAPTYRTLETYWDSDDDSPGPRCSHTLTAVSATKSQGPRLILFGGATAIEGG  60

Query  414  nggpgi---RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                     RLAGVTNAIHSYDVLTRKWTRL+PAGEPPSPRAAH A AVGTMV
Sbjct  61   ASSSSAPGIRLAGVTNAIHSYDVLTRKWTRLRPAGEPPSPRAAHTAVAVGTMV  113



>ref|XP_011011092.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011012419.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
Length=886

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                 GIRL G TN++HSYDVLTRKW R+Q AGEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_011011093.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
 ref|XP_011012420.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
Length=885

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL+PAP YR+LET+W +D+DAPGPRC HTLTAVAATK+HGPRLILFGG TAIEGG
Sbjct  1    MGSKPWLHPAPAYRTLETYWSSDDDAPGPRCSHTLTAVAATKSHGPRLILFGGVTAIEGG  60

Query  414  nggp-giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                 GIRL G TN++HSYDVLTRKW R+Q AGEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAPGIRLDGATNSVHSYDVLTRKWIRIQAAGEPPSPRAAHAAAAVGTMV  111



>emb|CAN67846.1| hypothetical protein VITISV_016669 [Vitis vinifera]
Length=208

 Score =   135 bits (340),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 91/139 (65%), Gaps = 30/139 (22%)
 Frame = +3

Query  237  AAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILF----------  386
             +KPWLYPAPTYR+LE++WDTD+DAPGPRCGHTLTA+A TKTHGPRLILF          
Sbjct  3    GSKPWLYPAPTYRTLESYWDTDDDAPGPRCGHTLTAIAPTKTHGPRLILFGGATAIEGGA  62

Query  387  --------------------ggataieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPA  506
                                     +        + LAGVTN++HSYDVLTRKWTRL+PA
Sbjct  63   SSSAPGIRTPHPIRFFFFVWIRVCVVASLCVVCFLGLAGVTNSVHSYDVLTRKWTRLRPA  122

Query  507  GEPPSPRaahaaaaVGTMV  563
            GEPPS RAAHAAAAV TMV
Sbjct  123  GEPPSVRAAHAAAAVXTMV  141



>ref|XP_010910522.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Elaeis guineensis]
Length=278

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M  K W  PAPTYR L+  WD D+DAPGPRCGH+LT VAATK+HGPRL+LFGGATAIEGG
Sbjct  1    MGTKSWTIPAPTYRPLDASWDNDDDAPGPRCGHSLTTVAATKSHGPRLVLFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDV TRKWTRL P GEPPSPRAAHAAAAVGTMV
Sbjct  61   ASSAVPGIRLAGVTNSVHSYDVETRKWTRLHPVGEPPSPRAAHAAAAVGTMV  112



>ref|XP_010684726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Beta vulgaris 
subsp. vulgaris]
Length=877

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 100/112 (89%), Gaps = 3/112 (3%)
 Frame = +3

Query  237  AAKPWLYPAPTYRSL-ETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            ++KPWL PAP+Y  L ++FWD+DEDAPGPRCGHTLTAVAATK+ GPRLILFGGATAIEGG
Sbjct  3    SSKPWLQPAPSYTPLLDSFWDSDEDAPGPRCGHTLTAVAATKSQGPRLILFGGATAIEGG  62

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDVLT+KWTR++PAG+PPSPRAAHAAAAVGTMV
Sbjct  63   ASSSAPGIRLAGVTNSVHSYDVLTKKWTRIRPAGDPPSPRAAHAAAAVGTMV  114



>ref|XP_009385028.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Musa acuminata subsp. malaccensis]
Length=893

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 94/112 (84%), Gaps = 2/112 (2%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +KPWL PAP YR L++ W+TD+DAPGPRCGH+LTAV A+K+ GPRLILFGGATAIEGG
Sbjct  1    MGSKPWLIPAPNYRRLDSSWETDDDAPGPRCGHSLTAVDASKSRGPRLILFGGATAIEGG  60

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   IRLAGVTN++HSYDV TRKWTR+ P GEPPSPRAAHAAA VGTMV
Sbjct  61   ASSAVPGIRLAGVTNSVHSYDVNTRKWTRIHPVGEPPSPRAAHAAAVVGTMV  112



>ref|XP_006846753.1| hypothetical protein AMTR_s00276p00018700, partial [Amborella 
trichopoda]
 gb|ERN08334.1| hypothetical protein AMTR_s00276p00018700, partial [Amborella 
trichopoda]
Length=218

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 93/124 (75%), Gaps = 14/124 (11%)
 Frame = +3

Query  234  MAAKPWLYPAP----TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH----------GP  371
            M +K  L PAP     YR ++T W+TDED+PGPRCGHTLT V+               GP
Sbjct  1    MGSKLRLCPAPLPASAYRVVDTSWETDEDSPGPRCGHTLTPVSTPSNSSSSSGSHHYVGP  60

Query  372  RLILFggataieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaV  551
            RLILFGGATAIE  + G GIRLAGVTN++HSYDVLTRKWTRLQP+GEPPSPRAAHAAAAV
Sbjct  61   RLILFGGATAIEMSSTGAGIRLAGVTNSVHSYDVLTRKWTRLQPSGEPPSPRAAHAAAAV  120

Query  552  GTMV  563
            GTMV
Sbjct  121  GTMV  124



>ref|XP_010904839.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 homolog [Elaeis guineensis]
Length=888

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M +K  L PAP+YR +E  W+   D+PGPRC HTLTAV AT +HGPRLILFGG TAIEG 
Sbjct  1    MGSKTRLVPAPSYRPVEASWEAAGDSPGPRCSHTLTAVPATGSHGPRLILFGGTTAIEGS  60

Query  414  n-ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                PGIRLAGVTN++HS+DV TRKWTR+QPAGEPPSPRAAHAAAAVGTMV
Sbjct  61   XPPAPGIRLAGVTNSVHSFDVQTRKWTRIQPAGEPPSPRAAHAAAAVGTMV  111



>ref|XP_004960470.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Setaria italica]
Length=887

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  231  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  407
            G A K  W+ PAP YR +E +    EDAPG RCGH+LTAVA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKNAWVVPAPAYREVEGWEGVGEDAPGFRCGHSLTAVAPTKGHGPRLILFGGATAIE  61

Query  408  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G       IRLAGVTN++HSYDV  R+WTRL PAGEPPSPRAAH+AAAVGTMV
Sbjct  62   AGASSGLPGIRLAGVTNSVHSYDVEKRRWTRLHPAGEPPSPRAAHSAAAVGTMV  115



>gb|AFW82656.1| hypothetical protein ZEAMMB73_760112 [Zea mays]
Length=491

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  231  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  407
            G A K  W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIE  61

Query  408  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMV
Sbjct  62   TGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPAGEPPSPRAAHAAAAVGTMV  115



>ref|XP_002439264.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
 gb|EES17694.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
Length=895

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  231  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  407
            G A K  W+ PAP YR +E +    +DAPG RCGH+LTAVA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGVGDDAPGFRCGHSLTAVAPTKGHGPRLILFGGATAIE  61

Query  408  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G       IRLAGVTN++HSYDV  RKWTRL PAGEPPSPRAAHAAAAVGTMV
Sbjct  62   AGASSGLPGIRLAGVTNSVHSYDVEKRKWTRLHPAGEPPSPRAAHAAAAVGTMV  115



>ref|XP_008795124.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Phoenix dactylifera]
Length=867

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            M ++  L PAP+YR +E  W+   DAPGPR  HTLTAV AT +HGPRLILFGG TAIEG 
Sbjct  1    MGSRTRLVPAPSYRPVEASWEAAGDAPGPRYAHTLTAVPATGSHGPRLILFGGGTAIEGS  60

Query  414  nggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
              GPGIRLAGVTN +HS+DV TRKWTR QPAG+PPSPRAAHAAAAVGTMV
Sbjct  61   PCGPGIRLAGVTNWVHSFDVRTRKWTRAQPAGQPPSPRAAHAAAAVGTMV  110



>ref|XP_008655295.1| PREDICTED: uncharacterized protein LOC100383776 isoform X2 [Zea 
mays]
Length=979

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  231  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  407
            G A K  W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE
Sbjct  94   GTAGKGAWVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIE  153

Query  408  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMV
Sbjct  154  TGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPAGEPPSPRAAHAAAAVGTMV  207



>ref|XP_008655294.1| PREDICTED: uncharacterized protein LOC100383776 isoform X1 [Zea 
mays]
Length=987

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  231  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  407
            G A K  W+ PAP YR +E +    +DAPG RC H+LTAVA TK HGPRLILFGGATAIE
Sbjct  94   GTAGKGAWVVPAPAYREVEGWEGAGDDAPGFRCAHSLTAVAPTKGHGPRLILFGGATAIE  153

Query  408  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMV
Sbjct  154  TGASSGLPGIRLAGVTNSVHSYDVETRRWTRLHPAGEPPSPRAAHAAAAVGTMV  207



>gb|EEE62303.1| hypothetical protein OsJ_17091 [Oryza sativa Japonica Group]
Length=877

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  231  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  407
            G A K  W+ PAP YR +E +    +D+PG RCGH+LT VA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDSPGFRCGHSLTVVAPTKGHGPRLILFGGATAIE  61

Query  408  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMV
Sbjct  62   AGASSGMPGIRLAGVTNSVHSYDVDTRRWTRLHPAGEPPSPRAAHAAAAVGTMV  115



>ref|NP_001054625.1| Os05g0144400 [Oryza sativa Japonica Group]
 sp|Q60EX6.1|BSL1_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL1 homolog; 
AltName: Full=BSU1-like protein 1 homolog [Oryza sativa 
Japonica Group]
 gb|AAU90203.1| putative Serine/threonine protein phosphatase BSL1 [Oryza sativa 
Japonica Group]
 dbj|BAF16539.1| Os05g0144400 [Oryza sativa Japonica Group]
 dbj|BAG99920.1| unnamed protein product [Oryza sativa Japonica Group]
Length=883

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +3

Query  231  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  407
            G A K  W+ PAP YR +E +    +D+PG RCGH+LT VA TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDSPGFRCGHSLTVVAPTKGHGPRLILFGGATAIE  61

Query  408  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G       IRLAGVTN++HSYDV TR+WTRL PAGEPPSPRAAHAAAAVGTMV
Sbjct  62   AGASSGMPGIRLAGVTNSVHSYDVDTRRWTRLHPAGEPPSPRAAHAAAAVGTMV  115



>ref|XP_003568959.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Brachypodium distachyon]
Length=889

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +3

Query  231  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  407
            G A K  W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIE  61

Query  408  ggnggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G       IRLAGVTN++HSYDV  R+WTR+ PAG+PPSPRAAH+AAAVGTMV
Sbjct  62   AGASSGLPGIRLAGVTNSVHSYDVEKRRWTRMHPAGDPPSPRAAHSAAAVGTMV  115



>ref|NP_171844.6| serine/threonine-protein phosphatase BSU1 [Arabidopsis thaliana]
 sp|Q9LR78.2|BSU1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSU1; AltName: 
Full=Bri1 suppressor protein 1 [Arabidopsis thaliana]
 gb|AAR19789.1| BSU1 Ser/Thr phosphatase [Arabidopsis thaliana]
 gb|AEE27572.1| serine/threonine-protein phosphatase BSU1 [Arabidopsis thaliana]
Length=793

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 4/109 (4%)
 Frame = +3

Query  243  KPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggngg  422
            + + YP+P+Y S++TF+DTDED PGPRCGHTLTAV    +H  +LILFGG+T     +  
Sbjct  5    QSYQYPSPSYESIQTFYDTDEDWPGPRCGHTLTAVFVNNSH--QLILFGGSTTAVANHNS  62

Query  423  p--giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                I L GVTN++HS+DVLTRKWTRL P G+ PSPRA HAAA  GT++
Sbjct  63   SLPEISLDGVTNSVHSFDVLTRKWTRLNPIGDVPSPRACHAAALYGTLI  111



>ref|XP_010231726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Brachypodium distachyon]
Length=900

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 86/125 (69%), Gaps = 14/125 (11%)
 Frame = +3

Query  231  GMAAK-PWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataie  407
            G A K  W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE
Sbjct  2    GTAGKGAWVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIE  61

Query  408  ggnggpg-------------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaa  548
             G                   RLAGVTN++HSYDV  R+WTR+ PAG+PPSPRAAH+AAA
Sbjct  62   AGASSGLPGISSVPPPSLAPPRLAGVTNSVHSYDVEKRRWTRMHPAGDPPSPRAAHSAAA  121

Query  549  VGTMV  563
            VGTMV
Sbjct  122  VGTMV  126



>ref|XP_010231727.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Brachypodium distachyon]
Length=868

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 83/118 (70%), Gaps = 13/118 (11%)
 Frame = +3

Query  249  WLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpg  428
            W+ PAP YR +E +    +DAPG RCGH+LT +A TK HGPRLILFGGATAIE G     
Sbjct  9    WVVPAPAYREVEGWEGAGDDAPGYRCGHSLTFIAPTKGHGPRLILFGGATAIEAGASSGL  68

Query  429  -------------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                          RLAGVTN++HSYDV  R+WTR+ PAG+PPSPRAAH+AAAVGTMV
Sbjct  69   PGISSVPPPSLAPPRLAGVTNSVHSYDVEKRRWTRMHPAGDPPSPRAAHSAAAVGTMV  126



>ref|XP_002892160.1| Serine/threonine-protein phosphatase BSU1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68419.1| Serine/threonine-protein phosphatase BSU1 [Arabidopsis lyrata 
subsp. lyrata]
Length=795

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 76/105 (72%), Gaps = 4/105 (4%)
 Frame = +3

Query  255  YPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggp--g  428
            YP+P+Y S++TF+DTDE  PGPRCGHTLT V    +H  +LILFGG++     +      
Sbjct  11   YPSPSYESIQTFYDTDEGWPGPRCGHTLTGVFVNNSH--QLILFGGSSTAVTTHDSSLPE  68

Query  429  iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            I L GVTN++HS+DVLTRKWTRL P G+ PSPRA HAAA  GT++
Sbjct  69   ISLEGVTNSVHSFDVLTRKWTRLNPDGDVPSPRACHAAALYGTLL  113



>gb|KGN66599.1| hypothetical protein Csa_1G638460 [Cucumis sativus]
Length=736

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    D  ED PGPRCGHTLTAV+A    G      PRLILFGGATA+EG +  
Sbjct  72   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  131

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KWTR+ P GEPP+PRAAH A AVGTMV
Sbjct  132  AGTPTSAGNAGIRLAGATADVHCYDVLTNKWTRVTPLGEPPTPRAAHVATAVGTMV  187



>ref|XP_006367867.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Solanum 
tuberosum]
Length=367

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 77/116 (66%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY ++++  +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  51   APTYTAVQSVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  110

Query  423  pg---------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                       IRLAG T  +HSYDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  111  AAAPSSPGGAGIRLAGATADVHSYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMV  166



>gb|KHG00523.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=315

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            AP Y  ++   +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  78   APPYSVVDAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  137

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  138  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  193



>ref|XP_010045170.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Eucalyptus 
grandis]
 gb|KCW87326.1| hypothetical protein EUGRSUZ_B03812 [Eucalyptus grandis]
Length=999

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 76/117 (65%), Gaps = 15/117 (13%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  419
            PAPTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG + 
Sbjct  64   PAPTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSA  123

Query  420  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                       GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  124  ASGAPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVACAVGTMV  180



>dbj|BAH19666.1| AT1G08420 [Arabidopsis thaliana]
Length=1018

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 83/141 (59%), Gaps = 17/141 (12%)
 Frame = +3

Query  186  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  365
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  366  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  500
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLT  179

Query  501  PAGEPPSPRaahaaaaVGTMV  563
            P GEPP+PRAAH A AVGTMV
Sbjct  180  PFGEPPTPRAAHVATAVGTMV  200



>ref|NP_172318.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 sp|Q9SJF0.2|BSL2_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL2; AltName: 
Full=BSU1-like protein 2 [Arabidopsis thaliana]
 gb|AEE28287.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1018

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 83/141 (59%), Gaps = 17/141 (12%)
 Frame = +3

Query  186  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  365
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  366  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  500
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLT  179

Query  501  PAGEPPSPRaahaaaaVGTMV  563
            P GEPP+PRAAH A AVGTMV
Sbjct  180  PFGEPPTPRAAHVATAVGTMV  200



>ref|XP_008450272.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450273.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450274.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
Length=1008

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    D  ED PGPRCGHTLTAV+A    G      PRLILFGGATA+EG +  
Sbjct  72   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  131

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KWTR+ P GEPP+PRAAH A AVGTMV
Sbjct  132  AGTPTSAGNAGIRLAGATADVHCYDVLTNKWTRVTPLGEPPTPRAAHVATAVGTMV  187



>ref|XP_004139147.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=981

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    D  ED PGPRCGHTLTAV+A    G      PRLILFGGATA+EG +  
Sbjct  45   APTYSVVNALMDKKEDGPGPRCGHTLTAVSAVGEDGTPGYSGPRLILFGGATALEGNSAA  104

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KWTR+ P GEPP+PRAAH A AVGTMV
Sbjct  105  AGTPTSAGNAGIRLAGATADVHCYDVLTNKWTRVTPLGEPPTPRAAHVATAVGTMV  160



>ref|NP_001184935.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 gb|AEE28288.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1013

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 83/141 (59%), Gaps = 17/141 (12%)
 Frame = +3

Query  186  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  365
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  366  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  500
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLT  179

Query  501  PAGEPPSPRaahaaaaVGTMV  563
            P GEPP+PRAAH A AVGTMV
Sbjct  180  PFGEPPTPRAAHVATAVGTMV  200



>ref|XP_010263036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Nelumbo 
nucifera]
Length=1015

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 75/117 (64%), Gaps = 15/117 (13%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAPTY  +E   +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E    
Sbjct  81   PAPTYSVVEANIEKKEDGPGPRCGHTLTAVAAVGEEGTAGYIGPRLILFGGATALEGNSA  140

Query  408  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                    G  GIRLAG T  +H YDV + KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  141  ASGPPSSAGSAGIRLAGATADVHCYDVNSNKWSRLTPLGEPPSPRAAHVATAVGTMV  197



>gb|EYU25964.1| hypothetical protein MIMGU_mgv1a0006242mg, partial [Erythranthe 
guttata]
Length=340

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 72/116 (62%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            AP+Y  +    D  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  69   APSYSVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGNPGYIGPRLILFGGATALEGNSAA  128

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YD LT KWTR+ P GEPP+PRAAH A AVGTMV
Sbjct  129  SGTPTSAGSAGIRLAGATADVHCYDALTNKWTRVTPIGEPPTPRAAHVATAVGTMV  184



>ref|XP_010247574.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nelumbo 
nucifera]
Length=1021

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 75/117 (64%), Gaps = 15/117 (13%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAPTY  +E   +  ED PG RCGHTLTA+AA    G      PRLILFGGATA+E    
Sbjct  84   PAPTYSVVEAIIEKKEDGPGSRCGHTLTAIAAVGEEGTPGYIGPRLILFGGATALEGNAA  143

Query  408  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                    G  GIRLAG T  +H YDV++ KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  144  ASGPPSSAGSAGIRLAGATADVHCYDVISNKWSRLTPLGEPPSPRAAHVATAVGTMV  200



>gb|EYU41291.1| hypothetical protein MIMGU_mgv1a0202661mg, partial [Erythranthe 
guttata]
Length=340

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 67/116 (58%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            AP+Y  +    D  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  69   APSYSVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGNPGYIGPRLILFGGATALEGNSAA  128

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YD LT KWTR+ P GEPP+PRAAH A AVGTMV
Sbjct  129  SGTPTSAGSAGIRLAGATADVHCYDALTNKWTRVTPIGEPPTPRAAHVATAVGTMV  184



>gb|ABV91338.1| kelch repeat-containing protein /serine/threonine phosphoesterase 
family protein [Arabidopsis thaliana]
Length=1018

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 83/141 (59%), Gaps = 17/141 (12%)
 Frame = +3

Query  186  ANQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH  365
            + Q +  ++G  +   +   P    APTY  ++   D  ED PGPRCGHTLTAV A    
Sbjct  62   SQQQAAAVVGQEQQPALVVGPRC--APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDE  119

Query  366  G------PRLILFggataie---------ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQ  500
            G      PRL+LFGGATA+E            G  GIRLAG T  +H YDVL+ KWTRL 
Sbjct  120  GTPGYIGPRLVLFGGATALEGNSGGTGTPTSAGSAGIRLAGATPDVHCYDVLSNKWTRLT  179

Query  501  PAGEPPSPRaahaaaaVGTMV  563
            P GEPP+PRAAH A AVGTMV
Sbjct  180  PFGEPPTPRAAHVATAVGTMV  200



>ref|XP_001760494.1| predicted protein [Physcomitrella patens]
 gb|EDQ74569.1| predicted protein [Physcomitrella patens]
Length=954

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 77/118 (65%), Gaps = 16/118 (14%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  419
            PAP +R +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG + 
Sbjct  7    PAPAFRMVSAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYVGPRLILFGGATALEGNSS  66

Query  420  gpg----------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
              G          IRLAG T  +H YDV +RKW+RL P G+PPSPRAAHAA AVGTMV
Sbjct  67   AAGGPQTAAAGAGIRLAGATADVHCYDVTSRKWSRLIPVGDPPSPRAAHAATAVGTMV  124



>dbj|BAK03675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 73/115 (63%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAP Y ++    D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  61   PAPGYTAVNAVIDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  408  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPLGEPPSPRAAHVATAVGTMV  175



>ref|XP_007150014.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
 gb|ESW22008.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
Length=996

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  62   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAA  121

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+RL P GEPP+PRAAH A AVGTMV
Sbjct  122  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRLTPFGEPPTPRAAHVATAVGTMV  177



>ref|XP_001781021.1| predicted protein [Physcomitrella patens]
 gb|EDQ54130.1| predicted protein [Physcomitrella patens]
Length=1047

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 73/116 (63%), Gaps = 14/116 (12%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF--------gga  395
            PAPTYR + +  +  +D PGPRCGHTLTAVA+    G      PRLILF          A
Sbjct  106  PAPTYRVVNSVIEKRDDGPGPRCGHTLTAVASVNEEGSPGYIGPRLILFGGATALEGSSA  165

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
               +  + G GIRLAG T  +H YDV + +WTR+ P G+PPSPRAAHAA AVGTMV
Sbjct  166  AGPQAASSGAGIRLAGATADVHCYDVQSNQWTRITPVGDPPSPRAAHAATAVGTMV  221



>ref|XP_002889692.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65951.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1017

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  84   APTYSVVDAMMDKKEDGPGPRCGHTLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGG  143

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMV
Sbjct  144  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMV  199



>ref|XP_007015657.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015658.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015659.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33276.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33277.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33278.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
Length=1019

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  143

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  144  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRISPFGEPPTPRAAHVATAVGTMV  199



>ref|XP_010488844.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Camelina 
sativa]
Length=1022

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 84/142 (59%), Gaps = 19/142 (13%)
 Frame = +3

Query  189  NQSSGCLIGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG  368
            +  S  ++G  +L      P    APTY  ++   D  ED PGPRCGHTLTAV A    G
Sbjct  65   SSQSAPVVGQEQLQAQVVGPRC--APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEG  122

Query  369  ------PRLILFggataieggng-----------gpgiRLAGVTNAIHSYDVLTRKWTRL  497
                  PRL+LFGGATA+EG +G             GIRLAG T  +H YDVL+ KWTRL
Sbjct  123  TPGYIGPRLVLFGGATALEGNSGGGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRL  182

Query  498  QPAGEPPSPRaahaaaaVGTMV  563
             P GEPP+PRAAH A AVGTMV
Sbjct  183  TPFGEPPTPRAAHVATAVGTMV  204



>ref|XP_009373887.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Pyrus 
x bretschneideri]
Length=1001

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGQPGYIGPRLILFGGATALEGNSAA  129

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  185



>ref|XP_008385576.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Malus domestica]
Length=1002

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  71   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  130

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  131  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  186



>gb|KFK43163.1| hypothetical protein AALP_AA1G088000 [Arabis alpina]
Length=1016

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 74/117 (63%), Gaps = 16/117 (14%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  83   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  142

Query  408  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                    G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMV
Sbjct  143  TGTPTSAAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMV  199



>ref|XP_008361620.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Malus 
domestica]
Length=1001

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYFGPRLILFGGATALEGNSAA  129

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  185



>ref|XP_009368358.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Pyrus x 
bretschneideri]
Length=1004

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  132

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  188



>ref|XP_006369377.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
 gb|ERP65946.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
Length=1000

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    D  ED PGPRCGHTLT VAA    G      PRLILFGGATA+E     
Sbjct  77   APTYSVVNANMDKKEDGPGPRCGHTLTNVAAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KWTR+ P GEPP+PRAAH A AVGTMV
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWTRITPFGEPPTPRAAHVATAVGTMV  192



>ref|XP_009336399.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336400.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Pyrus x bretschneideri]
Length=1001

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  70   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGQPGYIGPRLILFGGATALEGNSAA  129

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  130  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  185



>ref|XP_008230041.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Prunus mume]
Length=1004

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGCIGPRLILFGGATALEGNSAA  132

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  188



>ref|XP_007208428.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
 gb|EMJ09627.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
Length=1005

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  132

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  188



>ref|XP_008230036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Prunus mume]
Length=1005

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGCIGPRLILFGGATALEGNSAA  132

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  188



>ref|XP_009398342.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=985

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 80/127 (63%), Gaps = 15/127 (12%)
 Frame = +3

Query  222  ELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLIL  383
            E   +AA P   PAPT+  +    +  ED PG RCGHTLTAVAA    G      PRLIL
Sbjct  42   EAQAVAAGP--RPAPTFSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLIL  99

Query  384  Fggataieggnggpg-------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaa  542
            FGGATA+EG +  P        IRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A
Sbjct  100  FGGATALEGNSAAPASPAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVA  159

Query  543  aaVGTMV  563
             AVGTMV
Sbjct  160  TAVGTMV  166



>ref|XP_009398341.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=986

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 80/127 (63%), Gaps = 15/127 (12%)
 Frame = +3

Query  222  ELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLIL  383
            E   +AA P   PAPT+  +    +  ED PG RCGHTLTAVAA    G      PRLIL
Sbjct  42   EAQAVAAGP--RPAPTFSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLIL  99

Query  384  Fggataieggnggpg-------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaa  542
            FGGATA+EG +  P        IRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A
Sbjct  100  FGGATALEGNSAAPASPAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVA  159

Query  543  aaVGTMV  563
             AVGTMV
Sbjct  160  TAVGTMV  166



>ref|XP_010101992.1| Serine/threonine-protein phosphatase BSL2 [Morus notabilis]
 gb|EXB91212.1| Serine/threonine-protein phosphatase BSL2 [Morus notabilis]
Length=1084

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  86   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  145

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  146  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  201



>ref|XP_011044597.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 68/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    D  ED PGPRCGHTLT VAA    G      PRLILF           +
Sbjct  77   APTYSVVNANMDKKEDGPGPRCGHTLTNVAAVGEEGTPGYIGPRLILFGGATALGGNSAS  136

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            T      G  GIRLAG T  +H YDVLT KWTR+ P GEPP+PRAAH A AVGTMV
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWTRITPFGEPPTPRAAHVATAVGTMV  192



>ref|XP_006594918.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=877

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  64   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  179



>gb|KHG29076.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1016

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           +
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPSYIGPRLILFGGATALEGNSAS  143

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  144  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  199



>emb|CDY22684.1| BnaC08g43180D [Brassica napus]
Length=995

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 76/117 (65%), Gaps = 16/117 (14%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  419
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  65   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGAPGYIGPRLVLFGGATALEGNSGG  124

Query  420  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                       GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMV
Sbjct  125  TGTPTSATPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMV  181



>dbj|BAF00990.1| putative phosphoprotein phosphatase [Arabidopsis thaliana]
Length=707

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPYGEPPSPRAAHVATAVGTMV  189



>gb|KJB55556.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55557.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55558.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55559.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55560.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=1016

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 68/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           +
Sbjct  84   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPSYIGPRLILFGGATALEGNSAS  143

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  144  AGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  199



>ref|XP_003543410.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=988

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  64   APTYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  179



>ref|XP_007132502.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
 gb|ESW04496.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
Length=1007

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGSSAA  132

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDV+T KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  133  SGTPSSAGNAGIRLAGATADVHCYDVITNKWSRITPIGEPPTPRAAHVATAVGTMV  188



>ref|XP_010419412.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1003

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIMEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  133

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMV  189



>emb|CDY06313.1| BnaA09g48900D [Brassica napus]
Length=992

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 76/117 (65%), Gaps = 16/117 (14%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  419
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  62   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  121

Query  420  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                       GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMV
Sbjct  122  TGTPTSATPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMV  178



>ref|XP_010473113.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Camelina 
sativa]
Length=1011

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  81   APTYSVVNAIMEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  140

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  141  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMV  196



>ref|XP_009118376.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Brassica 
rapa]
Length=992

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 76/117 (65%), Gaps = 16/117 (14%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  419
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  62   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  121

Query  420  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                       GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMV
Sbjct  122  TGTPTSATPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMV  178



>ref|XP_004291538.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Fragaria 
vesca subsp. vesca]
Length=998

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  64   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALEGNSAA  123

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YD+LT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDILTNKWSRITPFGEPPTPRAAHVATAVGTMV  179



>gb|KDO46578.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=975

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  187



>ref|XP_006826448.1| hypothetical protein AMTR_s00004p00175690 [Amborella trichopoda]
 gb|ERM93685.1| hypothetical protein AMTR_s00004p00175690 [Amborella trichopoda]
Length=1423

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 74/120 (62%), Gaps = 18/120 (15%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  419
            PAPTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG + 
Sbjct  66   PAPTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSS  125

Query  420  gpg------------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                           IRLAG T  +H YDVL+ KW+RL P GE PSPRAAH A AVGTMV
Sbjct  126  STAPSGPPSSGGNAGIRLAGATADVHCYDVLSNKWSRLTPLGEQPSPRAAHVATAVGTMV  185



>ref|XP_006408677.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
 gb|ESQ50130.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
Length=1005

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  73   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSGG  132

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  133  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMV  188



>gb|AFW68154.1| hypothetical protein ZEAMMB73_166373 [Zea mays]
Length=185

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 71/115 (62%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAP Y  +    D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  59   PAPGYTVVNAVIDKKEDGPGCRCGHTLTAVPAVGEDGTPGYIGPRLILFGGATALEGNSA  118

Query  408  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  G  GIRLAG T  +H YDV + KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  119  TPPSSAGSAGIRLAGATADVHCYDVSSNKWSRLTPLGEPPSPRAAHVATAVGTMV  173



>ref|XP_006424082.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|ESR37322.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46576.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=999

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  187



>ref|XP_006424083.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 ref|XP_006487860.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Citrus 
sinensis]
 gb|ESR37323.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46577.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=998

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  131

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  187



>ref|XP_002879075.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55334.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=1002

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  70   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSGYIGPRLILFGGATALEGNSGG  129

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  130  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMV  185



>ref|XP_003596905.1| Serine/threonine protein phosphatase [Medicago truncatula]
 gb|AES67156.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=995

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            AP Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  64   APNYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  123

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+RL P GEPP+PRAAH A AVGTMV
Sbjct  124  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRLTPFGEPPTPRAAHVATAVGTMV  179



>ref|XP_006303893.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
 gb|EOA36791.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
Length=1018

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  85   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEGTPSYIGPRLVLFGGATALEGNSGG  144

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPP+PRAAH A AVGTMV
Sbjct  145  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPFGEPPTPRAAHVATAVGTMV  200



>ref|NP_001266022.1| Hop-interacting protein THI140 [Solanum lycopersicum]
 gb|AEW69826.1| Hop-interacting protein THI140 [Solanum lycopersicum]
Length=982

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 76/116 (66%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +++  +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  50   APTYTVVQSVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  109

Query  423  pg---------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                       IRLAG T  +HSYDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  110  AAAPSSPGGAGIRLAGATADVHSYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMV  165



>gb|KJB35473.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1001

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPRAAHVATAVGTMV  195



>gb|KJB35474.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=982

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPRAAHVATAVGTMV  195



>ref|XP_010513312.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1045

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  136

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  137  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMV  192



>ref|XP_004487445.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cicer 
arietinum]
Length=1003

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            AP Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  70   APNYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  129

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+RL P GEPP+PRAAH A AVGTMV
Sbjct  130  SGTPTSAGNAGIRLAGATADVHCYDVLTNKWSRLTPFGEPPTPRAAHVATAVGTMV  185



>ref|XP_010474966.1| PREDICTED: serine/threonine-protein phosphatase BSU1-like [Camelina 
sativa]
Length=800

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            MA+  + Y + +Y  L+ F D DED PGPRCGHTLTA+ A  +H  +L+LFGG+T     
Sbjct  1    MASHSYPY-STSYDYLQNFSDNDEDWPGPRCGHTLTAIFANDSH--QLVLFGGSTDAVTT  57

Query  414  nggp--giRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      I L GVTN++HS+DVLTRKWTR+   G+ PSPRA HAA ++GT++
Sbjct  58   DDSSLPAISLGGVTNSVHSFDVLTRKWTRINTDGDLPSPRACHAATSLGTLL  109



>gb|KJB35470.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35471.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35472.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1015

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPRAAHVATAVGTMV  195



>ref|XP_010458078.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Camelina 
sativa]
Length=1017

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 76/118 (64%), Gaps = 17/118 (14%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  419
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  82   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGG  141

Query  420  ----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                        GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMV
Sbjct  142  GGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMV  199



>ref|XP_006295510.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
 gb|EOA28408.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
Length=999

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  72   APTYSVVNAVIEKKEDGPGPRCGHTLTAVPAVGEEGTSCYIGPRLILFGGATALEGNSGG  131

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  132  TGTPTSAGSAGIRLAGATADVHCYDVLTNKWSRLTPYGEPPSPRAAHVATAVGTMV  187



>gb|KHG22818.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1015

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  80   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  139

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVL+ KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  140  SGTPSSAGSAGIRLAGATADVHCYDVLSNKWSRITPFGEPPTPRAAHVATAVGTMV  195



>ref|XP_008681503.1| PREDICTED: uncharacterized protein LOC100192777 isoform X2 [Zea 
mays]
Length=995

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 73/115 (63%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  61   PAPGYTVVDAAMDKKEDGPGSRCGHTLTAVPAAGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  408  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AVGTMV
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAVGTMV  175



>ref|XP_008681453.1| PREDICTED: uncharacterized protein LOC100192777 isoform X1 [Zea 
mays]
 tpg|DAA47544.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=996

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 73/115 (63%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  61   PAPGYTVVDAAMDKKEDGPGSRCGHTLTAVPAAGEEGSPGYVGPRLILFGGATALEGNSA  120

Query  408  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AVGTMV
Sbjct  121  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAVGTMV  175



>ref|XP_002976889.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
 gb|EFJ21999.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
Length=994

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 77/117 (66%), Gaps = 15/117 (13%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  419
            PAP+YR +    +  ED PGPRCGHTLT+VAA    G      PRLILFGGATA+EG + 
Sbjct  62   PAPSYRVVNAIIEKKEDGPGPRCGHTLTSVAAVGEQGTAGYIGPRLILFGGATALEGNSA  121

Query  420  ---------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                       GIRLAG T  +H +D+++ KW+RL   GEPPSPRAAHAA AVG+MV
Sbjct  122  AAPTPPPAGNAGIRLAGATADVHCFDIISNKWSRLNAVGEPPSPRAAHAATAVGSMV  178



>ref|XP_009388972.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=986

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 80/128 (63%), Gaps = 15/128 (12%)
 Frame = +3

Query  219  AELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLI  380
            AE   +AA P   PAP Y  +    +  ED PG RCGHTLTAVAA    G      PRLI
Sbjct  40   AEAQPVAAGP--RPAPGYSVVNAVIERKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLI  97

Query  381  LFggataieggng-------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaaha  539
            LFGGATA+EG +          GIRLAG T  +H YDVL+ KWTR+ P GEPPSPRAAH 
Sbjct  98   LFGGATALEGNSAAPASPTGSAGIRLAGATADVHCYDVLSNKWTRVTPLGEPPSPRAAHV  157

Query  540  aaaVGTMV  563
            A AVGTMV
Sbjct  158  ATAVGTMV  165



>ref|XP_002980607.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
 gb|EFJ18258.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
Length=995

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 75/118 (64%), Gaps = 16/118 (14%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggn-  416
            PAP+YR +    +  ED PGPRCGHTLT+VAA    G      PRLILFGGATA+EG + 
Sbjct  62   PAPSYRVVNAIIEKKEDGPGPRCGHTLTSVAAVGEQGTAGYIGPRLILFGGATALEGNSA  121

Query  417  ---------ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                          RLAG T  +H +D+++ KW+RL   GEPPSPRAAHAA AVG+MV
Sbjct  122  AAPTPPPAGNAGISRLAGATADVHCFDIISNKWSRLNAVGEPPSPRAAHAATAVGSMV  179



>ref|XP_010557449.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Tarenaya 
hassleriana]
Length=1008

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  81   APTYSVVNAIIENKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  140

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMV
Sbjct  141  TGTPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPYGEPPTPRAAHVATAVGTMV  196



>gb|KDP42962.1| hypothetical protein JCGZ_23904 [Jatropha curcas]
Length=1008

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 75/116 (65%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  419
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  133

Query  420  --------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                      GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  134  SGAPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  189



>ref|XP_010475640.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X1 [Camelina sativa]
 ref|XP_010475641.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X2 [Camelina sativa]
Length=1023

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 76/119 (64%), Gaps = 18/119 (15%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng-  419
            APTY  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+EG +G 
Sbjct  87   APTYSVVDALMDKKEDGPGPRCGHTLTAVPAVGDEGTPGYIGPRLVLFGGATALEGNSGG  146

Query  420  -----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                         GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMV
Sbjct  147  GGGTGTPTSAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMV  205



>ref|XP_006417691.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
 gb|ESQ36044.1| hypothetical protein EUTSA_v10006669mg [Eutrema salsugineum]
Length=1012

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 73/117 (62%), Gaps = 16/117 (14%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            AP Y  ++   D  ED PGPRCGHTLTAV A    G      PRL+LFGGATA+E     
Sbjct  78   APNYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLVLFGGATALEGNSGG  137

Query  408  -----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                    G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMV
Sbjct  138  TGTPTSAAGSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPTPRAAHVATAVGTMV  194



>ref|XP_002264614.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Vitis vinifera]
Length=1006

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  71   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  130

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDV+T KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  131  SGTPSSAGSAGIRLAGATADVHCYDVITNKWSRITPFGEPPTPRAAHVATAVGTMV  186



>ref|XP_009770254.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Nicotiana sylvestris]
Length=982

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    + +ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMV  177



>emb|CBI24435.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  43   APTYSVVNAVIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  102

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDV+T KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  103  SGTPSSAGSAGIRLAGATADVHCYDVITNKWSRITPFGEPPTPRAAHVATAVGTMV  158



>ref|XP_009412503.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=981

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 75/115 (65%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  419
            PAPTYR + +  +  ED  G RCGHTLTAV A    G      PRLILFGGATA+EG + 
Sbjct  47   PAPTYRVVNSIIEKKEDGAGCRCGHTLTAVPAVGEEGTPGFIGPRLILFGGATALEGNSA  106

Query  420  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                     GIRLAG T  +H YDVL+ +WTRL P GEPPSPRAAH A AVGTMV
Sbjct  107  APPSPAGSAGIRLAGATADVHCYDVLSNRWTRLMPLGEPPSPRAAHVATAVGTMV  161



>ref|XP_009770255.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana sylvestris]
Length=949

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    + +ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMV  177



>ref|XP_010544321.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Tarenaya hassleriana]
Length=1015

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  82   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  141

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMV
Sbjct  142  TGTPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPYGEPPTPRAAHVATAVGTMV  197



>ref|XP_003539489.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1003

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            AP+Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  67   APSYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  126

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  127  TGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  182



>ref|XP_009770253.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana sylvestris]
Length=984

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    + +ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  62   APTYSVVHAVLEKEEDGPGPRCGHTLTAVPAVGEEGSPNYSGPRLILFGGATALEGNSAA  121

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMV  177



>ref|XP_006592783.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=998

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            AP+Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  67   APSYTVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  126

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  127  TGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  182



>ref|XP_009788953.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
 ref|XP_009788954.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
Length=709

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 73/117 (62%), Gaps = 16/117 (14%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  ++   +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  47   APTYTVVQAVMEKKEDGPGPRCGHTLTAVPAVGEEGTSNYIGPRLILFGGATALEGNSAA  106

Query  423  pgi----------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                         RLAG T  +H YDVLT KW+RL P GEPP+PRAAH A AVGTMV
Sbjct  107  SAPAPSSPGSAGIRLAGATADVHCYDVLTNKWSRLTPIGEPPTPRAAHVATAVGTMV  163



>ref|XP_006591057.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=1014

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  76   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAA  135

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDV++ KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  136  SGTPSSAGNAGIRLAGATADVHCYDVISNKWSRITPIGEPPTPRAAHVATAVGTMV  191



>ref|XP_004963199.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Setaria italica]
Length=997

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 73/115 (63%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  63   PAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  122

Query  408  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AVGTMV
Sbjct  123  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAVGTMV  177



>ref|XP_003538088.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=1010

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  76   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAA  135

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDV++ KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  136  SGTPSSAGNAGIRLAGATADVHCYDVISNKWSRITPIGEPPTPRAAHVATAVGTMV  191



>ref|XP_010544322.1| PREDICTED: serine/threonine-protein phosphatase BSL2 isoform 
X2 [Tarenaya hassleriana]
Length=991

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  82   APTYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSGG  141

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVL+ KWTRL P GEPP+PRAAH A AVGTMV
Sbjct  142  TGTPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPYGEPPTPRAAHVATAVGTMV  197



>ref|NP_001189614.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 gb|AEC07954.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1001

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPYGEPPSPRAAHVATAVGTMV  189



>ref|XP_002443577.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
 gb|EES17415.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
Length=1008

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 73/115 (63%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  74   PAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGGATALEGNSA  133

Query  408  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AVGTMV
Sbjct  134  TPPSSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAVGTMV  188



>ref|XP_006592360.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Glycine max]
Length=986

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 67/116 (58%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILF            
Sbjct  68   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAV  127

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  IH YDV+T KW+R+ P GEPPS RAAH A AVGTMV
Sbjct  128  SGTPSSAGNAGIRLAGATADIHCYDVITNKWSRITPIGEPPSSRAAHVATAVGTMV  183



>ref|NP_180289.3| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 sp|Q9SHS7.2|BSL3_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL3; AltName: 
Full=BSU1-like protein 3 [Arabidopsis thaliana]
 gb|AEC07953.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1006

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  74   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  133

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  134  TGTPTSAGSAGIRLAGATADVHCYDVLSNKWSRLTPYGEPPSPRAAHVATAVGTMV  189



>ref|XP_008674098.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Zea mays]
 tpg|DAA54714.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=998

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 78/124 (63%), Gaps = 15/124 (12%)
 Frame = +3

Query  231  GMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFgg  392
            G+ A P   PAP Y  ++   D  ED PG RCGHTLTAV A    G      PRLILFGG
Sbjct  57   GLVAGP--RPAPGYTVVDAAMDKKEDGPGCRCGHTLTAVPAVGEEGSPGYVGPRLILFGG  114

Query  393  ataieggng-------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaV  551
            ATA+EG +          GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AV
Sbjct  115  ATALEGNSATPPSPAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAV  174

Query  552  GTMV  563
            GTMV
Sbjct  175  GTMV  178



>ref|XP_006592359.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=996

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  68   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAV  127

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  IH YDV+T KW+R+ P GEPPS RAAH A AVGTMV
Sbjct  128  SGTPSSAGNAGIRLAGATADIHCYDVITNKWSRITPIGEPPSSRAAHVATAVGTMV  183



>ref|XP_003540821.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1001

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E     
Sbjct  68   APTYSVVNAILEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAV  127

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  IH YDV+T KW+R+ P GEPPS RAAH A AVGTMV
Sbjct  128  SGTPSSAGNAGIRLAGATADIHCYDVITNKWSRITPIGEPPSSRAAHVATAVGTMV  183



>ref|XP_011008746.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  192



>ref|XP_011008648.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Populus 
euphratica]
Length=1011

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  192



>ref|XP_006361106.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=997

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  64   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  123

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMV  179



>emb|CDX97481.1| BnaC08g13460D [Brassica napus]
Length=992

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 79/134 (59%), Gaps = 16/134 (12%)
 Frame = +3

Query  210  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------P  371
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A    G      P
Sbjct  49   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGP  108

Query  372  RLILFggataieggng----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPS  521
            RL+LFGGATA+EG +G            GIRLAG T  +H YDVL+ KWTRL P GEPP+
Sbjct  109  RLVLFGGATALEGNSGGTGTPTSAAPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPT  168

Query  522  PRaahaaaaVGTMV  563
            PRAAH A AVGTMV
Sbjct  169  PRAAHVATAVGTMV  182



>ref|XP_009110896.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Brassica 
rapa]
Length=990

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 78/134 (58%), Gaps = 16/134 (12%)
 Frame = +3

Query  210  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------P  371
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A    G      P
Sbjct  47   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGP  106

Query  372  RLILFggataieggng----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPS  521
            RL+LFGGATA+E  +G            GIRLAG T  +H YDVL+ KWTRL P GEPP+
Sbjct  107  RLVLFGGATALEDNSGGTGTPTSAAPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPT  166

Query  522  PRaahaaaaVGTMV  563
            PRAAH A AVGTMV
Sbjct  167  PRAAHVATAVGTMV  180



>ref|XP_002313501.2| kelch repeat-containing family protein [Populus trichocarpa]
 gb|EEE87456.2| kelch repeat-containing family protein [Populus trichocarpa]
Length=993

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  77   APTYSVVNAIIEKKEDGPGPRCGHTLTAVIAVGEEGTPGYIGPRLILFGGATALEGNSAS  136

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  137  TGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  192



>ref|NP_001275238.1| serine/threonine-protein phosphatase BSL3-like [Solanum tuberosum]
 gb|AFN44701.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=999

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  64   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  123

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMV  179



>ref|XP_009587053.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Nicotiana tomentosiformis]
Length=956

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMV  177



>ref|XP_011090290.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Sesamum indicum]
Length=1005

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 68/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMV  187



>emb|CDY31148.1| BnaA08g26980D [Brassica napus]
Length=990

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 79/134 (59%), Gaps = 16/134 (12%)
 Frame = +3

Query  210  IGGAELDGMAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------P  371
            +GG E            AP Y  ++   D  ED PGPRCGHTLTAV A    G      P
Sbjct  47   VGGGEAQSAQVVVGPRCAPPYSVVDALMDKKEDGPGPRCGHTLTAVPAVGEEGTNGYIGP  106

Query  372  RLILFggataieggng----------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPS  521
            RL+LFGGATA+EG +G            GIRLAG T  +H YDVL+ KWTRL P GEPP+
Sbjct  107  RLVLFGGATALEGNSGGTGTPTSAAPSAGIRLAGATADVHCYDVLSNKWTRLTPFGEPPT  166

Query  522  PRaahaaaaVGTMV  563
            PRAAH A AVGTMV
Sbjct  167  PRAAHVATAVGTMV  180



>ref|XP_004241349.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Solanum lycopersicum]
Length=996

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  62   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  121

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMV  177



>ref|XP_010322449.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Solanum lycopersicum]
Length=994

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  62   APTYSVVHAVMEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAG  121

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  122  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMV  177



>ref|XP_009587040.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=991

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMV  177



>ref|XP_011090289.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Sesamum indicum]
Length=1006

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 68/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMV  187



>ref|XP_009587046.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=989

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  62   APTYSVVHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  121

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  122  SGTPSAAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMV  177



>ref|XP_009587594.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
tomentosiformis]
Length=978

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 74/117 (63%), Gaps = 16/117 (14%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  ++   +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  47   APTYTVVQAVMEKKEDGPGPRCGHTLTAVPAVGEEGSSNYIGPRLILFGGATALEGNSAA  106

Query  423  pg----------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                        IRLAG T  +H YDVLT KW+RL P GEPP+PRAAH A AVGTMV
Sbjct  107  SAPAPSSPGSAGIRLAGATADVHCYDVLTNKWSRLTPIGEPPTPRAAHVATAVGTMV  163



>ref|XP_011090288.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Sesamum indicum]
Length=1007

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 68/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  72   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGIPGYIGPRLILFGGATALEGNSAA  131

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  132  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMV  187



>gb|EYU36016.1| hypothetical protein MIMGU_mgv1a000720mg [Erythranthe guttata]
Length=1005

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 71/116 (61%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            AP Y  +    D  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  73   APMYTVVNALMDKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSGA  132

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A  VGTMV
Sbjct  133  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATTVGTMV  188



>emb|CDP15567.1| unnamed protein product [Coffea canephora]
Length=1012

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 68/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  82   APTYTVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  141

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  142  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMV  197



>gb|KJB21740.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
 gb|KJB21741.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
Length=1013

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 68/116 (59%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            AP Y  +    +  ED PGPRCGHTLTAVAA    G      PRLILF           A
Sbjct  78   APPYSVVNAIIEKKEDGPGPRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAA  137

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  138  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  193



>gb|AES88189.2| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=999

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 74/116 (64%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            AP+Y  ++   +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  69   APSYTVVDAILEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSAA  128

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  129  SGTPTSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  184



>ref|XP_006340328.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=994

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  64   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMV  179



>ref|XP_006340327.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum tuberosum]
Length=996

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  64   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  124  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRITPIGEPPTPRAAHVATAVGTMV  179



>ref|XP_009598633.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=305

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 66/116 (57%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            AP Y  +    +  ED PG RCGHTLTAV A    G      PRLILF           A
Sbjct  63   APAYSVVHAVLEKKEDGPGSRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSAA  122

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  123  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMV  178



>ref|XP_010658896.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X4 [Vitis vinifera]
Length=869

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +3

Query  264  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  419
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  420  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PRAAH AAAVGTMV
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPRAAHVAAAVGTMV  156



>emb|CDY57791.1| BnaCnng32470D [Brassica napus]
Length=997

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 73/117 (62%), Gaps = 16/117 (14%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggn--  416
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  65   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSGG  124

Query  417  --------ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                       GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  125  TGTPTSAGSAGGIRLAGATADVHCYDVLTNKWSRLSPHGEPPSPRAAHVATAVGTMV  181



>ref|XP_010658894.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Vitis vinifera]
Length=884

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +3

Query  264  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  419
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  420  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PRAAH AAAVGTMV
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPRAAHVAAAVGTMV  156



>ref|XP_009598634.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=289

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 66/116 (57%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            AP Y  +    +  ED PG RCGHTLTAV A    G      PRLILF           A
Sbjct  63   APAYSVVHAVLEKKEDGPGSRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSAA  122

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  123  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMV  178



>ref|XP_010658895.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Vitis vinifera]
Length=875

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +3

Query  264  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  419
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  420  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PRAAH AAAVGTMV
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPRAAHVAAAVGTMV  156



>ref|XP_002262846.2| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Vitis vinifera]
 ref|XP_010658893.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Vitis vinifera]
Length=976

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +3

Query  264  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  419
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  420  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PRAAH AAAVGTMV
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPRAAHVAAAVGTMV  156



>emb|CBI24997.3| unnamed protein product [Vitis vinifera]
Length=928

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +3

Query  264  PTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng--  419
            PTY  + T  +  ED PGPRCGHTLTAVAA    G      PRLILFGGATA+E      
Sbjct  42   PTYFPVNTIIEKKEDNPGPRCGHTLTAVAAVGEEGSPGYIGPRLILFGGATALENNATTS  101

Query  420  -------gpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                      IRLAG T  +H YD+ ++KW+R+ P GEPP+PRAAH AAAVGTMV
Sbjct  102  GALSSPGSSSIRLAGATADVHCYDISSKKWSRITPLGEPPTPRAAHVAAAVGTMV  156



>ref|XP_009795596.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL3-like [Nicotiana sylvestris]
Length=989

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 72/116 (62%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY       +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  64   APTYSVAHAVLEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  123

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  124  PGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRMTPIGEPPTPRAAHVATAVGTMV  179



>ref|XP_009140775.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Brassica 
rapa]
Length=998

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 73/117 (62%), Gaps = 16/117 (14%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTH------GPRLILFggataieggn--  416
            AP Y  +    +  ED PGPRCGHTLTAV A          GPRLILFGGATA+EG +  
Sbjct  66   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEERSANYIGPRLILFGGATALEGNSGG  125

Query  417  --------ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                       GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  126  TGTPTSAGSAGGIRLAGATADVHCYDVLTNKWSRLTPHGEPPSPRAAHVATAVGTMV  182



>emb|CDY57485.1| BnaAnng14650D [Brassica napus]
Length=998

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 73/117 (62%), Gaps = 16/117 (14%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggn--  416
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  66   APPYSVVNAILEKKEDGPGPRCGHTLTAVPAVGEEGSANYIGPRLILFGGATALEGNSGG  125

Query  417  --------ggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                       GIRLAG T  +H YDVLT KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  126  TGTPTSAGSAGGIRLAGATADVHCYDVLTNKWSRLTPHGEPPSPRAAHVATAVGTMV  182



>gb|ABF97885.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
Length=1003

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 73/115 (63%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAP Y ++    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  68   PAPGYTAVSAVIEKKEDGPGCRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSA  127

Query  408  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  128  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPQGEPPSPRAAHVATAVGTMV  182



>gb|EEC75832.1| hypothetical protein OsI_12812 [Oryza sativa Indica Group]
Length=1003

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 73/115 (63%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAP Y ++    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  68   PAPGYTAVSAVIEKKEDGPGCRCGHTLTAVPAVGEEGTPGYIGPRLILFGGATALEGNSA  127

Query  408  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  128  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPQGEPPSPRAAHVATAVGTMV  182



>ref|XP_010457353.1| PREDICTED: serine/threonine-protein phosphatase BSU1-like [Camelina 
sativa]
Length=796

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = +3

Query  234  MAAKPWLYPAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHGPRLILFggataiegg  413
            MA+  + YP+ +Y  L+TF + DE  PGPRCGHTLTAV A  +H  +L+LFGG+T     
Sbjct  1    MASHSYPYPSTSYEYLQTFANDDE-WPGPRCGHTLTAVFANDSH--QLVLFGGSTTAVTT  57

Query  414  nggpg--iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTM  560
            N      I L GVTN++HS+DVLTR+WTR+   G+ PSPRA HAA + GT+
Sbjct  58   NDYSLPGISLEGVTNSVHSFDVLTRRWTRIHTDGDLPSPRACHAATSFGTL  108



>ref|XP_008449600.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Cucumis 
melo]
Length=1002

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 67/116 (58%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            APTY  +    D  ED PGPRCGHTLTAV +    G      PRLILF           A
Sbjct  69   APTYSVVNAIIDKKEDGPGPRCGHTLTAVGSVGEEGTPGYIGPRLILFGGATALEGNSAA  128

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H +DVL  KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  129  SGTPSSAGSAGIRLAGATADVHCFDVLANKWSRITPLGEPPTPRAAHVATAVGTMV  184



>ref|XP_001765008.1| predicted protein [Physcomitrella patens]
 gb|EDQ70224.1| predicted protein [Physcomitrella patens]
Length=986

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 76/117 (65%), Gaps = 15/117 (13%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  419
            PAP ++++    +  +D PGPRCGHTLTAVAA    G      PRLILFGGATA+EG + 
Sbjct  34   PAPAFKAITAICERKDDGPGPRCGHTLTAVAAVGEEGSPAYIGPRLILFGGATALEGNSS  93

Query  420  gpg---------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
              G         IRLAG T  +H YD  T KW+RL P G+PPSPRAAHAA AVGTMV
Sbjct  94   QAGPQTAVAGAGIRLAGATADVHCYDAHTNKWSRLIPVGDPPSPRAAHAATAVGTMV  150



>ref|XP_010685448.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Beta vulgaris 
subsp. vulgaris]
Length=1019

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 72/116 (62%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            AP+Y  +    D  ED  GPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  85   APSYSVVNAIIDKKEDGAGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  144

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  IH YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  145  AGTPSSAGSAGIRLAGATADIHCYDVLTNKWSRIAPIGEPPTPRAAHVATAVGTMV  200



>ref|XP_004506226.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004506227.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Cicer arietinum]
Length=1003

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            AP+Y  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  68   APSYTVVNAILEKKEDGPGPRCGHTLTAVPAVGEDGTPGYIGPRLILFGGATALEGNSAA  127

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  128  SGTPSSAGNAGIRLAGATADVHCYDVLTNKWSRITPFGEPPTPRAAHVATAVGTMV  183



>ref|XP_008811284.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Phoenix dactylifera]
Length=995

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 72/112 (64%), Gaps = 13/112 (12%)
 Frame = +3

Query  267  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  407
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  61   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  120

Query  408  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAHAA AVGTMV
Sbjct  121  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHAATAVGTMV  172



>ref|XP_008811285.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Phoenix dactylifera]
Length=995

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 72/112 (64%), Gaps = 13/112 (12%)
 Frame = +3

Query  267  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  407
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  61   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  120

Query  408  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAHAA AVGTMV
Sbjct  121  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHAATAVGTMV  172



>ref|XP_008811286.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Phoenix dactylifera]
Length=994

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 72/112 (64%), Gaps = 13/112 (12%)
 Frame = +3

Query  267  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  407
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  61   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  120

Query  408  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAHAA AVGTMV
Sbjct  121  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHAATAVGTMV  172



>ref|XP_010313488.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum lycopersicum]
Length=995

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 72/116 (62%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  65   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  124

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDV T KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  125  SGTPSSAGSAGIRLAGATADVHCYDVFTNKWSRITPIGEPPTPRAAHVATAVGTMV  180



>ref|XP_011088984.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Sesamum indicum]
Length=1013

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 67/116 (58%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  81   APMYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  140

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  141  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRVTPIGEPPTPRAAHVATAVGTMV  196



>ref|XP_011088983.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Sesamum indicum]
Length=1015

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 67/116 (58%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PRLILF           A
Sbjct  81   APMYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGSPGYIGPRLILFGGATALEGNSAA  140

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H YDVLT KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  141  SGTPSSAGSAGIRLAGATADVHCYDVLTNKWSRVTPIGEPPTPRAAHVATAVGTMV  196



>gb|AAD26883.1| putative phosphoprotein phosphatase [Arabidopsis thaliana]
Length=715

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 70/116 (60%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+E     
Sbjct  50   APTYSVVNAIIEKKEDGPGPRCGHTLTAVPAVGEEGTSSYIGPRLILFGGATALEGNSGG  109

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  +      LAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  110  TGTPTSSNVSYAGLAGATADVHCYDVLSNKWSRLTPYGEPPSPRAAHVATAVGTMV  165



>ref|XP_010941606.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Elaeis guineensis]
Length=978

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 71/112 (63%), Gaps = 13/112 (12%)
 Frame = +3

Query  267  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  407
            TY  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  43   TYSVVNAIIEKKEDGPGCRCGHTLTAVAAVGEEGTSGYIGPRLILFGGATALEGNSAAPP  102

Query  408  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAH A AVGTMV
Sbjct  103  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHVATAVGTMV  154



>ref|XP_004251224.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Solanum lycopersicum]
Length=997

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 72/116 (62%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            APTY  +    +  ED PGPRCGHTLTAV A    G      PRLILFGGATA+EG +  
Sbjct  65   APTYSVVHEVIEKKEDGPGPRCGHTLTAVPAVGEEGSPNYIGPRLILFGGATALEGNSAA  124

Query  423  pgi---------RLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G          RLAG T  +H YDV T KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  125  SGTPSSAGSAGIRLAGATADVHCYDVFTNKWSRITPIGEPPTPRAAHVATAVGTMV  180



>gb|EPS70499.1| hypothetical protein M569_04238, partial [Genlisea aurea]
Length=1011

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 72/116 (62%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-----  407
            AP Y  +    +  ED PGPRCGHTLTAV A    G      PR+ILFGGATA+E     
Sbjct  74   APMYNVVNVIIEKKEDGPGPRCGHTLTAVPAVGEEGTPGYIGPRMILFGGATALEGNSGG  133

Query  408  ----ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                   G  GIRLAG T  IH YDV+T KW+R+ P GEPP+PRAAH A +VGTMV
Sbjct  134  TGTPTSAGSAGIRLAGATADIHCYDVMTNKWSRMTPIGEPPTPRAAHVATSVGTMV  189



>ref|XP_006651637.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=940

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 72/115 (63%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAP Y  +    +  ED PG RCGHTLTAV A    G      PRLILFGGATA+E    
Sbjct  5    PAPGYTVVSAVIEKKEDGPGCRCGHTLTAVPAVGEDGTPGYIGPRLILFGGATALEGNSA  64

Query  408  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  65   TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPQGEPPSPRAAHVATAVGTMV  119



>ref|XP_001769730.1| predicted protein [Physcomitrella patens]
 gb|EDQ65531.1| predicted protein [Physcomitrella patens]
Length=962

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 75/116 (65%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggngg  422
            AP Y+++    +  +D PGPRCGHTLTAVAA    G      PRLILFGGATA+EG +  
Sbjct  25   APAYKAITAICERKDDGPGPRCGHTLTAVAAVGEEGKLAYVGPRLILFGGATALEGNSSQ  84

Query  423  pg---------iRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
             G         IRLAG T  +H YD+ + KW+RL P G+PPSPRAAHAA  VGTMV
Sbjct  85   AGPQMAVAGAGIRLAGATADVHCYDIHSNKWSRLIPVGDPPSPRAAHAATTVGTMV  140



>ref|XP_009418973.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=982

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 73/115 (63%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataieggng  419
            PAPTYR +    +  ED  G RCGHTLTAV      G      PRLILFGGATA+EG + 
Sbjct  47   PAPTYRVVNAIIEKKEDGAGCRCGHTLTAVPPVGEEGTPGYIGPRLILFGGATALEGNSA  106

Query  420  g-------pgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                     GIRLAG T  +H YD+L+ KWTRL P GEPPSPRAAH A AVGTMV
Sbjct  107  APPSPAGTAGIRLAGATADVHCYDMLSNKWTRLTPLGEPPSPRAAHVATAVGTMV  161



>pir||T00913 probable phosphoprotein phosphatase (EC 3.1.3.16) F21B7.27 - 
Arabidopsis thaliana
Length=729

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 52/90 (58%), Positives = 64/90 (71%), Gaps = 4/90 (4%)
 Frame = +3

Query  300  DEDAPGPRCGHTLTAVAATKTHGPRLILFggataieggnggpgiRLA--GVTNAIHSYDV  473
            DED PGPRCGHTLTAV    +H  +LILFGG+T     +      ++  GVTN++HS+DV
Sbjct  74   DEDWPGPRCGHTLTAVFVNNSH--QLILFGGSTTAVANHNSSLPEISLDGVTNSVHSFDV  131

Query  474  LTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            LTRKWTRL P G+ PSPRA HAAA  GT++
Sbjct  132  LTRKWTRLNPIGDVPSPRACHAAALYGTLI  161



>ref|XP_004140171.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
 gb|KGN48053.1| hypothetical protein Csa_6G426880 [Cucumis sativus]
Length=1002

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 66/116 (57%), Gaps = 15/116 (13%)
 Frame = +3

Query  261  APTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILF---------gga  395
            AP Y  +    D  ED PGPRCGHTLTAV +    G      PRLILF           A
Sbjct  69   APAYSVVNAIIDKKEDGPGPRCGHTLTAVGSVGEEGTPGYIGPRLILFGGATALEGNSAA  128

Query  396  taieggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
            +      G  GIRLAG T  +H +DVL  KW+R+ P GEPP+PRAAH A AVGTMV
Sbjct  129  SGTPSSAGSAGIRLAGATADVHCFDVLANKWSRITPLGEPPTPRAAHVATAVGTMV  184



>ref|XP_003561867.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
isoform X2 [Brachypodium distachyon]
Length=993

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 73/115 (63%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAP Y ++    +  ED PG RCGHTLT+V A    G      PRLILFGGATA+E    
Sbjct  60   PAPGYTAVTAVIEKKEDGPGCRCGHTLTSVPAVGEEGSQSYVGPRLILFGGATALEGNSA  119

Query  408  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  120  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPLGEPPSPRAAHVATAVGTMV  174



>ref|XP_010232097.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
isoform X1 [Brachypodium distachyon]
Length=1021

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 73/115 (63%), Gaps = 13/115 (11%)
 Frame = +3

Query  258  PAPTYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie----  407
            PAP Y ++    +  ED PG RCGHTLT+V A    G      PRLILFGGATA+E    
Sbjct  60   PAPGYTAVTAVIEKKEDGPGCRCGHTLTSVPAVGEEGSQSYVGPRLILFGGATALEGNSA  119

Query  408  ---ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
                  G  GIRLAG T  +H YDVL+ KW+RL P GEPPSPRAAH A AVGTMV
Sbjct  120  TPPSSAGSAGIRLAGATADVHCYDVLSNKWSRLTPLGEPPSPRAAHVATAVGTMV  174



>ref|XP_010907354.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Elaeis guineensis]
Length=1028

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 72/112 (64%), Gaps = 13/112 (12%)
 Frame = +3

Query  267  TYRSLETFWDTDEDAPGPRCGHTLTAVAATKTHG------PRLILFggataie-------  407
            +Y  +    +  ED PG RCGHTLTAVAA    G      PRLILFGGATA+E       
Sbjct  95   SYSVVNAVIEKKEDGPGCRCGHTLTAVAAVGEEGTPGYIGPRLILFGGATALEGNSAAPP  154

Query  408  ggnggpgiRLAGVTNAIHSYDVLTRKWTRLQPAGEPPSPRaahaaaaVGTMV  563
               G  GIRLAG T  +H YDVL+ KWTRL P GEPPSPRAAHAA AVGTMV
Sbjct  155  SSAGSAGIRLAGATADVHCYDVLSNKWTRLTPLGEPPSPRAAHAATAVGTMV  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920