BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H05

Length=562
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790840.1|  PREDICTED: uncharacterized protein LOC104238...    253   2e-81   Nicotiana sylvestris
ref|XP_004244165.1|  PREDICTED: uncharacterized protein LOC101261728    252   4e-81   Solanum lycopersicum
ref|XP_009626175.1|  PREDICTED: uncharacterized protein LOC104116...    251   8e-81   Nicotiana tomentosiformis
ref|XP_006360119.1|  PREDICTED: uncharacterized protein LOC102582458    251   1e-80   Solanum tuberosum [potatoes]
ref|XP_009790839.1|  PREDICTED: uncharacterized protein LOC104238...    248   2e-79   Nicotiana sylvestris
ref|XP_009626174.1|  PREDICTED: uncharacterized protein LOC104116...    246   8e-79   Nicotiana tomentosiformis
ref|XP_011069328.1|  PREDICTED: uncharacterized protein LOC105180349    236   6e-75   Sesamum indicum [beniseed]
gb|EYU20297.1|  hypothetical protein MIMGU_mgv1a013416mg                231   7e-73   Erythranthe guttata [common monkey flower]
ref|XP_006577760.1|  PREDICTED: uncharacterized protein LOC100305...    231   1e-72   
ref|NP_001235274.1|  uncharacterized protein LOC100305941 precursor     230   1e-72   
ref|XP_011081601.1|  PREDICTED: uncharacterized protein LOC105164610    229   2e-72   Sesamum indicum [beniseed]
ref|XP_004303460.1|  PREDICTED: uncharacterized protein LOC101299313    229   5e-72   Fragaria vesca subsp. vesca
emb|CDP13469.1|  unnamed protein product                                226   8e-71   Coffea canephora [robusta coffee]
ref|XP_008220571.1|  PREDICTED: uncharacterized protein LOC103320642    225   2e-70   Prunus mume [ume]
ref|XP_003526059.1|  PREDICTED: uncharacterized protein LOC100789560    225   2e-70   
emb|CDP06333.1|  unnamed protein product                                224   3e-70   Coffea canephora [robusta coffee]
ref|XP_008377828.1|  PREDICTED: uncharacterized protein LOC103440909    224   4e-70   
ref|XP_003603211.1|  hypothetical protein MTR_3g105080                  224   6e-70   Medicago truncatula
ref|XP_007222204.1|  hypothetical protein PRUPE_ppa009735mg             224   2e-69   
gb|ACU20606.1|  unknown                                                 221   5e-69   Glycine max [soybeans]
ref|XP_002281459.1|  PREDICTED: uncharacterized protein LOC100257849    219   2e-68   Vitis vinifera
gb|KHG15497.1|  Pathogenesis-related PR-1 type                          218   1e-67   Gossypium arboreum [tree cotton]
ref|XP_010261903.1|  PREDICTED: uncharacterized protein LOC104600...    217   2e-67   Nelumbo nucifera [Indian lotus]
ref|XP_004501432.1|  PREDICTED: uncharacterized protein LOC101501292    217   3e-67   Cicer arietinum [garbanzo]
ref|XP_010261902.1|  PREDICTED: uncharacterized protein LOC104600...    216   3e-67   Nelumbo nucifera [Indian lotus]
ref|XP_010527500.1|  PREDICTED: uncharacterized protein LOC104804836    216   4e-67   Tarenaya hassleriana [spider flower]
gb|KJB54600.1|  hypothetical protein B456_009G040600                    216   4e-67   Gossypium raimondii
ref|XP_009334743.1|  PREDICTED: uncharacterized protein LOC103927528    216   5e-67   
ref|XP_011016636.1|  PREDICTED: uncharacterized protein LOC105120142    216   5e-67   Populus euphratica
ref|XP_007136885.1|  hypothetical protein PHAVU_009G082100g             216   5e-67   Phaseolus vulgaris [French bean]
gb|KHN29678.1|  hypothetical protein glysoja_016300                     216   7e-67   Glycine soja [wild soybean]
ref|XP_002516139.1|  conserved hypothetical protein                     216   7e-67   Ricinus communis
gb|KDP34029.1|  hypothetical protein JCGZ_07600                         213   6e-66   Jatropha curcas
ref|XP_010098369.1|  hypothetical protein L484_018601                   212   2e-65   Morus notabilis
gb|KDO73630.1|  hypothetical protein CISIN_1g027565mg                   212   2e-65   Citrus sinensis [apfelsine]
ref|XP_006474494.1|  PREDICTED: uncharacterized protein LOC102617...    211   3e-65   Citrus sinensis [apfelsine]
ref|XP_010669319.1|  PREDICTED: uncharacterized protein LOC104886563    212   3e-65   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK93415.1|  unknown                                                 210   4e-65   Populus trichocarpa [western balsam poplar]
ref|XP_007012420.1|  Ferredoxin-related                                 211   5e-65   Theobroma cacao [chocolate]
ref|XP_004141344.1|  PREDICTED: uncharacterized protein LOC101215279    211   6e-65   
ref|XP_008452786.1|  PREDICTED: uncharacterized protein LOC103493...    209   3e-64   
ref|XP_002309466.1|  hypothetical protein POPTR_0006s23730g             209   4e-64   Populus trichocarpa [western balsam poplar]
ref|XP_009362772.1|  PREDICTED: uncharacterized protein LOC103952806    209   5e-64   Pyrus x bretschneideri [bai li]
emb|CBI20724.3|  unnamed protein product                                222   6e-64   Vitis vinifera
gb|KJB65467.1|  hypothetical protein B456_010G096500                    208   6e-64   Gossypium raimondii
gb|KHG22696.1|  hypothetical protein F383_04298                         207   1e-63   Gossypium arboreum [tree cotton]
ref|XP_008393587.1|  PREDICTED: uncharacterized protein LOC103455775    207   2e-63   Malus domestica [apple tree]
ref|XP_006474495.1|  PREDICTED: uncharacterized protein LOC102617...    206   5e-63   
ref|XP_008786636.1|  PREDICTED: uncharacterized protein LOC103704909    205   7e-63   Phoenix dactylifera
gb|KJB65468.1|  hypothetical protein B456_010G096500                    205   2e-62   Gossypium raimondii
ref|XP_010047394.1|  PREDICTED: uncharacterized protein LOC104436349    204   2e-62   Eucalyptus grandis [rose gum]
ref|XP_008452785.1|  PREDICTED: uncharacterized protein LOC103493...    204   2e-62   Cucumis melo [Oriental melon]
ref|XP_010917186.1|  PREDICTED: uncharacterized protein LOC105041...    201   2e-61   Elaeis guineensis
ref|XP_006452992.1|  hypothetical protein CICLE_v10010155mg             211   1e-60   
gb|ACN41190.1|  unknown                                                 196   2e-59   Picea sitchensis
gb|AFK45931.1|  unknown                                                 192   1e-58   Lotus japonicus
ref|XP_004157406.1|  PREDICTED: uncharacterized LOC101215279            197   2e-58   
ref|XP_010917187.1|  PREDICTED: uncharacterized protein LOC105041...    192   5e-58   Elaeis guineensis
ref|XP_006849670.1|  hypothetical protein AMTR_s00024p00232320          184   1e-54   Amborella trichopoda
ref|XP_009381399.1|  PREDICTED: uncharacterized protein LOC103969560    184   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT07035.1|  hypothetical protein F775_05309                         181   2e-53   
dbj|BAJ87667.1|  predicted protein                                      179   5e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003574591.1|  PREDICTED: uncharacterized protein LOC100824002    180   7e-53   
gb|EMS67934.1|  hypothetical protein TRIUR3_30141                       177   5e-52   Triticum urartu
gb|AEI28612.1|  hypothetical protein                                    177   6e-52   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006659474.1|  PREDICTED: uncharacterized protein LOC102704354    176   2e-51   Oryza brachyantha
dbj|BAJ89776.1|  predicted protein                                      176   3e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001061973.1|  Os08g0459300                                       174   1e-50   
gb|EEC83682.1|  hypothetical protein OsI_29480                          174   1e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_008389963.1|  PREDICTED: uncharacterized protein LOC103452219    170   1e-49   Malus domestica [apple tree]
ref|XP_008676945.1|  PREDICTED: uncharacterized protein LOC100276...    171   1e-49   
ref|XP_002445606.1|  hypothetical protein SORBIDRAFT_07g022480          170   4e-49   
ref|XP_004973623.1|  PREDICTED: uncharacterized protein LOC101780191    167   9e-48   Setaria italica
ref|NP_001145228.1|  uncharacterized protein LOC100278496 precursor     165   6e-47   
ref|NP_001182878.1|  uncharacterized protein LOC100501150 precursor     165   6e-47   Zea mays [maize]
gb|ADE77277.1|  unknown                                                 162   6e-46   Picea sitchensis
ref|XP_007052411.1|  Ferredoxin-related                                 152   2e-42   
gb|KDP28903.1|  hypothetical protein JCGZ_14674                         150   2e-41   Jatropha curcas
ref|XP_010544350.1|  PREDICTED: uncharacterized protein LOC104816995    149   5e-41   Tarenaya hassleriana [spider flower]
ref|XP_010274581.1|  PREDICTED: uncharacterized protein LOC104609867    148   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010496690.1|  PREDICTED: uncharacterized protein LOC104773737    148   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010496477.1|  PREDICTED: uncharacterized protein LOC104773537    147   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006445473.1|  hypothetical protein CICLE_v10022088mg             147   4e-40   Citrus clementina [clementine]
ref|XP_010269882.1|  PREDICTED: uncharacterized protein LOC104606409    146   6e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010479288.1|  PREDICTED: uncharacterized protein LOC104758161    145   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_003626803.1|  hypothetical protein MTR_8g009260                  144   6e-39   Medicago truncatula
ref|XP_008775950.1|  PREDICTED: uncharacterized protein LOC103696192    143   9e-39   Phoenix dactylifera
gb|KFK42592.1|  hypothetical protein AALP_AA1G015400                    143   1e-38   Arabis alpina [alpine rockcress]
gb|KJB40943.1|  hypothetical protein B456_007G084300                    143   1e-38   Gossypium raimondii
gb|AFK38521.1|  unknown                                                 143   1e-38   Medicago truncatula
ref|XP_010496692.1|  PREDICTED: uncharacterized protein LOC104773739    142   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002320860.2|  hypothetical protein POPTR_0014s04400g             142   3e-38   
ref|XP_011031741.1|  PREDICTED: uncharacterized protein LOC105130770    141   1e-37   Populus euphratica
ref|XP_002526498.1|  conserved hypothetical protein                     140   1e-37   
ref|XP_007218315.1|  hypothetical protein PRUPE_ppa010954mg             140   2e-37   Prunus persica
gb|KHG03665.1|  Lon protease, mitochondrial                             140   2e-37   Gossypium arboreum [tree cotton]
emb|CBI16715.3|  unnamed protein product                                140   3e-37   Vitis vinifera
ref|XP_010661428.1|  PREDICTED: uncharacterized protein LOC100263389    139   3e-37   Vitis vinifera
ref|XP_006576685.1|  PREDICTED: uncharacterized protein LOC100804659    139   3e-37   Glycine max [soybeans]
ref|XP_004510136.1|  PREDICTED: uncharacterized protein LOC101510755    139   4e-37   Cicer arietinum [garbanzo]
gb|KHN10896.1|  hypothetical protein glysoja_041881                     139   7e-37   Glycine soja [wild soybean]
ref|XP_008343981.1|  PREDICTED: uncharacterized protein LOC103406763    139   7e-37   
ref|XP_009119762.1|  PREDICTED: uncharacterized protein LOC103844700    138   9e-37   Brassica rapa
ref|XP_006583506.1|  PREDICTED: uncharacterized protein LOC100820431    138   9e-37   Glycine max [soybeans]
ref|XP_002969463.1|  hypothetical protein SELMODRAFT_440699             140   2e-36   
ref|XP_006418507.1|  hypothetical protein EUTSA_v10008694mg             137   4e-36   Eutrema salsugineum [saltwater cress]
ref|XP_007134369.1|  hypothetical protein PHAVU_010G041900g             137   4e-36   Phaseolus vulgaris [French bean]
ref|XP_008232305.1|  PREDICTED: uncharacterized protein LOC103331461    136   7e-36   Prunus mume [ume]
ref|XP_002961232.1|  hypothetical protein SELMODRAFT_402947             140   8e-36   
ref|XP_002889329.1|  hypothetical protein ARALYDRAFT_470049             135   8e-36   
ref|XP_010934407.1|  PREDICTED: uncharacterized protein LOC105054571    135   1e-35   Elaeis guineensis
ref|XP_011017317.1|  PREDICTED: uncharacterized protein LOC105120708    135   2e-35   Populus euphratica
ref|XP_002301223.2|  hypothetical protein POPTR_0002s13690g             135   2e-35   
ref|XP_010089779.1|  hypothetical protein L484_008029                   134   2e-35   Morus notabilis
emb|CDY15124.1|  BnaC05g00030D                                          134   3e-35   Brassica napus [oilseed rape]
ref|NP_171720.2|  ferredoxin-like protein                               130   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011469540.1|  PREDICTED: uncharacterized protein LOC101295667    129   5e-33   Fragaria vesca subsp. vesca
ref|XP_009603590.1|  PREDICTED: uncharacterized protein LOC104098542    129   5e-33   
ref|XP_006838443.1|  hypothetical protein AMTR_s00002p00129520          129   1e-32   
ref|XP_009767512.1|  PREDICTED: uncharacterized protein LOC104218669    127   1e-32   Nicotiana sylvestris
ref|XP_010691985.1|  PREDICTED: uncharacterized protein LOC104905223    126   4e-32   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP09383.1|  unnamed protein product                                125   8e-32   Coffea canephora [robusta coffee]
ref|XP_011085419.1|  PREDICTED: uncharacterized protein LOC105167410    125   9e-32   Sesamum indicum [beniseed]
ref|XP_010056460.1|  PREDICTED: uncharacterized protein LOC104444487    124   2e-31   Eucalyptus grandis [rose gum]
ref|XP_010056472.1|  PREDICTED: uncharacterized protein LOC104444502    124   2e-31   Eucalyptus grandis [rose gum]
ref|XP_004145028.1|  PREDICTED: uncharacterized protein LOC101213121    124   3e-31   
ref|XP_004160685.1|  PREDICTED: uncharacterized protein LOC101226210    124   4e-31   
ref|XP_009407978.1|  PREDICTED: uncharacterized protein LOC103990...    122   7e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006354640.1|  PREDICTED: uncharacterized protein LOC102586844    123   8e-31   Solanum tuberosum [potatoes]
ref|XP_008460047.1|  PREDICTED: uncharacterized protein LOC103498980    122   8e-31   Cucumis melo [Oriental melon]
ref|XP_009407979.1|  PREDICTED: uncharacterized protein LOC103990...    119   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004229711.1|  PREDICTED: uncharacterized protein LOC101247064    120   1e-29   Solanum lycopersicum
gb|KCW73237.1|  hypothetical protein EUGRSUZ_E01705                     119   1e-29   Eucalyptus grandis [rose gum]
ref|XP_006649217.1|  PREDICTED: uncharacterized protein LOC102710564    115   4e-28   Oryza brachyantha
ref|NP_001048640.1|  Os02g0834300                                       112   1e-26   
gb|EAY88130.1|  hypothetical protein OsI_09566                          111   2e-26   Oryza sativa Indica Group [Indian rice]
gb|EYU40325.1|  hypothetical protein MIMGU_mgv1a013003mg                109   1e-25   Erythranthe guttata [common monkey flower]
ref|NP_001143617.1|  uncharacterized protein LOC100276332               106   2e-25   
ref|XP_006445474.1|  hypothetical protein CICLE_v10022088mg             105   7e-25   
gb|KJB40944.1|  hypothetical protein B456_007G084300                    104   3e-24   Gossypium raimondii
ref|XP_002454855.1|  hypothetical protein SORBIDRAFT_04g038630          100   2e-22   Sorghum bicolor [broomcorn]
ref|NP_001143408.1|  hypothetical protein precursor                   96.3    9e-21   Zea mays [maize]
ref|XP_004954543.1|  PREDICTED: uncharacterized protein LOC101768...  94.7    3e-20   
ref|XP_004954542.1|  PREDICTED: uncharacterized protein LOC101768...  84.7    1e-16   Setaria italica
ref|XP_002438638.1|  hypothetical protein SORBIDRAFT_10g023450        82.4    5e-16   
ref|XP_002452370.1|  hypothetical protein SORBIDRAFT_04g024560        81.6    8e-16   
ref|XP_003570747.1|  PREDICTED: uncharacterized protein LOC100838594  77.4    5e-14   Brachypodium distachyon [annual false brome]
gb|AFK43925.1|  unknown                                               45.8    7e-04   Medicago truncatula



>ref|XP_009790840.1| PREDICTED: uncharacterized protein LOC104238234 isoform X2 [Nicotiana 
sylvestris]
Length=222

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASA-NAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLA  234
            MA  QWFLLLCIFF SASA N Q+KVTDNPADELVA LN+NRT  KL SLYSNPGLACLA
Sbjct  1    MAMAQWFLLLCIFFISASASNVQTKVTDNPADELVAVLNSNRTGNKLSSLYSNPGLACLA  60

Query  235  LQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPS  414
            LQYIKA++G+C AVGG DAKKP +S F ETFAPNC V+ ++LAQITGRFLACQSKY  PS
Sbjct  61   LQYIKAYQGECSAVGGPDAKKPAESEFAETFAPNCDVKASSLAQITGRFLACQSKYAEPS  120

Query  415  QAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            +AF+DILIR  KS DIL SKNHTEVG AVSGSDGGGPYFWCVLFSNGK
Sbjct  121  EAFNDILIRNSKSLDILNSKNHTEVGTAVSGSDGGGPYFWCVLFSNGK  168



>ref|XP_004244165.1| PREDICTED: uncharacterized protein LOC101261728 [Solanum lycopersicum]
Length=224

 Score =   252 bits (644),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASA-NAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLA  234
            MA LQWF LLCIFF SASA   Q+KVTDNPADELV+ALN+NRTA KL SLYSNPGLACLA
Sbjct  1    MAMLQWFPLLCIFFISASAAKVQTKVTDNPADELVSALNSNRTANKLSSLYSNPGLACLA  60

Query  235  LQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPS  414
            LQYIKA+ GDC  VGG D KKP +S F + FAPNCGVQ ++LAQITGRFLACQSKY  PS
Sbjct  61   LQYIKAYGGDCKVVGGPDGKKPAESEFAQEFAPNCGVQASSLAQITGRFLACQSKYAEPS  120

Query  415  QAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            +AF+DILIR  KS DILYSKNHTEVG AVSGS GGGPYFWCVLFSNGK
Sbjct  121  EAFNDILIRNTKSLDILYSKNHTEVGAAVSGSGGGGPYFWCVLFSNGK  168



>ref|XP_009626175.1| PREDICTED: uncharacterized protein LOC104116915 isoform X2 [Nicotiana 
tomentosiformis]
Length=222

 Score =   251 bits (641),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASA-NAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLA  234
            MA  QWFLLLCIFF SASA N Q+KVTDNPADELVA LN+NRT  KL SLYSNPGLACLA
Sbjct  1    MAMAQWFLLLCIFFISASASNVQTKVTDNPADELVAVLNSNRTGNKLSSLYSNPGLACLA  60

Query  235  LQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPS  414
            LQYIKA++G+C AVGG DAKKP +S F ETFAP+C V+ ++LAQITGRFLACQSKY  PS
Sbjct  61   LQYIKAYQGECSAVGGPDAKKPAESEFAETFAPDCDVKASSLAQITGRFLACQSKYAEPS  120

Query  415  QAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            +AF+DILIR  KS DIL SKNHTEVG AVSGSDGGGPYFWCVLFSNGK
Sbjct  121  EAFNDILIRNSKSLDILNSKNHTEVGAAVSGSDGGGPYFWCVLFSNGK  168



>ref|XP_006360119.1| PREDICTED: uncharacterized protein LOC102582458 [Solanum tuberosum]
Length=224

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASA-NAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLA  234
            MA LQ FLLLCIFF SASA   Q+KVTDNPADELV+ALN+NRTA KL SLYSNPGLACLA
Sbjct  1    MAMLQRFLLLCIFFISASAAKVQTKVTDNPADELVSALNSNRTANKLSSLYSNPGLACLA  60

Query  235  LQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPS  414
            LQYIKA+ GDC  VGG D KKP +S F + FAPNCGVQ ++LAQITGRFLACQSKY  PS
Sbjct  61   LQYIKAYGGDCKVVGGPDGKKPAESEFAQEFAPNCGVQASSLAQITGRFLACQSKYAEPS  120

Query  415  QAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            +AF+DILIR  KS DILYSKNHTEVG AVSGS GGGPYFWCVLFSNGK
Sbjct  121  EAFNDILIRNTKSLDILYSKNHTEVGAAVSGSGGGGPYFWCVLFSNGK  168



>ref|XP_009790839.1| PREDICTED: uncharacterized protein LOC104238234 isoform X1 [Nicotiana 
sylvestris]
Length=224

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASA-NAQ--SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLAC  228
            MA  QWFLLLCIFF SASA N Q  +KVTDNPADELVA LN+NRT  KL SLYSNPGLAC
Sbjct  1    MAMAQWFLLLCIFFISASASNVQNTAKVTDNPADELVAVLNSNRTGNKLSSLYSNPGLAC  60

Query  229  LALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVS  408
            LALQYIKA++G+C AVGG DAKKP +S F ETFAPNC V+ ++LAQITGRFLACQSKY  
Sbjct  61   LALQYIKAYQGECSAVGGPDAKKPAESEFAETFAPNCDVKASSLAQITGRFLACQSKYAE  120

Query  409  PSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            PS+AF+DILIR  KS DIL SKNHTEVG AVSGSDGGGPYFWCVLFSNGK
Sbjct  121  PSEAFNDILIRNSKSLDILNSKNHTEVGTAVSGSDGGGPYFWCVLFSNGK  170



>ref|XP_009626174.1| PREDICTED: uncharacterized protein LOC104116915 isoform X1 [Nicotiana 
tomentosiformis]
Length=224

 Score =   246 bits (628),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASA-NAQ--SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLAC  228
            MA  QWFLLLCIFF SASA N Q  +KVTDNPADELVA LN+NRT  KL SLYSNPGLAC
Sbjct  1    MAMAQWFLLLCIFFISASASNVQITAKVTDNPADELVAVLNSNRTGNKLSSLYSNPGLAC  60

Query  229  LALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVS  408
            LALQYIKA++G+C AVGG DAKKP +S F ETFAP+C V+ ++LAQITGRFLACQSKY  
Sbjct  61   LALQYIKAYQGECSAVGGPDAKKPAESEFAETFAPDCDVKASSLAQITGRFLACQSKYAE  120

Query  409  PSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            PS+AF+DILIR  KS DIL SKNHTEVG AVSGSDGGGPYFWCVLFSNGK
Sbjct  121  PSEAFNDILIRNSKSLDILNSKNHTEVGAAVSGSDGGGPYFWCVLFSNGK  170



>ref|XP_011069328.1| PREDICTED: uncharacterized protein LOC105180349 [Sesamum indicum]
Length=225

 Score =   236 bits (603),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   FLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAF  255
            F LLCIFF S SA+ Q+KVTDNPADELVAA+N NRTA K   LYSNPGLAC+ALQYIKAF
Sbjct  8    FYLLCIFFISVSASVQNKVTDNPADELVAAINANRTASKSSGLYSNPGLACIALQYIKAF  67

Query  256  EGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDIL  435
            +GDC  VGG  AK+P DS F ETFAPNCGV+V+TLA ITGR L CQSKYV PS+AFS+IL
Sbjct  68   QGDCSVVGGPKAKRPADSEFAETFAPNCGVEVSTLAPITGRLLGCQSKYVKPSEAFSEIL  127

Query  436  IRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            ++ +KS +I++SKNH+E+G AVSGSDGG PYFWCVLFS+GKS
Sbjct  128  MKNEKSLEIVHSKNHSEMGAAVSGSDGGAPYFWCVLFSSGKS  169



>gb|EYU20297.1| hypothetical protein MIMGU_mgv1a013416mg [Erythranthe guttata]
Length=221

 Score =   231 bits (589),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANA-QSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLA  234
            MA   W  +LCI F SAS++A Q+KVT+NPADELV+++NNNRTA K  SLYSNPGLACLA
Sbjct  1    MANFMWTPVLCILFISASSSALQNKVTNNPADELVSSINNNRTASKSSSLYSNPGLACLA  60

Query  235  LQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPS  414
            LQYIKA++GDC +VGG++AK+P DS F E+FAPNCGV+V+TL+ ITGR LACQSKYV PS
Sbjct  61   LQYIKAYKGDCSSVGGTNAKRPADSEFTESFAPNCGVEVSTLSPITGRLLACQSKYVEPS  120

Query  415  QAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
             AFSDIL++  +S +I+ SKNH+EVG AVSGSDGGGPYFWCVLFSNGKS
Sbjct  121  VAFSDILMKNARSVEIVQSKNHSEVGAAVSGSDGGGPYFWCVLFSNGKS  169



>ref|XP_006577760.1| PREDICTED: uncharacterized protein LOC100305941 isoform X1 [Glycine 
max]
Length=227

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +1

Query  55   TMAFLQWFLL--LCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLAC  228
            T     WFLL  L   +  A+AN Q K+T+NPAD+LVAA+N NRTA K+ +L  NPGLAC
Sbjct  2    TKTMTMWFLLVSLSFIYAVATANTQIKITNNPADKLVAAINENRTAHKVSALTDNPGLAC  61

Query  229  LALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVS  408
            +ALQYIKA++G+CDAVGGSD KKPP+S F E FAPNCGV+ +TLA ITGRFLACQ+KYV 
Sbjct  62   IALQYIKAYQGECDAVGGSDGKKPPESHFAEVFAPNCGVEASTLAPITGRFLACQTKYVH  121

Query  409  PSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
              +AFSDILIR QKS DILYSKNHT+VG AV+G+DGG PYFWCVLFS+GK
Sbjct  122  APEAFSDILIRNQKSIDILYSKNHTQVGAAVTGTDGGSPYFWCVLFSSGK  171



>ref|NP_001235274.1| uncharacterized protein LOC100305941 precursor [Glycine max]
 gb|ACU13869.1| unknown [Glycine max]
Length=217

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +1

Query  55   TMAFLQWFLL--LCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLAC  228
            T     WFLL  L   +  A+AN Q K+T+NPAD+LVAA+N NRTA K+ +L  NPGLAC
Sbjct  2    TKTMTMWFLLVSLSFIYAVATANTQIKITNNPADKLVAAINENRTAHKVSALTDNPGLAC  61

Query  229  LALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVS  408
            +ALQYIKA++G+CDAVGGSD KKPP+S F E FAPNCGV+ +TLA ITGRFLACQ+KYV 
Sbjct  62   IALQYIKAYQGECDAVGGSDGKKPPESHFAEVFAPNCGVEASTLAPITGRFLACQTKYVH  121

Query  409  PSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
              +AFSDILIR QKS DILYSKNHT+VG AV+G+DGG PYFWCVLFS+GK
Sbjct  122  APEAFSDILIRNQKSIDILYSKNHTQVGAAVTGTDGGSPYFWCVLFSSGK  171



>ref|XP_011081601.1| PREDICTED: uncharacterized protein LOC105164610 [Sesamum indicum]
Length=223

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLAL  237
            MA   W L+L I F SASA+ Q+KVTDNPAD+LVAA+N+NRTA K  SLYSNPGLAC+AL
Sbjct  1    MASSIWVLVLAILFISASASVQNKVTDNPADQLVAAINSNRTASKSSSLYSNPGLACIAL  60

Query  238  QYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQ  417
            QYIKA++G+C AVGG +AKKP DS F +TFAPNCGV+++TL  ITGR L CQS YV PS 
Sbjct  61   QYIKAYQGECGAVGGPNAKKPADSEFADTFAPNCGVEISTLTPITGRLLGCQSNYVKPSV  120

Query  418  AFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            AFS+IL++ +KS +IL SKNH EVG AVSGSDGGGPYFWCVLFSNGKS
Sbjct  121  AFSEILMKNEKSIEILQSKNHLEVGAAVSGSDGGGPYFWCVLFSNGKS  168



>ref|XP_004303460.1| PREDICTED: uncharacterized protein LOC101299313 [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLAL  237
            MA   W LL  +   S SA  Q KVT+NPADELVA LN NRTA K PSLY NPGLAC+AL
Sbjct  1    MAMTTWVLLASLLVVSVSAATQMKVTNNPADELVAVLNANRTAHKSPSLYDNPGLACIAL  60

Query  238  QYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQ  417
            QYIKA+EGDC AVGG DAKKP DS FVE FAP CGVQV+TL+ ITGR L C++KYV  ++
Sbjct  61   QYIKAYEGDCGAVGGPDAKKPADSEFVEAFAPTCGVQVSTLSPITGRLLGCETKYVPAAE  120

Query  418  AFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            AFS+ILI   KS DILY+KNHTEVG AVSGSDGG PYFWCVLFS GK+
Sbjct  121  AFSNILIESNKSLDILYNKNHTEVGAAVSGSDGGSPYFWCVLFSGGKT  168



>emb|CDP13469.1| unnamed protein product [Coffea canephora]
Length=225

 Score =   226 bits (575),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +1

Query  58   MAFLQWFLL-LCIFFTSA-SANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACL  231
            MA   W LL  CIFF SA +A  Q+KVTDNPAD+LV ALN+NRTA K  SLYSNPGLAC+
Sbjct  1    MATQTWLLLGCCIFFISAEAATLQNKVTDNPADQLVTALNSNRTAHKSSSLYSNPGLACI  60

Query  232  ALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSP  411
            ALQYIKA++GDC+ VGG +AKKP D  F ETFAPNCGV+V TL  ITGR L C++KYV P
Sbjct  61   ALQYIKAYQGDCNEVGGPNAKKPADGEFAETFAPNCGVEVKTLGPITGRLLGCETKYVKP  120

Query  412  SQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
             +AFS IL++  KS +ILYSKNHTEVG AVSGSDGG PYFWCVLFSNG S
Sbjct  121  DEAFSGILMKNSKSVEILYSKNHTEVGAAVSGSDGGSPYFWCVLFSNGTS  170



>ref|XP_008220571.1| PREDICTED: uncharacterized protein LOC103320642 [Prunus mume]
Length=223

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLAL  237
            MA   WFLL+ +   SA+A  Q KVT+NPADELV+ +N+NRTA K  +LY NPGLAC+AL
Sbjct  1    MAKSTWFLLVSLLVVSAAAATQIKVTNNPADELVSVINSNRTAHKASTLYDNPGLACIAL  60

Query  238  QYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQ  417
            QYIKA++G+C AVGG DAKKPP+S F ETFAPNCGV  +TL  ITGR L CQSKYV PS 
Sbjct  61   QYIKAYQGECSAVGGDDAKKPPESEFAETFAPNCGVLASTLTPITGRLLGCQSKYVPPSD  120

Query  418  AFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            AFS ILI   KS +ILY+KNHTEVG AVSGSD G PYFWCVLFS+GK+
Sbjct  121  AFSKILIENSKSLEILYNKNHTEVGAAVSGSDRGSPYFWCVLFSSGKA  168



>ref|XP_003526059.1| PREDICTED: uncharacterized protein LOC100789560 [Glycine max]
 gb|KHN32171.1| hypothetical protein glysoja_035264 [Glycine soja]
Length=227

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +1

Query  70   QWFLLLCIFFT--SASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQY  243
             WFLL+ + F   +A+AN Q KVT+NPAD+LV A+N NRTA K+ +L  NPGLAC+ALQY
Sbjct  7    MWFLLVTLSFVYAAATANTQIKVTNNPADKLVVAINENRTAHKVSALTDNPGLACIALQY  66

Query  244  IKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAF  423
            IKA++G+CDAVGGSD KKPP+S F E FAPNCGV+ +TLA ITGRFLACQ+KYV   +AF
Sbjct  67   IKAYQGECDAVGGSDGKKPPESRFAEVFAPNCGVEASTLAPITGRFLACQTKYVHAPEAF  126

Query  424  SDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            SDILIR Q+S DILY+ NHT+VG AV+G+DGG PYFWCVLFS+GK
Sbjct  127  SDILIRNQQSLDILYNNNHTQVGAAVTGTDGGSPYFWCVLFSSGK  171



>emb|CDP06333.1| unnamed protein product [Coffea canephora]
Length=225

 Score =   224 bits (571),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +1

Query  58   MAFLQWFLL-LCIFFTSA-SANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACL  231
            MA   W LL  CIFF SA +A  Q+KVTDNPAD+LVAALN+NRTA K  +LYSNPGLAC+
Sbjct  1    MATQTWLLLGCCIFFISAEAATLQNKVTDNPADQLVAALNSNRTAHKSSTLYSNPGLACI  60

Query  232  ALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSP  411
            ALQYIKA++GDC+ VGG +AKKP D  F E FAPNCGV+V TL  ITGR L C++KYV P
Sbjct  61   ALQYIKAYQGDCNEVGGPNAKKPADGEFAEIFAPNCGVEVKTLGPITGRLLGCETKYVKP  120

Query  412  SQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
             +AFS IL++  KS +ILYSKNHTEVG AVSGSDGG PYFWCVLFSNG S
Sbjct  121  DEAFSGILMKNSKSVEILYSKNHTEVGAAVSGSDGGSPYFWCVLFSNGTS  170



>ref|XP_008377828.1| PREDICTED: uncharacterized protein LOC103440909 [Malus domestica]
Length=233

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = +1

Query  73   WFLLLC--IFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYI  246
            WFL L   +   SASA  Q KVT+NPAD+LV  +N+NRTA K  SLY N GLAC+ALQYI
Sbjct  7    WFLFLVASVLIVSASAGTQIKVTNNPADKLVDIINSNRTAHKASSLYDNQGLACIALQYI  66

Query  247  KAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFS  426
            KA++GDCDAVGGSDAKKPPDS+F ETFAPNCGVQ +TLA ITGR + CQSKYV   +AFS
Sbjct  67   KAYQGDCDAVGGSDAKKPPDSAFAETFAPNCGVQTSTLAPITGRLIGCQSKYVHADEAFS  126

Query  427  DILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
             ILI   K+ DILY KNHTEVG A SGSDGG PYFWCVLFS+GK+
Sbjct  127  KILIENSKALDILYDKNHTEVGAAASGSDGGAPYFWCVLFSSGKT  171



>ref|XP_003603211.1| hypothetical protein MTR_3g105080 [Medicago truncatula]
 gb|AES73462.1| ferredoxin-like protein [Medicago truncatula]
Length=229

 Score =   224 bits (570),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 137/169 (81%), Gaps = 8/169 (5%)
 Frame = +1

Query  76   FLLLCIFFT--------SASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACL  231
            F L C+FF         ++++  Q K+TDNPAD+LVAA+N NRTA K  SL+ NPGLACL
Sbjct  5    FTLCCLFFILSFLLGLGASTSATQIKITDNPADKLVAAINENRTAHKDSSLFDNPGLACL  64

Query  232  ALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSP  411
            ALQYIKA++GDC AVGGSDAKKPP+S F E FAPNCGV+ +TLA+ITGRFL CQ+KYV  
Sbjct  65   ALQYIKAYQGDCGAVGGSDAKKPPESQFAEAFAPNCGVKASTLARITGRFLGCQTKYVHA  124

Query  412  SQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
             +AFS+ILIR +KS DILYSKNHT+VG AV+G+DGG PYFWCVLFSNGK
Sbjct  125  PEAFSEILIRNEKSLDILYSKNHTQVGAAVTGTDGGSPYFWCVLFSNGK  173



>ref|XP_007222204.1| hypothetical protein PRUPE_ppa009735mg [Prunus persica]
 gb|EMJ23403.1| hypothetical protein PRUPE_ppa009735mg [Prunus persica]
Length=280

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLAL  237
            MA   WFLL+ +   SA+A  Q KVTDNPADELV+ +N+NRTA K  +LY NPGLAC+AL
Sbjct  1    MAKSTWFLLVSLLVVSAAAATQIKVTDNPADELVSVINSNRTAHKASTLYDNPGLACIAL  60

Query  238  QYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQ  417
            QYIKA++ DC AVGG+DAKKP +S F ETFAPNCGV  +TL  ITGR L CQSKYV PS+
Sbjct  61   QYIKAYQSDCSAVGGTDAKKPLESEFAETFAPNCGVLASTLTPITGRLLGCQSKYVPPSE  120

Query  418  AFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            AFS ILI   KS +ILY+KNHTEVG AVSGSDGG PYFWCVLFS+GK+
Sbjct  121  AFSKILIENSKSLEILYNKNHTEVGAAVSGSDGGSPYFWCVLFSSGKT  168



>gb|ACU20606.1| unknown [Glycine max]
Length=227

 Score =   221 bits (564),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = +1

Query  70   QWFLLLCIFFT--SASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQY  243
             WFLL+ + F   +A+AN Q KVT+NPAD+LV A+N +RTA K+ +L  NPGLAC+ALQY
Sbjct  7    MWFLLVTLSFVYAAATANTQIKVTNNPADKLVVAINEDRTAHKVSALTDNPGLACIALQY  66

Query  244  IKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAF  423
            IKA++G+CDAVGGSD KKPP+S F E FAPNCGV+ + LA ITGRFLACQ+KYV   +AF
Sbjct  67   IKAYQGECDAVGGSDGKKPPESRFAEVFAPNCGVEASALAPITGRFLACQTKYVHAPEAF  126

Query  424  SDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            SDILIR Q+S DILY+ NHT+VG AV+G+DGG PYFWCVLFS+GK
Sbjct  127  SDILIRNQQSLDILYNNNHTQVGAAVTGTDGGSPYFWCVLFSSGK  171



>ref|XP_002281459.1| PREDICTED: uncharacterized protein LOC100257849 [Vitis vinifera]
Length=228

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +1

Query  112  ANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDA  291
            A+    VTDNPADELVA LNNNRTA K  +LY NPGLAC+ALQYIKA++G C  VGG DA
Sbjct  25   ADTHKSVTDNPADELVATLNNNRTAHKESALYDNPGLACIALQYIKAYQGSCGEVGGEDA  84

Query  292  KKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYS  471
            KKP +S F ETFAPNCGVQV+TL QITGR L C++KYVSP++AFS+IL++  KS +ILYS
Sbjct  85   KKPAESQFAETFAPNCGVQVSTLTQITGRLLGCETKYVSPAEAFSEILMKNSKSLEILYS  144

Query  472  KNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            KNHTE+G AVSGSDGG PYFWCVLFSNGKS
Sbjct  145  KNHTELGAAVSGSDGGAPYFWCVLFSNGKS  174



>gb|KHG15497.1| Pathogenesis-related PR-1 type [Gossypium arboreum]
Length=220

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 134/167 (80%), Gaps = 3/167 (2%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLAL  237
            MA + W L     F S SAN Q+KVTDNPADELVAALN NRTA K  +L  NPGLAC+AL
Sbjct  1    MAMVLWLLFSPFLFLSVSANTQTKVTDNPADELVAALNANRTAHKSSALTDNPGLACIAL  60

Query  238  QYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQ  417
            QYIKA++GDC AVG  +AKKP DS F ETFAPNCGV+ +TL+ ITGR L CQSKYV PS+
Sbjct  61   QYIKAYQGDCKAVG--EAKKPADSEFSETFAPNCGVEASTLSPITGRLLGCQSKYVEPSE  118

Query  418  AFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            AFS +L++ +KS +ILY+KNHTEVG  V+GSDGGGPYFWCVLFSNGK
Sbjct  119  AFS-MLMKNEKSLEILYNKNHTEVGAGVTGSDGGGPYFWCVLFSNGK  164



>ref|XP_010261903.1| PREDICTED: uncharacterized protein LOC104600570 isoform X2 [Nelumbo 
nucifera]
Length=215

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 130/167 (78%), Gaps = 6/167 (4%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLAL  237
            MA + WFL++ + F SASA+      DNPADELV+ LN+NRTA K  +L+ NPGL C+AL
Sbjct  1    MAVVTWFLVVALLFVSASAD------DNPADELVSILNSNRTAHKSTALFDNPGLGCIAL  54

Query  238  QYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQ  417
            QYIKA++G CD VGGSDAKKP D+ F ETFAPNCGVQ +TL  ITGR L CQSKYV  S+
Sbjct  55   QYIKAYQGRCDDVGGSDAKKPADAEFAETFAPNCGVQASTLGPITGRLLGCQSKYVGASE  114

Query  418  AFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            AFS +LI   KS +ILYS NHTEVG AVSG+DGG PYFWCVLFSNGK
Sbjct  115  AFSGLLIHNSKSLEILYSSNHTEVGAAVSGTDGGAPYFWCVLFSNGK  161



>ref|XP_004501432.1| PREDICTED: uncharacterized protein LOC101501292 [Cicer arietinum]
Length=230

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 131/170 (77%), Gaps = 5/170 (3%)
 Frame = +1

Query  64   FLQWFLLLCIFF-----TSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLAC  228
            F  W LL  + F       A+A+ Q KV +NPAD+LVAALN NRTA K  SL  NPGLAC
Sbjct  5    FTVWSLLFILSFLHAASMGATADTQIKVANNPADKLVAALNENRTAHKDSSLTDNPGLAC  64

Query  229  LALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVS  408
            LALQYIKA++GDC AVGG DAKKP +S F E FAP CGVQ +TLA ITGRFL CQ+KYV 
Sbjct  65   LALQYIKAYQGDCGAVGGPDAKKPTESQFAEVFAPTCGVQASTLAPITGRFLGCQTKYVH  124

Query  409  PSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
              +AFS+ILIR QKS DILYSKNHT+VG AV+G+DGG PYFWCVLFSNGK
Sbjct  125  APEAFSEILIRNQKSLDILYSKNHTQVGAAVTGTDGGSPYFWCVLFSNGK  174



>ref|XP_010261902.1| PREDICTED: uncharacterized protein LOC104600570 isoform X1 [Nelumbo 
nucifera]
Length=217

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLAL  237
            MA + WFL++ + F SASA+ +    +NPADELV+ LN+NRTA K  +L+ NPGL C+AL
Sbjct  1    MAVVTWFLVVALLFVSASADGK----NNPADELVSILNSNRTAHKSTALFDNPGLGCIAL  56

Query  238  QYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQ  417
            QYIKA++G CD VGGSDAKKP D+ F ETFAPNCGVQ +TL  ITGR L CQSKYV  S+
Sbjct  57   QYIKAYQGRCDDVGGSDAKKPADAEFAETFAPNCGVQASTLGPITGRLLGCQSKYVGASE  116

Query  418  AFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            AFS +LI   KS +ILYS NHTEVG AVSG+DGG PYFWCVLFSNGK
Sbjct  117  AFSGLLIHNSKSLEILYSSNHTEVGAAVSGTDGGAPYFWCVLFSNGK  163



>ref|XP_010527500.1| PREDICTED: uncharacterized protein LOC104804836 [Tarenaya hassleriana]
Length=227

 Score =   216 bits (551),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +1

Query  103  SASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGG  282
            S+SA+ QS+VTDNPADELV  LN NRTA K PSLY++PGLACLALQYIKA++G+CDAVGG
Sbjct  18   SSSASIQSRVTDNPADELVEVLNKNRTANKEPSLYNHPGLACLALQYIKAYQGNCDAVGG  77

Query  283  SDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDI  462
            S+AKKP DS F ETFAPNC V  +TL+ ITGR L CQ+KY+ P++AFS IL+R Q+  +I
Sbjct  78   SNAKKPSDSLFAETFAPNCRVDASTLSPITGRLLGCQTKYIQPAEAFSQILMRNQRGLEI  137

Query  463  LYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            LY KNHTE+G AVSGSDGG PYFWCVLFSNGK
Sbjct  138  LYDKNHTELGAAVSGSDGGSPYFWCVLFSNGK  169



>gb|KJB54600.1| hypothetical protein B456_009G040600 [Gossypium raimondii]
Length=220

 Score =   216 bits (550),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 134/167 (80%), Gaps = 3/167 (2%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLAL  237
            MA + W L     F S SAN Q+KVTDNPADELVAALN NRTA K  +L  NPGLAC+AL
Sbjct  1    MAMVLWLLFSPFLFLSVSANTQTKVTDNPADELVAALNANRTAHKSSALTDNPGLACIAL  60

Query  238  QYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQ  417
            QYIKA++GDC AVG  +AKKP DS F ETFAP+CGV+ +TL+ ITGR L CQSKYV PS+
Sbjct  61   QYIKAYQGDCKAVG--EAKKPADSEFAETFAPDCGVEASTLSPITGRLLGCQSKYVKPSE  118

Query  418  AFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            AFS +L++ +KS +ILY+KNHTEVG  V+GSDGGGPYFWCVLFSNGK
Sbjct  119  AFS-MLMKNEKSLEILYNKNHTEVGAGVTGSDGGGPYFWCVLFSNGK  164



>ref|XP_009334743.1| PREDICTED: uncharacterized protein LOC103927528, partial [Pyrus 
x bretschneideri]
Length=220

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   IFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCD  270
            +   SASA  Q KVT+NPAD+LV  +N+NRTA K  SLY N GLAC+ALQYIKA++GDCD
Sbjct  2    VLIVSASAGTQIKVTNNPADKLVDIINSNRTAHKASSLYDNQGLACIALQYIKAYQGDCD  61

Query  271  AVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQK  450
            AVGGSDAKKPPDS+F ETFAPNCGVQ +TLA ITGR + CQSKYV   +AFS ILI   K
Sbjct  62   AVGGSDAKKPPDSAFAETFAPNCGVQTSTLAPITGRLIGCQSKYVHADEAFSKILIENSK  121

Query  451  SFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            + DILY+KNHTEVG AVSGSDGGG YFWCVLFS+GK+
Sbjct  122  ALDILYNKNHTEVGAAVSGSDGGGSYFWCVLFSSGKT  158



>ref|XP_011016636.1| PREDICTED: uncharacterized protein LOC105120142 [Populus euphratica]
Length=224

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 132/153 (86%), Gaps = 2/153 (1%)
 Frame = +1

Query  106  ASANAQ--SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVG  279
            ASA+ Q  ++VTDNPAD+LVAALN+NRTAKK  +LY NPGL C+ALQYIKA++GDC+ VG
Sbjct  16   ASAHIQYVARVTDNPADQLVAALNDNRTAKKESTLYDNPGLGCIALQYIKAYQGDCNVVG  75

Query  280  GSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFD  459
            G DAKKP DS F +TFAPNCGV  +TL+QITGR +ACQSKYV PS+AFS+IL++  KS +
Sbjct  76   GDDAKKPSDSQFADTFAPNCGVTASTLSQITGRLVACQSKYVEPSKAFSEILMKDSKSLE  135

Query  460  ILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            IL++KNHTEVG AV+G+DGG PYFWCVLFSNGK
Sbjct  136  ILHNKNHTEVGAAVTGTDGGAPYFWCVLFSNGK  168



>ref|XP_007136885.1| hypothetical protein PHAVU_009G082100g [Phaseolus vulgaris]
 gb|ESW08879.1| hypothetical protein PHAVU_009G082100g [Phaseolus vulgaris]
Length=228

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  73   WFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKA  252
            + LL   F   A+A+ Q KVT+NPAD+LVAA+N NRTA K+ +L  NPGLAC+ALQYIKA
Sbjct  9    YLLLTLSFVYVATADTQIKVTNNPADKLVAAINENRTAHKVSALTDNPGLACIALQYIKA  68

Query  253  FEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDI  432
            ++G+C  VGGSD KKPP+S F E FAPNCGV+ +TLA +TGRFL CQ+KYV   +AFS+I
Sbjct  69   YQGNCGDVGGSDGKKPPESQFAEVFAPNCGVKASTLAPMTGRFLGCQTKYVHAPEAFSEI  128

Query  433  LIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            LIR QKS DILYSKNHT++G AV+G+DGG PYFWCVLFS+GK
Sbjct  129  LIRNQKSLDILYSKNHTQLGAAVTGTDGGSPYFWCVLFSSGK  170



>gb|KHN29678.1| hypothetical protein glysoja_016300 [Glycine soja]
Length=242

 Score =   216 bits (550),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 142/187 (76%), Gaps = 12/187 (6%)
 Frame = +1

Query  7    RCSTASSHFP---SLSNLPTMAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNN  177
            R ST S   P    L  LP +A L  FL+L +           K+T+NPAD+LVAA+N N
Sbjct  9    RNSTISEWIPLKLGLYALPCLA-LPCFLILSLRLL--------KITNNPADKLVAAINEN  59

Query  178  RTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNT  357
            RTA K+ +L  NPGLAC+ALQYIKA++G+CDAVGGSD KKPP+S F E FAPNCGV+ +T
Sbjct  60   RTAHKVSALTDNPGLACIALQYIKAYQGECDAVGGSDGKKPPESHFAEVFAPNCGVEAST  119

Query  358  LAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWC  537
            LA ITGRFLACQ+KYV   +AFSDILIR QKS DILYSKNHT+VG AV+G+DGG PYFWC
Sbjct  120  LAPITGRFLACQTKYVHAPEAFSDILIRNQKSIDILYSKNHTQVGAAVTGTDGGSPYFWC  179

Query  538  VLFSNGK  558
            VLFS+GK
Sbjct  180  VLFSSGK  186



>ref|XP_002516139.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46141.1| conserved hypothetical protein [Ricinus communis]
Length=221

 Score =   216 bits (549),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +1

Query  112  ANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDA  291
            AN Q KVTDNPADELV  LN+NRTA K  SLY NPGLAC+ALQYIKA++GDC AVGG+DA
Sbjct  17   ANTQIKVTDNPADELVTVLNSNRTAHKESSLYDNPGLACIALQYIKAYQGDCGAVGGTDA  76

Query  292  KKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYS  471
            KKP +S F ETFAP CGV V+TL  ITGR L C+SKYV+P++AFS+IL++  KS +ILY 
Sbjct  77   KKPAESEFTETFAPACGVTVSTLTPITGRLLGCESKYVNPAEAFSEILMKNSKSLEILYD  136

Query  472  KNHTEvggavsgsdgggPYFWCVLFSNGK  558
            KNHTEVG AV+G+DGG PYFWCVLFSNGK
Sbjct  137  KNHTEVGAAVTGTDGGSPYFWCVLFSNGK  165



>gb|KDP34029.1| hypothetical protein JCGZ_07600 [Jatropha curcas]
Length=222

 Score =   213 bits (543),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = +1

Query  103  SASANAQS--KVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAV  276
            SASAN  +  KVTDNPADELVA L +NRTA K  +LY NPGLAC+ALQYIKA++GDC AV
Sbjct  14   SASANFHNVVKVTDNPADELVAVLTSNRTAHKGSTLYDNPGLACIALQYIKAYQGDCGAV  73

Query  277  GGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSF  456
            GG DAKKP +S F ETFAP CGV V+TL  ITGR LACQSKYV P++AFSDIL++  KS 
Sbjct  74   GGPDAKKPAESEFAETFAPTCGVTVSTLTPITGRLLACQSKYVDPAEAFSDILMKNSKSL  133

Query  457  DILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            +ILY KNHTEVG AV+G+DGG PYFWCVLFSNGK
Sbjct  134  EILYDKNHTEVGAAVTGTDGGSPYFWCVLFSNGK  167



>ref|XP_010098369.1| hypothetical protein L484_018601 [Morus notabilis]
 gb|EXB74893.1| hypothetical protein L484_018601 [Morus notabilis]
Length=224

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = +1

Query  109  SANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSD  288
            ++N   KVTDNPAD+LVA ++ NRTA K  SLYSN GLAC+ALQYIKA++GDC AVGGSD
Sbjct  20   ASNTHVKVTDNPADQLVAEIDANRTAHKSSSLYSNQGLACIALQYIKAYQGDCGAVGGSD  79

Query  289  AKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILY  468
            AKKP DS F ETFAPNCGV+V+TL+ +TGR L CQS YVSP +AFS+IL++ +KS +I+Y
Sbjct  80   AKKPSDSLFAETFAPNCGVEVSTLSPLTGRLLGCQSHYVSPQKAFSEILMKNEKSLEIVY  139

Query  469  SKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            SKNHTEVG AVSGSDGGGPYFWCVLFS GK
Sbjct  140  SKNHTEVGAAVSGSDGGGPYFWCVLFSGGK  169



>gb|KDO73630.1| hypothetical protein CISIN_1g027565mg [Citrus sinensis]
Length=222

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  109  SANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSD  288
            SAN Q KVT+NPADELVA LN+NRTA K  SL+ NPGLAC+ALQYIKA+EG CD VGG  
Sbjct  17   SANTQIKVTNNPADELVAVLNSNRTAHKESSLHDNPGLACIALQYIKAYEGHCDDVGGPK  76

Query  289  AKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILY  468
            AK+P  S F +TFAPNCGV  ++L QITGR L CQS+YV  S+AFSDIL++ +KS DILY
Sbjct  77   AKRPAASEFADTFAPNCGVLSSSLTQITGRLLGCQSRYVHASEAFSDILMKNEKSLDILY  136

Query  469  SKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            SKNHTEVG AVSG+DGG PYFWCVLFSNGK
Sbjct  137  SKNHTEVGAAVSGTDGGAPYFWCVLFSNGK  166



>ref|XP_006474494.1| PREDICTED: uncharacterized protein LOC102617951 isoform X1 [Citrus 
sinensis]
Length=222

 Score =   211 bits (538),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  109  SANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSD  288
            SAN Q KVT+NPADELVA LN+NRTA K  SL+ NPGLAC+ALQYIKA+EG CD VGG  
Sbjct  17   SANTQIKVTNNPADELVAVLNSNRTAHKESSLHDNPGLACIALQYIKAYEGHCDDVGGPK  76

Query  289  AKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILY  468
            AK+P  S F +TFAPNCGV  ++L QITGR L CQS+YV  S+AFSDIL++ +KS DILY
Sbjct  77   AKRPAASEFADTFAPNCGVLSSSLTQITGRLLGCQSRYVHASEAFSDILMKNEKSLDILY  136

Query  469  SKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            SKNHTEVG AVSG+DGG PYFWCVLFSNGK
Sbjct  137  SKNHTEVGAAVSGTDGGAPYFWCVLFSNGK  166



>ref|XP_010669319.1| PREDICTED: uncharacterized protein LOC104886563 [Beta vulgaris 
subsp. vulgaris]
Length=229

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   IFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCD  270
            +FF++ + + QSKVT+NPAD+LVA LN+NRTA  L +LYSNPGLAC+ALQYIKA+EG CD
Sbjct  18   LFFSATATDTQSKVTNNPADQLVAILNDNRTAHHLTALYSNPGLACIALQYIKAYEGSCD  77

Query  271  AVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQK  450
             VGG  AKKP DS+F ETFAP C V+  TL QITGRFL CQS+Y+ P +AFS++L++ +K
Sbjct  78   DVGGPKAKKPEDSAFSETFAPECNVEPATLTQITGRFLGCQSEYIKPDRAFSELLMKDEK  137

Query  451  SFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            S +IL SKNH+EVG AVSGS+GG PYFWCVLFSNGKS
Sbjct  138  SLNILNSKNHSEVGAAVSGSEGGSPYFWCVLFSNGKS  174



>gb|ABK93415.1| unknown [Populus trichocarpa]
Length=179

 Score =   210 bits (534),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            ++VTDNPAD+LVAALN+NRTAKK  +LY NPGL C+ALQYIKA++GDC  VGG DAKKP 
Sbjct  24   ARVTDNPADQLVAALNDNRTAKKESTLYDNPGLGCIALQYIKAYQGDCSVVGGDDAKKPF  83

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            +S F +TFAPNCGV  +TL+QITGR +ACQSKYV PS+AFS+IL++  KS +IL++KNHT
Sbjct  84   ESQFADTFAPNCGVIASTLSQITGRLVACQSKYVEPSKAFSEILMKDSKSLEILHNKNHT  143

Query  484  EvggavsgsdgggPYFWCVLFSNG  555
            EVG AV+G+DGG PYFWCVLFSNG
Sbjct  144  EVGAAVTGTDGGAPYFWCVLFSNG  167



>ref|XP_007012420.1| Ferredoxin-related [Theobroma cacao]
 gb|EOY30039.1| Ferredoxin-related [Theobroma cacao]
Length=222

 Score =   211 bits (536),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLAL  237
            MA + W LL    F S SAN Q+KVTDNPADELVAALN NRTA K  SL  NPGLAC+AL
Sbjct  1    MAMILWLLLPPFLFLSVSANTQTKVTDNPADELVAALNANRTAHKSSSLTDNPGLACIAL  60

Query  238  QYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQ  417
            QYIKA++GDCDAVGG DAKKP DS F ETFAPNCGV  +TL+ IT R L CQSKYV P +
Sbjct  61   QYIKAYQGDCDAVGGPDAKKPADSEFAETFAPNCGVDASTLSPITSRLLGCQSKYVQPPE  120

Query  418  AFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            AFS +L++ +KS +ILY+KNHTEVG AV+G+DGG P+FWCVLFS+GK
Sbjct  121  AFS-MLMKNEKSLEILYNKNHTEVGAAVTGTDGGAPFFWCVLFSSGK  166



>ref|XP_004141344.1| PREDICTED: uncharacterized protein LOC101215279 [Cucumis sativus]
 gb|KGN55378.1| hypothetical protein Csa_4G648000 [Cucumis sativus]
Length=224

 Score =   211 bits (536),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   LQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYI  246
            + W+LL C  F S  +   S VTDNPAD+LV  LN NRTA KL  L  NPGLACLALQYI
Sbjct  5    ILWYLLFCALFVSVFSAGDSNVTDNPADKLVVVLNKNRTAHKLSPLKDNPGLACLALQYI  64

Query  247  KAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFS  426
            KA++G C+AVGG D  KPP+S+F ETFAPNCGV V++LA ITGR L CQSKYV   +AFS
Sbjct  65   KAYQGKCEAVGGPDGMKPPNSAFAETFAPNCGVVVSSLAPITGRLLGCQSKYVHAPEAFS  124

Query  427  DILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            D+L+   KS +ILY KN+TEVG AV+G+DGG PYFWCVLFSNG +
Sbjct  125  DVLMENNKSLEILYYKNNTEVGAAVTGTDGGSPYFWCVLFSNGTT  169



>ref|XP_008452786.1| PREDICTED: uncharacterized protein LOC103493701 isoform X2 [Cucumis 
melo]
Length=224

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = +1

Query  67   LQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYI  246
            + W+LL    F S  +   S VTDNPAD+LVA LN NRTA KL  L  NPGLACLALQYI
Sbjct  5    ILWYLLFSALFVSVFSAGDSNVTDNPADKLVAVLNKNRTAHKLSPLKDNPGLACLALQYI  64

Query  247  KAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFS  426
            KA++G C+AVGG D  KPP+S+F ETFAPNCGV V++LA ITGR L CQSKYV   +AFS
Sbjct  65   KAYQGKCEAVGGPDGMKPPNSAFAETFAPNCGVVVSSLAPITGRLLGCQSKYVHAPEAFS  124

Query  427  DILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            D+L+   KS +ILY KN+TEVG AV+G+DGG PYFWCVLFSNG +
Sbjct  125  DVLMENNKSLEILYYKNNTEVGAAVTGTDGGSPYFWCVLFSNGST  169



>ref|XP_002309466.1| hypothetical protein POPTR_0006s23730g [Populus trichocarpa]
 gb|EEE92989.1| hypothetical protein POPTR_0006s23730g [Populus trichocarpa]
Length=224

 Score =   209 bits (531),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            ++VTDNPAD+LVAALN+NRTAKK  +LY NPGL C+ALQYIKA++GDC  VGG DAKKP 
Sbjct  24   ARVTDNPADQLVAALNDNRTAKKESTLYDNPGLGCIALQYIKAYQGDCSVVGGDDAKKPF  83

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            +S F +TFAPNCGV  +TL+QITGR +ACQSKYV PS+AFS+IL++  KS +IL++KNHT
Sbjct  84   ESQFADTFAPNCGVIASTLSQITGRLVACQSKYVEPSKAFSEILMKDSKSLEILHNKNHT  143

Query  484  EvggavsgsdgggPYFWCVLFSNG  555
            EVG AV+G+DGG PYFWCVLFSNG
Sbjct  144  EVGAAVTGTDGGAPYFWCVLFSNG  167



>ref|XP_009362772.1| PREDICTED: uncharacterized protein LOC103952806 [Pyrus x bretschneideri]
Length=233

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +1

Query  121  QSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKP  300
            Q KVT+NPAD+LV  +N+NRTA K+ SLYSN GLAC+ALQYIKA+EGDCDAVGG+DAKKP
Sbjct  25   QIKVTNNPADKLVDIINSNRTAHKVSSLYSNQGLACIALQYIKAYEGDCDAVGGTDAKKP  84

Query  301  PDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNH  480
             DS+F ETFAPNCGVQ +TL  ITGR + CQSKYV   +AFS ILI   K  DILY+KNH
Sbjct  85   ADSAFAETFAPNCGVQPSTLTPITGRLIGCQSKYVHADEAFSTILIENSKGLDILYNKNH  144

Query  481  TEvggavsgsdgggPYFWCVLFSNGKS  561
            TEVG A SGSDG GPYFWCVLFS GK+
Sbjct  145  TEVGAAASGSDGEGPYFWCVLFSGGKT  171



>emb|CBI20724.3| unnamed protein product [Vitis vinifera]
Length=957

 Score =   222 bits (566),  Expect = 6e-64, Method: Composition-based stats.
 Identities = 110/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +1

Query  112  ANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDA  291
            A+    VTDNPADELVA LNNNRTA K  +LY NPGLAC+ALQYIKA++G C  VGG DA
Sbjct  25   ADTHKSVTDNPADELVATLNNNRTAHKESALYDNPGLACIALQYIKAYQGSCGEVGGEDA  84

Query  292  KKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYS  471
            KKP +S F ETFAPNCGVQV+TL QITGR L C++KYVSP++AFS+IL++  KS +ILYS
Sbjct  85   KKPAESQFAETFAPNCGVQVSTLTQITGRLLGCETKYVSPAEAFSEILMKNSKSLEILYS  144

Query  472  KNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            KNHTE+G AVSGSDGG PYFWCVLFSNGKS
Sbjct  145  KNHTELGAAVSGSDGGAPYFWCVLFSNGKS  174



>gb|KJB65467.1| hypothetical protein B456_010G096500 [Gossypium raimondii]
Length=232

 Score =   208 bits (530),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = +1

Query  109  SANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSD  288
            SA  Q+K+TDNPADELVA LN NRTA K  SL  NPGLAC+ALQYIKA++GDC+AVG SD
Sbjct  24   SAITQTKLTDNPADELVAVLNANRTAHKSSSLADNPGLACIALQYIKAYQGDCEAVGESD  83

Query  289  AKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILY  468
            AKKPPDS F +TFAPNCGV  +TL+ ITGRFL CQSKYV PS+AFS +LI+ +KS +ILY
Sbjct  84   AKKPPDSEFAQTFAPNCGVDASTLSPITGRFLGCQSKYVQPSEAFS-MLIKNEKSLEILY  142

Query  469  SKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            +KN TE+G AV+G+DGG PYFWCVL SNGK
Sbjct  143  NKNQTEIGAAVTGTDGGAPYFWCVLLSNGK  172



>gb|KHG22696.1| hypothetical protein F383_04298 [Gossypium arboreum]
Length=228

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 125/150 (83%), Gaps = 1/150 (1%)
 Frame = +1

Query  109  SANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSD  288
            SA  Q+K+TDNPADELVA LN NRTA K  SL  NPGLAC+ALQYIKA++GDC+AVGGSD
Sbjct  24   SALTQTKLTDNPADELVAVLNANRTAHKSSSLADNPGLACIALQYIKAYQGDCEAVGGSD  83

Query  289  AKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILY  468
            AKKPPDS F +TFAP CGV  +TL+ ITGRFL CQSKYV PS+AFS +LI+ +KS +ILY
Sbjct  84   AKKPPDSEFAQTFAPYCGVDASTLSPITGRFLGCQSKYVQPSEAFS-MLIKNEKSLEILY  142

Query  469  SKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            +KN TE+G AV+G DGG PYFWCVL SNGK
Sbjct  143  NKNQTEIGAAVTGIDGGAPYFWCVLLSNGK  172



>ref|XP_008393587.1| PREDICTED: uncharacterized protein LOC103455775 [Malus domestica]
 ref|XP_008360951.1| PREDICTED: uncharacterized protein LOC103424633 [Malus domestica]
Length=233

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +1

Query  121  QSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKP  300
            Q KVT+NPAD+LV  +N+NRTA K  SLYSN GLAC+ALQYIKA+EGDCDAVGG+DAKKP
Sbjct  25   QIKVTNNPADKLVDIINSNRTAHKASSLYSNQGLACIALQYIKAYEGDCDAVGGTDAKKP  84

Query  301  PDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNH  480
             DS+F ETFAPNCGVQ  TL  ITGR + CQSKYV   +AFS ILI   K  DILY+KNH
Sbjct  85   ADSAFAETFAPNCGVQPATLTPITGRLIGCQSKYVHADEAFSTILIENSKGLDILYNKNH  144

Query  481  TEvggavsgsdgggPYFWCVLFSNGKS  561
            TEVG A SGSDGG PYFWCVLFS GK+
Sbjct  145  TEVGAAASGSDGGAPYFWCVLFSGGKT  171



>ref|XP_006474495.1| PREDICTED: uncharacterized protein LOC102617951 isoform X2 [Citrus 
sinensis]
 dbj|BAK61875.1| ferredoxin-like protein [Citrus unshiu]
Length=219

 Score =   206 bits (523),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +1

Query  127  KVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPD  306
            KVT+NPADELVA LN+NRTA K  SL+ NPGLAC+ALQYIKA+EG CD VGG  AK+P  
Sbjct  20   KVTNNPADELVAVLNSNRTAHKESSLHDNPGLACIALQYIKAYEGHCDDVGGPKAKRPAA  79

Query  307  SSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTE  486
            S F +TFAPNCGV  ++L QITGR L CQS+YV  S+AFSDIL++ +KS DILYSKNHTE
Sbjct  80   SEFADTFAPNCGVLSSSLTQITGRLLGCQSRYVHASEAFSDILMKNEKSLDILYSKNHTE  139

Query  487  vggavsgsdgggPYFWCVLFSNGK  558
            VG AVSG+DGG PYFWCVLFSNGK
Sbjct  140  VGAAVSGTDGGAPYFWCVLFSNGK  163



>ref|XP_008786636.1| PREDICTED: uncharacterized protein LOC103704909 [Phoenix dactylifera]
Length=218

 Score =   205 bits (522),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 132/170 (78%), Gaps = 7/170 (4%)
 Frame = +1

Query  58   MAFLQWFLLLCI--FFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACL  231
            MA   W L  C+  FF+ AS    +  T+NPAD+LVAA+N+NRTA K   L+ NPGL C+
Sbjct  1    MAISAWILAPCLLLFFSPASG---TDSTNNPADQLVAAINSNRTAHKSTKLFDNPGLGCI  57

Query  232  ALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSP  411
            ALQYIKA++G CDA+G  D KKPPDSSF +T APNCGV+  TLA I+GR LACQSKYVSP
Sbjct  58   ALQYIKAYQGQCDALG--DNKKPPDSSFADTLAPNCGVEAQTLAPISGRLLACQSKYVSP  115

Query  412  SQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
             QAFSDILIR  +S  ILY+KNHT+VG AV+G+DGG PYFWCVLFS+GK+
Sbjct  116  DQAFSDILIRNAESLQILYNKNHTQVGAAVTGTDGGAPYFWCVLFSSGKT  165



>gb|KJB65468.1| hypothetical protein B456_010G096500 [Gossypium raimondii]
Length=231

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            +K+TDNPADELVA LN NRTA K  SL  NPGLAC+ALQYIKA++GDC+AVG SDAKKPP
Sbjct  28   AKLTDNPADELVAVLNANRTAHKSSSLADNPGLACIALQYIKAYQGDCEAVGESDAKKPP  87

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            DS F +TFAPNCGV  +TL+ ITGRFL CQSKYV PS+AFS +LI+ +KS +ILY+KN T
Sbjct  88   DSEFAQTFAPNCGVDASTLSPITGRFLGCQSKYVQPSEAFS-MLIKNEKSLEILYNKNQT  146

Query  484  EvggavsgsdgggPYFWCVLFSNGK  558
            E+G AV+G+DGG PYFWCVL SNGK
Sbjct  147  EIGAAVTGTDGGAPYFWCVLLSNGK  171



>ref|XP_010047394.1| PREDICTED: uncharacterized protein LOC104436349 [Eucalyptus grandis]
 gb|KCW79306.1| hypothetical protein EUGRSUZ_C00728 [Eucalyptus grandis]
Length=222

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +1

Query  109  SANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSD  288
            SA+ Q KVT NP D+LV  +NNNRTA K  SLY NPGLAC+ALQYIKA++GDC AVGG++
Sbjct  18   SADVQIKVTKNPGDQLVDVINNNRTASKSSSLYDNPGLACIALQYIKAYQGDCAAVGGAN  77

Query  289  AKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILY  468
            AKKPP++ F E FAPNCGVQ ++L+ ITGR L C++KYVSPS+AFS IL++ +KS +I+ 
Sbjct  78   AKKPPEADFAEIFAPNCGVQTSSLSPITGRLLGCETKYVSPSKAFSGILMQKEKSIEIVT  137

Query  469  SKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
             KNHTEVG AVSGS+GG PYFWCVLFSNG S
Sbjct  138  DKNHTEVGAAVSGSNGGSPYFWCVLFSNGTS  168



>ref|XP_008452785.1| PREDICTED: uncharacterized protein LOC103493701 isoform X1 [Cucumis 
melo]
Length=226

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 128/167 (77%), Gaps = 2/167 (1%)
 Frame = +1

Query  67   LQWFLLLCIFFTS--ASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQ  240
            + W+LL    F S  ++ +  + VTDNPAD+LVA LN NRTA KL  L  NPGLACLALQ
Sbjct  5    ILWYLLFSALFVSVFSAGDFAANVTDNPADKLVAVLNKNRTAHKLSPLKDNPGLACLALQ  64

Query  241  YIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQA  420
            YIKA++G C+AVGG D  KPP+S+F ETFAPNCGV V++LA ITGR L CQSKYV   +A
Sbjct  65   YIKAYQGKCEAVGGPDGMKPPNSAFAETFAPNCGVVVSSLAPITGRLLGCQSKYVHAPEA  124

Query  421  FSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            FSD+L+   KS +ILY KN+TEVG AV+G+DGG PYFWCVLFSNG +
Sbjct  125  FSDVLMENNKSLEILYYKNNTEVGAAVTGTDGGSPYFWCVLFSNGST  171



>ref|XP_010917186.1| PREDICTED: uncharacterized protein LOC105041839 isoform X1 [Elaeis 
guineensis]
Length=218

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = +1

Query  58   MAFLQWFLLLCI--FFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACL  231
            MA   W L+ C+  FF+ ASA   +  T+NPAD+LVA +N+NRTA K   L+ NPGL C+
Sbjct  1    MAISAWILVSCLLLFFSPASA---TDSTNNPADQLVAVINSNRTAHKSSVLFDNPGLGCI  57

Query  232  ALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSP  411
            ALQYI+A++G CD VGG+  KKP DSSF +TFAPNCGV+  TLA ITGR LACQS YVSP
Sbjct  58   ALQYIQAYQGQCDEVGGN--KKPSDSSFADTFAPNCGVEAQTLAPITGRLLACQSSYVSP  115

Query  412  SQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
             QAFSDILI+  +S  ILY KNHT+VG AV G+DGG PYFWCVLFS GK+
Sbjct  116  DQAFSDILIKNARSLQILYDKNHTQVGAAVRGTDGGAPYFWCVLFSGGKT  165



>ref|XP_006452992.1| hypothetical protein CICLE_v10010155mg, partial [Citrus clementina]
 gb|ESR66232.1| hypothetical protein CICLE_v10010155mg, partial [Citrus clementina]
Length=747

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  127  KVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPD  306
            KVT+NPADELVA LN+NRTA K  SL+ NPGLAC+ALQYIKA+EG CD VGG  AK+P D
Sbjct  1    KVTNNPADELVAVLNSNRTAHKESSLHDNPGLACIALQYIKAYEGHCDDVGGPKAKRPAD  60

Query  307  SSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTE  486
            S F +TFAPNCGV  ++LAQITGR L CQS+YV  S+AFSDIL++ +KS DILYSKNHTE
Sbjct  61   SEFADTFAPNCGVLSSSLAQITGRLLGCQSRYVHASEAFSDILMKNEKSLDILYSKNHTE  120

Query  487  vggavsgsdgggPYFWCVLFSNGK  558
            VG AVSG+DGG PYFWCVLFSNGK
Sbjct  121  VGAAVSGTDGGAPYFWCVLFSNGK  144



>gb|ACN41190.1| unknown [Picea sitchensis]
Length=222

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 124/157 (79%), Gaps = 3/157 (2%)
 Frame = +1

Query  85   LCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGD  264
            + I   SASA A SK  +NPADELV  +N NRTA K  +L  NPGLACLALQYIKA++G+
Sbjct  11   ILIALGSASA-ADSK--NNPADELVGVINQNRTAHKSSTLADNPGLACLALQYIKAYDGN  67

Query  265  CDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRG  444
            CD V GSDAKKP +++F ETFAPNCGV+V+TL QI+GR LACQSKY  P++AFS++L   
Sbjct  68   CDDVAGSDAKKPAETAFAETFAPNCGVEVSTLGQISGRLLACQSKYAEPAEAFSNVLFEN  127

Query  445  QKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNG  555
             KS  ILY+KNHTEVG  + G+DGGGPYFWCVLFS+G
Sbjct  128  GKSLSILYNKNHTEVGVGIQGTDGGGPYFWCVLFSSG  164



>gb|AFK45931.1| unknown [Lotus japonicus]
Length=167

 Score =   192 bits (489),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 4/163 (2%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFT----SASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLA  225
            MA L   ++L    +    SA+ N Q KVT+NPAD+LVAA+N NRTA K+  LY N GLA
Sbjct  1    MAKLYLVVILSFLHSASTGSAATNTQIKVTNNPADKLVAAINENRTAYKVSELYDNAGLA  60

Query  226  CLALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYV  405
            C+ALQYIKA++GDC AVGG DAKKPP+S F E FAPNCGV+ ++LA ITGRFL CQ+KYV
Sbjct  61   CIALQYIKAYQGDCGAVGGPDAKKPPESQFAEVFAPNCGVKASSLAPITGRFLGCQTKYV  120

Query  406  SPSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFW  534
               +AFS++LI+ Q+S +IL+SKNHT+VG AV+G+DGG PYF 
Sbjct  121  HAPEAFSEVLIQNQRSLEILHSKNHTQVGAAVTGTDGGSPYFL  163



>ref|XP_004157406.1| PREDICTED: uncharacterized LOC101215279 [Cucumis sativus]
Length=301

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   LLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFE  258
            L+LC      SA   S VTDNPAD+LV  LN NRTA KL  L  NPGLACLALQYIKA++
Sbjct  87   LVLCPVRLCFSA-GDSNVTDNPADKLVVVLNKNRTAHKLSPLKDNPGLACLALQYIKAYQ  145

Query  259  GDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILI  438
            G C+AVGG D  KPP+S+F ETFAPNCGV V++LA ITGR L CQSKYV   +AFSD+L+
Sbjct  146  GKCEAVGGPDGMKPPNSAFAETFAPNCGVVVSSLAPITGRLLGCQSKYVHAPEAFSDVLM  205

Query  439  RGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
               KS +ILY KN+TEVG AV+G+DGG PYFWCVLFSNG +
Sbjct  206  ENNKSLEILYYKNNTEVGAAVTGTDGGSPYFWCVLFSNGTT  246



>ref|XP_010917187.1| PREDICTED: uncharacterized protein LOC105041839 isoform X2 [Elaeis 
guineensis]
Length=194

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            DNPAD+LVA +N+NRTA K   L+ NPGL C+ALQYI+A++G CD VGG+  KKP DSSF
Sbjct  2    DNPADQLVAVINSNRTAHKSSVLFDNPGLGCIALQYIQAYQGQCDEVGGN--KKPSDSSF  59

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgg  495
             +TFAPNCGV+  TLA ITGR LACQS YVSP QAFSDILI+  +S  ILY KNHT+VG 
Sbjct  60   ADTFAPNCGVEAQTLAPITGRLLACQSSYVSPDQAFSDILIKNARSLQILYDKNHTQVGA  119

Query  496  avsgsdgggPYFWCVLFSNGKS  561
            AV G+DGG PYFWCVLFS GK+
Sbjct  120  AVRGTDGGAPYFWCVLFSGGKT  141



>ref|XP_006849670.1| hypothetical protein AMTR_s00024p00232320 [Amborella trichopoda]
 gb|ERN11251.1| hypothetical protein AMTR_s00024p00232320 [Amborella trichopoda]
Length=212

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 113/144 (78%), Gaps = 3/144 (2%)
 Frame = +1

Query  130  VTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDS  309
             T NPADELVAALN NRTA KL SL+ NPGL C+ALQYIKA++G CD    ++ KKP D+
Sbjct  19   TTGNPADELVAALNANRTALKLASLHDNPGLGCMALQYIKAYQGRCDE---ANDKKPADA  75

Query  310  SFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEv  489
             F +TFAPNCGV+ ++LAQ+TGR L CQS YV  ++AFS++LI   KS  ILY+KNHTEV
Sbjct  76   DFAQTFAPNCGVEPSSLAQVTGRLLGCQSSYVHATEAFSNLLIHNNKSLAILYNKNHTEV  135

Query  490  ggavsgsdgggPYFWCVLFSNGKS  561
            G  VSG+DGG PYFWCVLFSNG S
Sbjct  136  GAGVSGTDGGAPYFWCVLFSNGAS  159



>ref|XP_009381399.1| PREDICTED: uncharacterized protein LOC103969560 [Musa acuminata 
subsp. malaccensis]
Length=217

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 113/140 (81%), Gaps = 3/140 (2%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            +NPADELV+ +N+NRT+ K P+L+ N GL C+ALQYIKA+EG C  VG  D+KKPPDSSF
Sbjct  26   NNPADELVSVINSNRTSHKSPALFDNAGLGCIALQYIKAYEGQCGEVG--DSKKPPDSSF  83

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgg  495
            ++TFAPNCGV+  TLA ITGR LACQS YVSP  AF DILI   +S  IL+ KNHTEVG 
Sbjct  84   IDTFAPNCGVEAPTLAPITGRLLACQSTYVSPEAAF-DILIENARSLQILHDKNHTEVGV  142

Query  496  avsgsdgggPYFWCVLFSNG  555
            AVSG+DGG PYFWCVLFSNG
Sbjct  143  AVSGTDGGAPYFWCVLFSNG  162



>gb|EMT07035.1| hypothetical protein F775_05309 [Aegilops tauschii]
Length=220

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 114/141 (81%), Gaps = 3/141 (2%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            DNPADELV+ +N+NRTA K  +L  N GL C+ALQYIKA+EG CD VGG+  KKP DSSF
Sbjct  29   DNPADELVSLINSNRTASKASNLVDNQGLGCIALQYIKAYEGQCDQVGGN--KKPVDSSF  86

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgg  495
            ++TFAPNCGVQ  +LA+ITGR LACQ  Y  P+QAF D+LI  ++S  +L+SKNHTEVG 
Sbjct  87   IDTFAPNCGVQAASLAKITGRLLACQPSYPPPAQAF-DMLIANERSLQVLHSKNHTEVGA  145

Query  496  avsgsdgggPYFWCVLFSNGK  558
            AV+G+ GGGPYFWCVLFSNGK
Sbjct  146  AVTGTSGGGPYFWCVLFSNGK  166



>dbj|BAJ87667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=197

 Score =   179 bits (454),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 113/142 (80%), Gaps = 3/142 (2%)
 Frame = +1

Query  133  TDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSS  312
            TDNPADELV+ +N NRTA K  +L  N GL C+ALQYIKA+EG CD VGG+  KKP DSS
Sbjct  5    TDNPADELVSLINANRTASKASNLADNQGLGCIALQYIKAYEGQCDQVGGN--KKPVDSS  62

Query  313  FVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvg  492
            F++TFAPNCGVQ  +LA+ITGR LACQ  Y  P+QAF D+LI  ++S  +L+SKNHTEVG
Sbjct  63   FIDTFAPNCGVQTASLAKITGRLLACQPTYPPPAQAF-DMLIADERSLQVLHSKNHTEVG  121

Query  493  gavsgsdgggPYFWCVLFSNGK  558
             AV+G+ GGGPYFWCVL SNGK
Sbjct  122  AAVTGTSGGGPYFWCVLLSNGK  143



>ref|XP_003574591.1| PREDICTED: uncharacterized protein LOC100824002 [Brachypodium 
distachyon]
Length=219

 Score =   180 bits (456),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 113/141 (80%), Gaps = 3/141 (2%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            +NPADELVA LN+NRTA K  SL  N GL C+ALQYIKA++G CD VGG+  KKP +SSF
Sbjct  28   NNPADELVALLNSNRTAAKASSLADNQGLGCIALQYIKAYKGQCDQVGGN--KKPVESSF  85

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgg  495
            ++TFAPNCGVQ  TLA++TGR LACQS Y  P+QA  D+LI   KS  +L+SKNHTEVG 
Sbjct  86   IDTFAPNCGVQATTLAKLTGRLLACQSTYPPPAQAL-DMLISDSKSLQVLHSKNHTEVGA  144

Query  496  avsgsdgggPYFWCVLFSNGK  558
            AV+G+ GGGPYFWCVLFSNGK
Sbjct  145  AVTGTSGGGPYFWCVLFSNGK  165



>gb|EMS67934.1| hypothetical protein TRIUR3_30141 [Triticum urartu]
Length=220

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 114/142 (80%), Gaps = 3/142 (2%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            DNPA+ELV+ +N+NRTA K  +L  N GL C+ALQYIKA++G CD VGG+  KKP DSSF
Sbjct  29   DNPANELVSLINSNRTASKASNLADNQGLGCIALQYIKAYKGQCDQVGGN--KKPVDSSF  86

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgg  495
            ++TFAPNCGVQ  +LA+ITGR LACQ  Y  P+QAF D+LI  ++S  +L+SKNHTEVG 
Sbjct  87   IDTFAPNCGVQAASLAKITGRLLACQPSYPPPAQAF-DMLIADERSLQVLHSKNHTEVGA  145

Query  496  avsgsdgggPYFWCVLFSNGKS  561
            AV+ + GGGPYFWCVLFSNGK+
Sbjct  146  AVTSTSGGGPYFWCVLFSNGKA  167



>gb|AEI28612.1| hypothetical protein [Triticum aestivum]
Length=219

 Score =   177 bits (449),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 114/141 (81%), Gaps = 3/141 (2%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            +NPADELV+ +N+NRTA K  +L  N GL C+ALQYIKA++G CD VGG+  KKP DSSF
Sbjct  28   NNPADELVSLINSNRTASKASNLVDNQGLGCIALQYIKAYKGQCDQVGGN--KKPVDSSF  85

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgg  495
            ++TFAPNCGVQ  +LA+ITGR LACQ  Y  P+QAF D+LI  ++S  +L+SKNHTEVG 
Sbjct  86   IDTFAPNCGVQAASLAKITGRLLACQPSYPPPAQAF-DMLIADERSLQVLHSKNHTEVGA  144

Query  496  avsgsdgggPYFWCVLFSNGK  558
            AV+G+ GGGPYFWCVLFSNGK
Sbjct  145  AVTGTSGGGPYFWCVLFSNGK  165



>ref|XP_006659474.1| PREDICTED: uncharacterized protein LOC102704354 [Oryza brachyantha]
Length=225

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 113/141 (80%), Gaps = 3/141 (2%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            +NPAD+LV+ +N+NRTA K  SL  N GL C+ALQYIKA+EG C+ VG S  KKP +SSF
Sbjct  31   NNPADQLVSLINSNRTASKASSLDDNQGLGCIALQYIKAYEGQCNQVGQS--KKPMESSF  88

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgg  495
             ETFAPNCGVQV TL++ITGR LACQS Y +P QAF D L+   KS ++L+SKNHTEVG 
Sbjct  89   AETFAPNCGVQVATLSKITGRLLACQSNYATPGQAF-DFLVNDAKSLEVLHSKNHTEVGA  147

Query  496  avsgsdgggPYFWCVLFSNGK  558
            AV+G+ GGGPYFWCVLFS+GK
Sbjct  148  AVTGTSGGGPYFWCVLFSSGK  168



>dbj|BAJ89776.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 112/141 (79%), Gaps = 3/141 (2%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            +NPADELV+ +N NRTA K  +L  N GL C+ALQYIKA+EG CD VGG+  KKP DSSF
Sbjct  28   NNPADELVSLINANRTASKASNLADNQGLGCIALQYIKAYEGQCDQVGGN--KKPVDSSF  85

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgg  495
            ++TFAPNCGVQ  +LA+ITGR LACQ  Y  P+QAF D+LI  ++S  +L+SKNHTEVG 
Sbjct  86   IDTFAPNCGVQTASLAKITGRLLACQPTYPPPAQAF-DMLIADERSLQVLHSKNHTEVGA  144

Query  496  avsgsdgggPYFWCVLFSNGK  558
            AV+G+ GGGPYFWCVL SNGK
Sbjct  145  AVTGTSGGGPYFWCVLLSNGK  165



>ref|NP_001061973.1| Os08g0459300 [Oryza sativa Japonica Group]
 dbj|BAD09597.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23887.1| Os08g0459300 [Oryza sativa Japonica Group]
 dbj|BAG95037.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68811.1| hypothetical protein OsJ_27570 [Oryza sativa Japonica Group]
Length=226

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 112/141 (79%), Gaps = 3/141 (2%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            +NPAD+LVA +N+NRTA K  +L  N GL C+ALQYIKA+EG C+ VG  ++KKPP++SF
Sbjct  32   NNPADQLVALINSNRTASKASTLDDNQGLGCIALQYIKAYEGQCNQVG--ESKKPPETSF  89

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgg  495
             ETFAPNCGVQ  TL +ITGR LACQS Y +P QAF + L+   KS  +L+SKNHTEVG 
Sbjct  90   AETFAPNCGVQAATLTKITGRLLACQSNYATPDQAF-NFLVNDAKSIQVLHSKNHTEVGA  148

Query  496  avsgsdgggPYFWCVLFSNGK  558
            AVSG+ GGGPYFWCVLFS+GK
Sbjct  149  AVSGTSGGGPYFWCVLFSSGK  169



>gb|EEC83682.1| hypothetical protein OsI_29480 [Oryza sativa Indica Group]
Length=226

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 111/141 (79%), Gaps = 3/141 (2%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            +NPAD+LVA +N+NRTA K  +L  N GL C+ALQYIKA+EG C+ VG  ++KKPP++SF
Sbjct  32   NNPADQLVALINSNRTASKASTLDDNQGLGCIALQYIKAYEGQCNQVG--ESKKPPETSF  89

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgg  495
             ETFAPNCGVQ  TL +ITGR LACQS Y +P QAF + L+   KS  +L+SKNHTEVG 
Sbjct  90   AETFAPNCGVQAATLTKITGRLLACQSNYATPDQAF-NFLVNDAKSIQVLHSKNHTEVGA  148

Query  496  avsgsdgggPYFWCVLFSNGK  558
            AVSG+ G GPYFWCVLFS+GK
Sbjct  149  AVSGTSGRGPYFWCVLFSSGK  169



>ref|XP_008389963.1| PREDICTED: uncharacterized protein LOC103452219 [Malus domestica]
Length=190

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = +1

Query  157  VAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPN  336
            VA +  NRT  K  SLY N GLAC+ALQYIKA++GDCDAVGG DAKKPP S+F ETFAPN
Sbjct  4    VALIWCNRTTHKASSLYDNQGLACIALQYIKAYQGDCDAVGGPDAKKPPGSAFAETFAPN  63

Query  337  CGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdg  516
            CGVQ +TLA I  R + CQS+YV   +AFS ILI   K+ DILY KN+ EVG AVSGSDG
Sbjct  64   CGVQTSTLAPIPCRLIGCQSRYVHADEAFSKILIENSKALDILYDKNNIEVGTAVSGSDG  123

Query  517  ggPYFWCVLFSNGKS  561
            G PYFWCVLFS+GK+
Sbjct  124  GAPYFWCVLFSSGKT  138



>ref|XP_008676945.1| PREDICTED: uncharacterized protein LOC100276332 isoform X1 [Zea 
mays]
 gb|AFW61891.1| hypothetical protein ZEAMMB73_398406 [Zea mays]
Length=223

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 110/140 (79%), Gaps = 3/140 (2%)
 Frame = +1

Query  139  NPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSFV  318
            NPADELVA +N+NRTA K  S+  N GL C+ALQYIKA+EG CD V   D KKP +SSF 
Sbjct  31   NPADELVALINSNRTAGKASSVSDNQGLGCIALQYIKAYEGHCDQV---DDKKPMESSFT  87

Query  319  ETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgga  498
            +TFAP CGVQ  TL++ITGR +ACQS+Y++P++AF  +L+   K   IL SKNHTEVG A
Sbjct  88   DTFAPTCGVQATTLSKITGRLVACQSQYLAPAEAFGVLLVNDAKGLQILRSKNHTEVGAA  147

Query  499  vsgsdgggPYFWCVLFSNGK  558
            VSG+DGGGPYFWCVLFS+GK
Sbjct  148  VSGTDGGGPYFWCVLFSDGK  167



>ref|XP_002445606.1| hypothetical protein SORBIDRAFT_07g022480 [Sorghum bicolor]
 gb|EES15101.1| hypothetical protein SORBIDRAFT_07g022480 [Sorghum bicolor]
Length=225

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 111/141 (79%), Gaps = 4/141 (3%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            DNPAD+LVA +N+NRTA K  ++  N GL C+ALQYI+A+EG CD V   D KKP +SSF
Sbjct  30   DNPADQLVALINSNRTASKASAVSDNQGLGCIALQYIRAYEGHCDQV---DDKKPMESSF  86

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgg  495
             +TFAP CGVQ  TL++ITGR + CQSKY +P++AF +IL+   K   IL+SKNHTEVG 
Sbjct  87   TDTFAPTCGVQATTLSKITGRLVGCQSKYATPAEAF-NILVNDAKGLQILHSKNHTEVGA  145

Query  496  avsgsdgggPYFWCVLFSNGK  558
            AVSG+DGGGPYFWCVLFS+GK
Sbjct  146  AVSGTDGGGPYFWCVLFSDGK  166



>ref|XP_004973623.1| PREDICTED: uncharacterized protein LOC101780191 [Setaria italica]
Length=226

 Score =   167 bits (422),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 4/142 (3%)
 Frame = +1

Query  133  TDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSS  312
            T+NPAD+LV+ +N+NRTA K  SL  N GL C+ALQYIKA++G C  V     KKPP+SS
Sbjct  28   TNNPADQLVSLVNSNRTASKASSLSDNQGLGCIALQYIKAYQGQCSDV---RDKKPPESS  84

Query  313  FVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvg  492
            F E FAP+CGVQV TL++ITGR +ACQSKY SP +A  DIL+   K   +L+SKNHTE+G
Sbjct  85   FAEKFAPDCGVQVATLSKITGRLVACQSKYPSPPEAL-DILVNDAKDLQVLHSKNHTEIG  143

Query  493  gavsgsdgggPYFWCVLFSNGK  558
             AVSG+DGGGPYFWCVLFS GK
Sbjct  144  VAVSGTDGGGPYFWCVLFSGGK  165



>ref|NP_001145228.1| uncharacterized protein LOC100278496 precursor [Zea mays]
 gb|ACG46095.1| hypothetical protein [Zea mays]
Length=231

 Score =   165 bits (417),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 110/142 (77%), Gaps = 5/142 (4%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            +NPAD+LVA +N+NRTA K  S+  N GL C+ALQYIKA+EG CD V   D KKP +SSF
Sbjct  32   NNPADQLVALINSNRTASKSASVSDNQGLGCIALQYIKAYEGHCDQV---DDKKPMESSF  88

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRG-QKSFDILYSKNHTEvg  492
             +TFAP CGVQ  TL++ITGR +ACQSKY +P++A   IL+ G +K    L+ KNHTEVG
Sbjct  89   TDTFAPTCGVQAATLSRITGRLVACQSKYATPAEALG-ILVNGAKKGLQTLHGKNHTEVG  147

Query  493  gavsgsdgggPYFWCVLFSNGK  558
             AVSG+DGGGPYFWCVLFS+GK
Sbjct  148  AAVSGTDGGGPYFWCVLFSDGK  169



>ref|NP_001182878.1| uncharacterized protein LOC100501150 precursor [Zea mays]
 gb|ACR34998.1| unknown [Zea mays]
Length=234

 Score =   165 bits (417),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 110/142 (77%), Gaps = 5/142 (4%)
 Frame = +1

Query  136  DNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSF  315
            +NPAD+LVA +N+NRTA K  S+  N GL C+ALQYIKA+EG CD V   D KKP +SSF
Sbjct  35   NNPADQLVALINSNRTASKSASVSDNQGLGCIALQYIKAYEGHCDQV---DDKKPMESSF  91

Query  316  VETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRG-QKSFDILYSKNHTEvg  492
             +TFAP CGVQ  TL++ITGR +ACQSKY +P++A   IL+ G +K    L+ KNHTEVG
Sbjct  92   TDTFAPTCGVQAATLSRITGRLVACQSKYATPAEALG-ILVNGAKKGLQTLHGKNHTEVG  150

Query  493  gavsgsdgggPYFWCVLFSNGK  558
             AVSG+DGGGPYFWCVLFS+GK
Sbjct  151  AAVSGTDGGGPYFWCVLFSDGK  172



>gb|ADE77277.1| unknown [Picea sitchensis]
Length=223

 Score =   162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 108/163 (66%), Gaps = 8/163 (5%)
 Frame = +1

Query  79   LLLCIFFTSASAN---AQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIK  249
            L +CI    +S +   A + V  NPADELV  +N NRTA K   LY NPGL C+ALQYI+
Sbjct  10   LAICISLLVSSLHMVAAHTHVHGNPADELVDIINKNRTAHKSSKLYDNPGLGCMALQYIQ  69

Query  250  AFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSD  429
            A+ G CD     ++K PP+    E FAP+CGV++ T+  I+GR LAC+S Y  P +AFS 
Sbjct  70   AYNGTCD-----ESKSPPEVDITEVFAPDCGVELPTVQTISGRLLACRSHYAKPPEAFSQ  124

Query  430  ILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            +LI  +KS  +LY  NHTEVG  +SG++  GPYFWCVLF +G+
Sbjct  125  VLIESKKSLSVLYDGNHTEVGVGLSGTNSDGPYFWCVLFGSGQ  167



>ref|XP_007052411.1| Ferredoxin-related [Theobroma cacao]
 gb|EOX96568.1| Ferredoxin-related [Theobroma cacao]
Length=222

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 107/171 (63%), Gaps = 5/171 (3%)
 Frame = +1

Query  49   LPTMAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLAC  228
            +  + F +W LL  +   +A     SK   NPA++LV  +N NRTA+KLP L  +PGL C
Sbjct  3    MKKLCFCEWILLCHLLLATAVC---SKHHGNPANDLVEIINQNRTAQKLPQLNDSPGLGC  59

Query  229  LALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVS  408
            +ALQY++  +G+C      + K PPD  F E FAPNCGV++ T   ITG  + CQSKY  
Sbjct  60   MALQYVELCKGNCSGNSAVNCK-PPDDDFTEVFAPNCGVELPTFGTITGHIVGCQSKYTE  118

Query  409  PSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            PS AFS +L++ +KS  +L +K++TE  G        GP+FWC+LFSNG++
Sbjct  119  PSLAFSHVLVKDKKSLSLLKNKSNTE-VGVGLVGFHKGPFFWCILFSNGRT  168



>gb|KDP28903.1| hypothetical protein JCGZ_14674 [Jatropha curcas]
Length=228

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 104/162 (64%), Gaps = 4/162 (2%)
 Frame = +1

Query  76   FLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAF  255
             ++LC    +A  +  SK   NPA+++V  +N NRTA KLP L  +PGL C+ALQY++  
Sbjct  12   LIVLCHLLLAACVS--SKNHGNPANDIVEMINENRTAHKLPQLNESPGLGCMALQYVELC  69

Query  256  EGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDIL  435
            EG+C +    + K PP+  F E FAPNCGV++ T   ITG  + C+SKYV PSQ FS +L
Sbjct  70   EGNCTSNNAVNCK-PPEDDFTEVFAPNCGVELPTFGTITGHIVGCESKYVDPSQVFSHVL  128

Query  436  IRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            ++  ++  +L +K+HTE  G        GP+FWC+LFSNGK+
Sbjct  129  VKDNRTLSLLRNKSHTE-VGVGFVGFHKGPFFWCILFSNGKT  169



>ref|XP_010544350.1| PREDICTED: uncharacterized protein LOC104816995 [Tarenaya hassleriana]
Length=225

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  118  AQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKK  297
            A S+   NPA+E+V  LN NRTA+KL  L ++PGL C+ALQYI+  +G+C     +   K
Sbjct  26   ASSRQHGNPANEIVDFLNKNRTAQKLAKLNNSPGLGCMALQYIELCKGNCSGNNDAANCK  85

Query  298  PPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKN  477
            PPD  F E FAPNCGV++ TL  +TG  + C SKYV P  AFSDIL+R ++   IL +K+
Sbjct  86   PPDDDFTEVFAPNCGVELPTLGTLTGHIVGCMSKYVQPEPAFSDILVRDRRELSILVNKS  145

Query  478  HTEvggavsgsdgggPYFWCVLFSNGKS  561
            HT   G        GP+FWCVLFSNG++
Sbjct  146  HT-GVGVGIVGFHKGPFFWCVLFSNGQT  172



>ref|XP_010274581.1| PREDICTED: uncharacterized protein LOC104609867 [Nelumbo nucifera]
Length=226

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 105/162 (65%), Gaps = 4/162 (2%)
 Frame = +1

Query  76   FLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAF  255
            +L+LC        +A+S    NPA+ELV+ +N NRTA+KLP L  NPGL C+ALQY    
Sbjct  11   WLILCNLLLVVMVSAKSH--GNPANELVSIINENRTAQKLPRLKDNPGLGCMALQYAVDC  68

Query  256  EGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDIL  435
            +G+C A   + + +P +  F E FAPNCGV++ T   I+G  + CQ KY+ PSQAFS+IL
Sbjct  69   KGNCTA-NNTVSCQPSEDDFTEIFAPNCGVELPTFDNISGHIVGCQFKYLEPSQAFSNIL  127

Query  436  IRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            +R +K+  +L SK HTE  G        GP+FWC+LFSNG++
Sbjct  128  VRDKKALSLLRSKEHTE-VGVGLIGTHRGPFFWCILFSNGQT  168



>ref|XP_010496690.1| PREDICTED: uncharacterized protein LOC104773737 [Camelina sativa]
 ref|XP_010496691.1| PREDICTED: uncharacterized protein LOC104773737 [Camelina sativa]
Length=224

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 104/157 (66%), Gaps = 2/157 (1%)
 Frame = +1

Query  91   IFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCD  270
            + F S S  A SK   NPA E+V+ LN NRT++KL +L  NPGL C+ALQY++  EG+C+
Sbjct  12   LLFLSLSELASSKFHGNPAHEMVSILNRNRTSQKLTNLNENPGLGCMALQYVEFCEGNCN  71

Query  271  AVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQK  450
             V  +   +PP+  F + FAPNCGV++ T   ITG  L C SKYV+P  AFSDIL R  K
Sbjct  72   -VNNTLGCEPPEDDFTQVFAPNCGVELPTFGAITGHILGCSSKYVAPEVAFSDILFRDNK  130

Query  451  SFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            +  +L +++HTEVG  V+    G  +FWC+LFS+G +
Sbjct  131  TLSVLRNRSHTEVGVGVARLHKGT-FFWCLLFSDGGT  166



>ref|XP_010496477.1| PREDICTED: uncharacterized protein LOC104773537 [Camelina sativa]
Length=224

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = +1

Query  91   IFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCD  270
            + F S S  A SK   NPA E+V+ LN NRT+ KL +L  NPGL C+ALQY++  EG+C+
Sbjct  12   LLFLSLSELANSKFHGNPAHEMVSILNRNRTSPKLTNLNENPGLGCMALQYVEFCEGNCN  71

Query  271  AVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQK  450
             V  +   +PP+  F + FAPNCGV++ T   ITG  L C SKYV+P  AFSDIL R  K
Sbjct  72   -VNNTLGCEPPEDDFTQVFAPNCGVELPTFGAITGHILGCSSKYVAPEVAFSDILFRDNK  130

Query  451  SFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            +  +L +++HTEVG  V+    G  +FWC+LFS+G +
Sbjct  131  TLSVLRNRSHTEVGVGVARLHKGT-FFWCLLFSDGGT  166



>ref|XP_006445473.1| hypothetical protein CICLE_v10022088mg [Citrus clementina]
 ref|XP_006464382.1| PREDICTED: uncharacterized protein LOC102616043 [Citrus sinensis]
 gb|ESR58713.1| hypothetical protein CICLE_v10022088mg [Citrus clementina]
 gb|KDO85419.1| hypothetical protein CISIN_1g027242mg [Citrus sinensis]
Length=226

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 108/168 (64%), Gaps = 6/168 (4%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLAL  237
            + F +W +L  +    A     SK   NPA++LV  +NNNRT++KL  L  +PGL C+AL
Sbjct  5    LCFFEWTVLCHLLLLVAVC---SKKHGNPANDLVDIINNNRTSQKLRKLNDSPGLGCMAL  61

Query  238  QYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQ  417
            QY++  +G+C + G +   KPP+  F E FAPNCGV++ T   ITG  + C++KY+ PS+
Sbjct  62   QYVELCKGNC-STGNAVNCKPPEDDFTEVFAPNCGVELPTFGTITGHMVGCKTKYLEPSR  120

Query  418  AFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            AFSD+L++ +K+  +L +K+HTE    V        +FWCVLFS+GK+
Sbjct  121  AFSDVLVKDKKALSLLRNKSHTE--VGVGLVGFHKSFFWCVLFSDGKT  166



>ref|XP_010269882.1| PREDICTED: uncharacterized protein LOC104606409 [Nelumbo nucifera]
Length=229

 Score =   146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 107/166 (64%), Gaps = 11/166 (7%)
 Frame = +1

Query  73   WFLL---LCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQY  243
            WF+L   L +F  SA  +       NPA+ELV  +N NRTA+KLP L  NPGL C+ALQY
Sbjct  15   WFILSNLLPVFVVSAMNHG------NPANELVNIINENRTAQKLPILKDNPGLGCMALQY  68

Query  244  IKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAF  423
             +  + +C +   + + +P D  F E FAPNCGV++ T   I+GR + CQ K++ PSQAF
Sbjct  69   AEECKANCTS-NNTLSCQPADDDFTEIFAPNCGVELPTFDIISGRIVGCQFKHIEPSQAF  127

Query  424  SDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            SDIL+R +KS  +L SK HTE  G     +  GP+FWC+LFS+G++
Sbjct  128  SDILVRDKKSLSLLISKGHTE-VGVGFIGNNHGPFFWCILFSSGQT  172



>ref|XP_010479288.1| PREDICTED: uncharacterized protein LOC104758161 [Camelina sativa]
 ref|XP_010496717.1| PREDICTED: uncharacterized protein LOC104773765 [Camelina sativa]
Length=224

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = +1

Query  91   IFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCD  270
            + F S S  A SK   NPA E+V+ LN NRT+ KL +L  NPGL C+ALQY++  EG+C+
Sbjct  12   LLFLSLSELASSKFHGNPAHEMVSILNRNRTSPKLTNLNENPGLGCMALQYVEFCEGNCN  71

Query  271  AVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQK  450
             V  +   +PP+  F + FAPNCGV++ T   ITG  L C SKYV+P  AFSDIL R  K
Sbjct  72   -VNNTLGCEPPEDDFTQVFAPNCGVELPTFGAITGHILGCSSKYVAPEVAFSDILFRDNK  130

Query  451  SFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            +  +L +++HTEVG  V+    G  +FWC+LFS G +
Sbjct  131  TLSLLRNRSHTEVGVGVARLHKGN-FFWCLLFSEGGT  166



>ref|XP_003626803.1| hypothetical protein MTR_8g009260 [Medicago truncatula]
 gb|AET01279.1| ferredoxin-like protein [Medicago truncatula]
Length=223

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 98/146 (67%), Gaps = 1/146 (1%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            S    NPA E+V  LN NRT +KL +L  +PGL C+ALQY++  +G+C      + K PP
Sbjct  25   SHTHGNPATEIVDILNKNRTDQKLHNLNDSPGLGCMALQYVELCKGNCTDNNVVNCK-PP  83

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            +  FVE FAPNCG+++ T   ITG  + CQ KY+ PS AFS ILI+ +KS  +L +K+HT
Sbjct  84   EDDFVEVFAPNCGIELPTFGTITGHIVGCQRKYLEPSLAFSQILIKDKKSLSLLRNKSHT  143

Query  484  EvggavsgsdgggPYFWCVLFSNGKS  561
            EVG  + G    GP+FWCVLF++GK+
Sbjct  144  EVGVGLVGLHKKGPFFWCVLFTDGKA  169



>ref|XP_008775950.1| PREDICTED: uncharacterized protein LOC103696192 [Phoenix dactylifera]
Length=222

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 105/162 (65%), Gaps = 4/162 (2%)
 Frame = +1

Query  76   FLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAF  255
            F +LC+   +  A+A++    NPA+E+V  +N NRT  KLP LY++PGL C+ALQYI   
Sbjct  12   FSILCLSIVALVASAKND--GNPANEVVDCINKNRTTNKLPKLYNSPGLGCMALQYISEC  69

Query  256  EGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDIL  435
             G+C     + + +PP+    E +APNCGV++ T+  I+G  + CQ KY++P QAFS +L
Sbjct  70   MGNCSTYN-TLSCQPPEVDITEVYAPNCGVELPTVGTISGHLVGCQWKYLNPEQAFSKVL  128

Query  436  IRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            I  +K   +L+SK+HTE  G        GP+FWC+LFS+GK+
Sbjct  129  ISDKKRLSLLHSKDHTE-VGVGFSRAHHGPFFWCILFSSGKT  169



>gb|KFK42592.1| hypothetical protein AALP_AA1G015400 [Arabis alpina]
Length=221

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 97/145 (67%), Gaps = 0/145 (0%)
 Frame = +1

Query  127  KVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPD  306
            ++  NPA E+V+ LNNNRTA+KL  L  +PGL C+ALQY +  EG+C+    + + +PP+
Sbjct  25   QLEGNPATEIVSILNNNRTARKLSKLDESPGLGCMALQYAELCEGNCNVNNNTVSCEPPE  84

Query  307  SSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTE  486
              F + FAPNCGV++ T   ITG  LAC S Y  P  AFSDIL R  K+  +L +++HTE
Sbjct  85   DDFTQVFAPNCGVELPTFGTITGHILACSSHYAKPQVAFSDILFRDSKALLVLRNRSHTE  144

Query  487  vggavsgsdgggPYFWCVLFSNGKS  561
            VG  ++    GG +FWC+LFS+G +
Sbjct  145  VGVGMARLHKGGTFFWCLLFSDGGT  169



>gb|KJB40943.1| hypothetical protein B456_007G084300 [Gossypium raimondii]
Length=225

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 96/146 (66%), Gaps = 2/146 (1%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            SK   NPA++LV  +N NRTA+KL  L  NPGL C+ALQY++  +G+C      + K PP
Sbjct  28   SKHHGNPANDLVEIINQNRTAQKLERLNDNPGLGCMALQYVELCKGNCSGNSAVNCK-PP  86

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
               F E FAPNCGV++ T+  ITG  + CQSKY  PS AF+++L++ +KS  +L +K+H+
Sbjct  87   TDDFTEVFAPNCGVELPTIGTITGHIVGCQSKYTEPSLAFANVLVKDKKSLTVLRNKSHS  146

Query  484  EvggavsgsdgggPYFWCVLFSNGKS  561
            E  G        GP+FWCVLFSNG +
Sbjct  147  E-VGVGLIGFHKGPFFWCVLFSNGGT  171



>gb|AFK38521.1| unknown [Medicago truncatula]
Length=223

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 97/146 (66%), Gaps = 1/146 (1%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            S    NPA E+V  LN NRT +KL +L  +PGL C+ALQY+   +G+C      + K PP
Sbjct  25   SHTHGNPATEIVDILNKNRTDQKLHNLNDSPGLGCMALQYVGLCKGNCTDNNVVNCK-PP  83

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            +  FVE FAPNCG+++ T   ITG  + CQ KY+ PS AFS ILI+ +KS  +L +K+HT
Sbjct  84   EDDFVEVFAPNCGIELPTFGTITGHIVGCQRKYLEPSLAFSQILIKDKKSLSLLRNKSHT  143

Query  484  EvggavsgsdgggPYFWCVLFSNGKS  561
            EVG  + G    GP+FWCVLF++GK+
Sbjct  144  EVGVGLVGLHKKGPFFWCVLFTDGKA  169



>ref|XP_010496692.1| PREDICTED: uncharacterized protein LOC104773739 [Camelina sativa]
Length=201

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 98/144 (68%), Gaps = 2/144 (1%)
 Frame = +1

Query  130  VTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDS  309
            V  NPA E+V+ LN NRT++KL +L  NPGL C+ALQY++  EG+C+ V  +   +PP+ 
Sbjct  2    VAGNPAHEMVSILNRNRTSQKLTNLNENPGLGCMALQYVEFCEGNCN-VNNTLGCEPPED  60

Query  310  SFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEv  489
             F + FAPNCGV++ T   ITG  L C SKYV+P  AFSDIL R  K+  +L +++HTEV
Sbjct  61   DFTQVFAPNCGVELPTFGAITGHILGCSSKYVAPEVAFSDILFRDNKTLSVLRNRSHTEV  120

Query  490  ggavsgsdgggPYFWCVLFSNGKS  561
            G  V+    G  +FWC+LFS+G +
Sbjct  121  GVGVARLHKGT-FFWCLLFSDGGT  143



>ref|XP_002320860.2| hypothetical protein POPTR_0014s04400g [Populus trichocarpa]
 gb|EEE99175.2| hypothetical protein POPTR_0014s04400g [Populus trichocarpa]
Length=230

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 107/164 (65%), Gaps = 5/164 (3%)
 Frame = +1

Query  70   QWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIK  249
            +W +L  +F  +   ++      NPA++LV  +N NRT++KLP L  NPGL C+ALQY++
Sbjct  14   KWIVLCQLFLATVVCSSHH---GNPANDLVDIINKNRTSQKLPQLNDNPGLGCMALQYVE  70

Query  250  AFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSD  429
              +G+C + G  + K PP+  F E F PNCGV++ T   +TG  + CQ KY+ PS AFS 
Sbjct  71   LCKGNCTSNGVVNCK-PPEDDFTEVFGPNCGVELPTFGTVTGHIVGCQPKYLEPSPAFSH  129

Query  430  ILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            +L++  K+  I+ +K+HTEVG  + G+  G  +FWC+LFS+GK+
Sbjct  130  VLVKDSKALSIIRNKSHTEVGVGLVGAHKGS-FFWCILFSDGKT  172



>ref|XP_011031741.1| PREDICTED: uncharacterized protein LOC105130770 [Populus euphratica]
Length=234

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 107/164 (65%), Gaps = 5/164 (3%)
 Frame = +1

Query  70   QWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIK  249
            +W +L  +F  +   ++      NPA++LV  +N NRT++KLP L  NPGL C+ALQY++
Sbjct  14   KWIVLCQLFLATVVCSSHH---GNPANDLVDIINKNRTSQKLPQLNDNPGLGCMALQYVE  70

Query  250  AFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSD  429
              +G+C + G  + K PP+  F E F PNCGV++ T   +TG  + CQ KY+ PS AFS 
Sbjct  71   LCKGNCTSNGVVNCK-PPEDDFTEIFGPNCGVELPTFGTVTGHIVGCQPKYLEPSPAFSH  129

Query  430  ILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            +L++  K+  I+ +K+HTEVG  + G+  G  +FWC+LFS+G++
Sbjct  130  VLVKDSKALSIIRNKSHTEVGVGMVGAHKGS-FFWCILFSDGQT  172



>ref|XP_002526498.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35889.1| conserved hypothetical protein [Ricinus communis]
Length=211

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 92/141 (65%), Gaps = 2/141 (1%)
 Frame = +1

Query  139  NPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSFV  318
            NPA++LV  +N NRTA+KLP L  +PGL C+ALQY++  + +C      + K PP+  F 
Sbjct  7    NPANDLVDIINKNRTAQKLPELNDSPGLGCMALQYVELCKSNCTGNSAVNCK-PPEDDFT  65

Query  319  ETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgga  498
            E FAPNCGV++ T   ITG  + C+ KYV PSQAFS +LI+  ++   L +K HTE  G 
Sbjct  66   EVFAPNCGVELPTFGTITGHIVGCELKYVEPSQAFSQVLIKDNRTLSFLKNKTHTE-VGV  124

Query  499  vsgsdgggPYFWCVLFSNGKS  561
                   GP+FWC+LFSNG++
Sbjct  125  GFVGFHKGPFFWCILFSNGQT  145



>ref|XP_007218315.1| hypothetical protein PRUPE_ppa010954mg [Prunus persica]
 gb|EMJ19514.1| hypothetical protein PRUPE_ppa010954mg [Prunus persica]
Length=229

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = +1

Query  73   WFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKA  252
            WF++ C    +A     SK   NPA++LV  +NNNRTA KL  L  +PGL C+ALQY + 
Sbjct  11   WFIIFCHLLLAALV--FSKNHGNPANDLVEIINNNRTAHKLSKLNDSPGLGCIALQYAEL  68

Query  253  FEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDI  432
             +G+C ++  +   KP +  F E FAP+CGV++ T   ITG  + CQSKY+ PS AF  +
Sbjct  69   CKGNC-SINNTVKCKPSEDDFTEVFAPDCGVELPTFGTITGHIVGCQSKYLEPSLAFVHV  127

Query  433  LIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            L+R  K+  IL +K+HTE  G        GP+FW VLFS+GK+
Sbjct  128  LVRDSKALSILRNKSHTE-VGVGMVRVHKGPFFWSVLFSSGKT  169



>gb|KHG03665.1| Lon protease, mitochondrial [Gossypium arboreum]
Length=225

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 95/146 (65%), Gaps = 2/146 (1%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            SK   NPA++LV  +N NRTA+KL  L  +PGL C+ALQY++  +G+C      + K PP
Sbjct  28   SKHHGNPANDLVEIINQNRTAQKLERLNDSPGLGCMALQYVELCKGNCSGNSAVNCK-PP  86

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
               F E FAPNCGV++ T+  ITG  + CQSKY  PS AF+++L++  KS  +L +K+H+
Sbjct  87   TDDFTEVFAPNCGVELPTIGTITGHIVGCQSKYTEPSLAFANVLVKDNKSLAVLRNKSHS  146

Query  484  EvggavsgsdgggPYFWCVLFSNGKS  561
            E  G        GP+FWCVLFSNG +
Sbjct  147  E-VGVGLIGFHKGPFFWCVLFSNGGT  171



>emb|CBI16715.3| unnamed protein product [Vitis vinifera]
Length=233

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 101/163 (62%), Gaps = 5/163 (3%)
 Frame = +1

Query  73   WFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKA  252
            WF +  +   +      SK   NPA++LV  +N NRTA+KLP L  NPGL C+ALQY++ 
Sbjct  10   WFTVSNLLLVTV---VYSKQHGNPANDLVDIINKNRTAQKLPKLNDNPGLGCMALQYVEE  66

Query  253  FEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDI  432
             +G+C      + + P +  F E FAPNCGV++ T   I+G  + CQSKY+  S+AFS +
Sbjct  67   CKGNCSKNNTINCR-PSEDDFTEIFAPNCGVELPTFGTISGHIVGCQSKYIESSEAFSQV  125

Query  433  LIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            LIR +K+  +L +K HTE  G     +  GP+ WCVLFS+G++
Sbjct  126  LIRDKKALSLLRNKTHTE-VGVGMIGNHKGPFLWCVLFSSGQT  167



>ref|XP_010661428.1| PREDICTED: uncharacterized protein LOC100263389 [Vitis vinifera]
Length=234

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 101/163 (62%), Gaps = 5/163 (3%)
 Frame = +1

Query  73   WFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKA  252
            WF +  +   +      SK   NPA++LV  +N NRTA+KLP L  NPGL C+ALQY++ 
Sbjct  11   WFTVSNLLLVTV---VYSKQHGNPANDLVDIINKNRTAQKLPKLNDNPGLGCMALQYVEE  67

Query  253  FEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDI  432
             +G+C      + + P +  F E FAPNCGV++ T   I+G  + CQSKY+  S+AFS +
Sbjct  68   CKGNCSKNNTINCR-PSEDDFTEIFAPNCGVELPTFGTISGHIVGCQSKYIESSEAFSQV  126

Query  433  LIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            LIR +K+  +L +K HTE  G     +  GP+ WCVLFS+G++
Sbjct  127  LIRDKKALSLLRNKTHTE-VGVGMIGNHKGPFLWCVLFSSGQT  168



>ref|XP_006576685.1| PREDICTED: uncharacterized protein LOC100804659 [Glycine max]
Length=226

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 102/173 (59%), Gaps = 5/173 (3%)
 Frame = +1

Query  43   SNLPTMAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGL  222
            +NL     L +F   C      +      +  NPA+++V  +N NRT +KLP L  +PGL
Sbjct  5    NNLSCCVLLHFF---CCCLLLPALVLSHHIHGNPANDIVDIINKNRTDEKLPRLNDSPGL  61

Query  223  ACLALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKY  402
             C+ALQY++  +G+C      + + PP+  F E FAPNCGV++ T   ITG  + CQ KY
Sbjct  62   GCMALQYVELCKGNCTENNVVNCR-PPEDDFTEVFAPNCGVELPTFGTITGHIVGCQRKY  120

Query  403  VSPSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            + P   FS++LI+ +KS  +L +K+HTE  G        GP+FWCVLFSNG++
Sbjct  121  IEPLLVFSEVLIKDKKSLSLLRNKSHTE-VGVGLVGLHKGPFFWCVLFSNGQT  172



>ref|XP_004510136.1| PREDICTED: uncharacterized protein LOC101510755 [Cicer arietinum]
Length=225

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 94/145 (65%), Gaps = 2/145 (1%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            S V  NPA+++V  +N NRT +KLP L  +PGL C+ALQY++  +G+C      + K PP
Sbjct  28   SHVHGNPANDIVDIINKNRTDQKLPLLNDSPGLGCMALQYVELCKGNCTDNNVVNCK-PP  86

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            +  F E FAPNCGV++ T   ITG  + CQ KY+ PS AFS +LI+ +KS   L +K+HT
Sbjct  87   EDDFTEVFAPNCGVELPTFGTITGLIVGCQRKYLEPSLAFSQVLIKDKKSLSSLTNKSHT  146

Query  484  EvggavsgsdgggPYFWCVLFSNGK  558
            E  G        GP+FWCVLFSNGK
Sbjct  147  E-IGVGLVGVHKGPFFWCVLFSNGK  170



>gb|KHN10896.1| hypothetical protein glysoja_041881 [Glycine soja]
Length=226

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 101/173 (58%), Gaps = 5/173 (3%)
 Frame = +1

Query  43   SNLPTMAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGL  222
            +NL     L +F   C      +      +  NPA ++V  +N NRT +KLP L  +PGL
Sbjct  5    NNLSCCVLLHFF---CCCLLLPALVLSHHIHGNPASDIVDIINKNRTDEKLPRLNDSPGL  61

Query  223  ACLALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKY  402
             C+ALQY++  +G+C      + + PP+  F E FAPNCGV++ T   ITG  + CQ KY
Sbjct  62   GCMALQYVELCKGNCTENNVVNCR-PPEDDFTEVFAPNCGVELPTFGTITGHIVGCQRKY  120

Query  403  VSPSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            + P   FS++LI+ +KS  +L +K+HTE  G        GP+FWCVLFSNG++
Sbjct  121  IEPLLVFSEVLIKDKKSLSLLKNKSHTE-VGVGLVGLHKGPFFWCVLFSNGQT  172



>ref|XP_008343981.1| PREDICTED: uncharacterized protein LOC103406763 [Malus domestica]
Length=229

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            SK+  NPA++LV  +NNNRTA KLP L  +PGL C+ALQY +  +G+C +    + K P 
Sbjct  26   SKIHGNPANDLVEIINNNRTAHKLPKLNDSPGLGCIALQYAELCKGNCTSNNTVNCK-PS  84

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            +  F + FAPNCGV++ T   IT   + CQSKY+ PS AF+ +L+R  K+  IL +K+HT
Sbjct  85   EEDFTQVFAPNCGVELPTFGTITAHIVGCQSKYLEPSLAFAHVLVRDNKALSILRNKSHT  144

Query  484  EvggavsgsdgggPYFWCVLFSNGKS  561
            E  G        GP+FW VLFS GK+
Sbjct  145  E-VGVGMVRVHKGPFFWSVLFSXGKT  169



>ref|XP_009119762.1| PREDICTED: uncharacterized protein LOC103844700 [Brassica rapa]
 emb|CDX90081.1| BnaA10g00010D [Brassica napus]
Length=222

 Score =   138 bits (348),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  127  KVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPD  306
            K   NPA E+V  LN NRTA KL  L+ +PGL C+ALQY +  EGDC+    +   +PP+
Sbjct  24   KSHGNPASEMVNVLNQNRTAWKLGKLHESPGLGCIALQYAELCEGDCNVNNNTLTCEPPE  83

Query  307  SSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTE  486
              F + FAPNCGV++ T   ITG  L C + Y +P  +FSDIL R  KS  +L +++HTE
Sbjct  84   DDFTQVFAPNCGVELPTFGTITGHVLGCGTHYATPEASFSDILFRDNKSLLVLRNRSHTE  143

Query  487  vggavsgsdgggPYFWCVLFSNGKS  561
            VG  ++    G  YFWC+LFS+G +
Sbjct  144  VGVGMARLHKGT-YFWCILFSDGGT  167



>ref|XP_006583506.1| PREDICTED: uncharacterized protein LOC100820431 [Glycine max]
 gb|KHN12251.1| hypothetical protein glysoja_035953 [Glycine soja]
Length=226

 Score =   138 bits (348),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 93/144 (65%), Gaps = 2/144 (1%)
 Frame = +1

Query  130  VTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDS  309
            +  NPA  +V  +N N T +KLP L  +PGL C+ALQY++  +G+C      + K PP+ 
Sbjct  31   IHGNPASNIVDIINKNLTDQKLPRLNDSPGLGCMALQYVELCKGNCTDNNVVNCK-PPED  89

Query  310  SFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEv  489
             F E FAPNCGV++ T   ITG  + CQ KY+ PS AFS++LI+ +KS  +L +K+HTE 
Sbjct  90   DFTEVFAPNCGVELPTFGTITGHIVGCQRKYLEPSLAFSEVLIKDEKSLSLLKNKSHTE-  148

Query  490  ggavsgsdgggPYFWCVLFSNGKS  561
             G        GP+FWCVLFSNGK+
Sbjct  149  VGVGLVGLHKGPFFWCVLFSNGKT  172



>ref|XP_002969463.1| hypothetical protein SELMODRAFT_440699 [Selaginella moellendorffii]
 gb|EFJ29551.1| hypothetical protein SELMODRAFT_440699 [Selaginella moellendorffii]
Length=335

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 95/144 (66%), Gaps = 1/144 (1%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
             K   NPAD L   +N N TA  LP+LY+NPGL C+ALQYI+A++G C  VG  + ++PP
Sbjct  20   GKSVKNPADALAREINRNLTAANLPTLYNNPGLGCVALQYIQAYQGQCSDVG-PNGQRPP  78

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            ++SF  T A NCGV  +++A ITG  LAC+++Y     AFS +L +   +   L S NHT
Sbjct  79   EASFKTTLADNCGVDPSSVADITGTILACETEYRDARYAFSSLLFKESSTLATLQSSNHT  138

Query  484  EvggavsgsdgggPYFWCVLFSNG  555
            E G  +SG +GG PYFWCVL SNG
Sbjct  139  EFGVGISGYEGGAPYFWCVLLSNG  162



>ref|XP_006418507.1| hypothetical protein EUTSA_v10008694mg [Eutrema salsugineum]
 gb|ESQ36860.1| hypothetical protein EUTSA_v10008694mg [Eutrema salsugineum]
Length=226

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 100/148 (68%), Gaps = 2/148 (1%)
 Frame = +1

Query  118  AQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKK  297
            A SK+  NPA E+V+ LN NRTA+KL  L  +PGL C+ALQY++  +G+C+ V  +   +
Sbjct  21   ATSKLDGNPASEMVSILNQNRTARKLSKLNESPGLGCMALQYVEHCKGNCN-VNDTLTCE  79

Query  298  PPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKN  477
            PP+  F + FAPNCGV++ +   ITG  + C +KYV+P  AFSDIL R  ++  +L +++
Sbjct  80   PPEDDFTQVFAPNCGVELPSFGTITGHVIGCSTKYVTPEVAFSDILFRDNQALLVLRNRS  139

Query  478  HTEvggavsgsdgggPYFWCVLFSNGKS  561
            HTEVG  ++    G  +FWC+LFS+G +
Sbjct  140  HTEVGVGMARLHKGT-FFWCLLFSDGGT  166



>ref|XP_007134369.1| hypothetical protein PHAVU_010G041900g, partial [Phaseolus vulgaris]
 gb|ESW06363.1| hypothetical protein PHAVU_010G041900g, partial [Phaseolus vulgaris]
Length=270

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 101/173 (58%), Gaps = 2/173 (1%)
 Frame = +1

Query  40   LSNLPTMAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPG  219
            + N P+   L +F          +      +  NPA ++V  +N NRT +KLP L  +PG
Sbjct  45   MMNNPSCCVLHFFCCFSCCLLLPALVLSHHIYGNPASDIVDIINKNRTDQKLPHLNDSPG  104

Query  220  LACLALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSK  399
            L C+ALQY++  +G+C      + K PP+  F E FAPNCGV++ T   ITG  + C+ +
Sbjct  105  LGCMALQYVELCKGNCTGNNAVNCK-PPEDDFTEVFAPNCGVELPTFGTITGHIVGCRRE  163

Query  400  YVSPSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            Y+ PS AFS++LI+ + S  +L +K+HTE  G        GP+FWCVLFSNG+
Sbjct  164  YLEPSLAFSEVLIKDKNSVSLLKNKSHTE-VGVGLVGLHKGPFFWCVLFSNGQ  215



>ref|XP_008232305.1| PREDICTED: uncharacterized protein LOC103331461 [Prunus mume]
Length=229

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = +1

Query  73   WFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKA  252
            WF+ +     +A     SK   NPA++LV  +NNNRTA KL  L  +PGL C+ALQY + 
Sbjct  11   WFIFVSHLLLAALV--CSKNHGNPANDLVEIINNNRTAHKLSKLNDSPGLGCIALQYAEL  68

Query  253  FEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDI  432
             +G+C ++  +   KP +  F E FAP+CGV++ T + ITG  + CQSKY+ PS AF  +
Sbjct  69   CKGNC-SINNTVNCKPSEDDFTEVFAPDCGVELPTFSTITGHIVGCQSKYLEPSLAFGHV  127

Query  433  LIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            L+R  K+  IL +K+HTE  G        GP+FW VLFS+GK+
Sbjct  128  LVRDSKALSILRNKSHTE-VGVGMVRVHKGPFFWSVLFSSGKT  169



>ref|XP_002961232.1| hypothetical protein SELMODRAFT_402947 [Selaginella moellendorffii]
 gb|EFJ38771.1| hypothetical protein SELMODRAFT_402947 [Selaginella moellendorffii]
Length=476

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 96/147 (65%), Gaps = 1/147 (1%)
 Frame = +1

Query  115  NAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAK  294
             A  K   NPAD L   +N N TA  LP+LY+NPGL C+ALQYI+A++G C  VG  + +
Sbjct  17   TAIGKSVKNPADALAREINRNLTAANLPTLYNNPGLGCVALQYIQAYQGQCSDVG-PNGQ  75

Query  295  KPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSK  474
            +PP++SF  T A NCGV  +++A ITG  LAC+++Y     AFS +L +   +   L S 
Sbjct  76   RPPEASFKTTLADNCGVDPSSVADITGTILACETEYRDARYAFSSLLFKESSTLATLQSS  135

Query  475  NHTEvggavsgsdgggPYFWCVLFSNG  555
            NHTE G  +SG +GG PYFWCVL SNG
Sbjct  136  NHTEFGVGISGYEGGAPYFWCVLLSNG  162



>ref|XP_002889329.1| hypothetical protein ARALYDRAFT_470049 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65588.1| hypothetical protein ARALYDRAFT_470049 [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score =   135 bits (341),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 92/139 (66%), Gaps = 2/139 (1%)
 Frame = +1

Query  139  NPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSFV  318
            NPA E+V  LN NRTA+KL  L  +PGL C+ALQY++  EG+C+ V  + +  PP+  F 
Sbjct  29   NPAHEMVGVLNQNRTAQKLGKLNESPGLGCMALQYVELCEGNCN-VNNTLSCDPPEDDFT  87

Query  319  ETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgga  498
            + FAPNCGV++ T   ITG  L C SKY +P   FSDIL R  K+  +L +++HTEVG  
Sbjct  88   QVFAPNCGVELPTFGTITGHILGCSSKYAAPEVTFSDILFRDNKALSVLRNRSHTEVGVG  147

Query  499  vsgsdgggPYFWCVLFSNG  555
            ++    G  +FWC+LFS+G
Sbjct  148  MARLHKGT-FFWCLLFSDG  165



>ref|XP_010934407.1| PREDICTED: uncharacterized protein LOC105054571 [Elaeis guineensis]
Length=222

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = +1

Query  91   IFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCD  270
            +F +  +    +K   NPA+E+V  +N NRTA KLP LY +PGL C+ALQYI    G+C 
Sbjct  15   LFLSVLALVTSAKNAGNPANEIVDYINKNRTANKLPKLYDSPGLGCMALQYISECMGNCS  74

Query  271  AVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQK  450
            +   S +  PP+    E +A NCGV++ T+  I+G  + CQ KY++P QA S++LI  +K
Sbjct  75   S-NNSLSCHPPEVDITEVYAANCGVELPTVDIISGHLVGCQWKYLNPEQALSEVLIPDEK  133

Query  451  SFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
               +L+SK HTE  G        GP FWC+LFS+GK+
Sbjct  134  RLSLLHSKEHTE-VGVGFNRAHHGPSFWCILFSSGKT  169



>ref|XP_011017317.1| PREDICTED: uncharacterized protein LOC105120708 [Populus euphratica]
Length=238

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 106/164 (65%), Gaps = 5/164 (3%)
 Frame = +1

Query  70   QWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIK  249
            +W +L  +   +A   +      NPA++LV  +N NRTA+KLP L  +PGL C+ALQY++
Sbjct  18   KWIVLCQLLLANAVCASHH---GNPANDLVDIINKNRTAQKLPELNDSPGLGCMALQYVE  74

Query  250  AFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSD  429
              + +C + G  + K PP+  F E F PNCGV++ T   ITG  + CQ+KY+ PS AFS 
Sbjct  75   LCKDNCSSNGVVNCK-PPEDDFTEIFGPNCGVELPTFGTITGHVVGCQAKYLEPSLAFSH  133

Query  430  ILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            +L++  K+  ++ +K+HTEVG  + G+  G  +FWC+LFS+G++
Sbjct  134  VLVKDSKALSLIRNKSHTEVGVGLVGARKGS-FFWCILFSDGQT  176



>ref|XP_002301223.2| hypothetical protein POPTR_0002s13690g [Populus trichocarpa]
 gb|EEE80496.2| hypothetical protein POPTR_0002s13690g [Populus trichocarpa]
Length=233

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 105/164 (64%), Gaps = 5/164 (3%)
 Frame = +1

Query  70   QWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIK  249
            +W +L  +   +A   +      NPA++LV  +N NRTA+KLP L  +PGL C+ALQY++
Sbjct  18   KWIVLCQLLLANAVCASHH---GNPANDLVDIINKNRTAQKLPELNDSPGLGCMALQYVE  74

Query  250  AFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSD  429
              + +C + G  + K PP+  F E F PNCGV++ T   ITG  + CQ+KY+ PS AFS 
Sbjct  75   LCKDNCTSNGVVNCK-PPEDDFTEVFGPNCGVELPTFGTITGHVVGCQAKYLEPSLAFSH  133

Query  430  ILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            +L+   K+  ++ +K+HTEVG  + G+  G  +FWC+LFS+G++
Sbjct  134  VLVNDSKALSLIRNKSHTEVGVGLVGARKGS-FFWCILFSDGQT  176



>ref|XP_010089779.1| hypothetical protein L484_008029 [Morus notabilis]
 gb|EXB38371.1| hypothetical protein L484_008029 [Morus notabilis]
Length=229

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 98/146 (67%), Gaps = 2/146 (1%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            SK   NPA++LV  +NNNRTA KL  L  +PGL C+ALQ+++  +G+C +    + K P 
Sbjct  24   SKDHGNPANDLVNMINNNRTAHKLTKLNDSPGLGCMALQFVEFCKGNCTSDNTVNCK-PS  82

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            +  F E FAPNCGV++ T   ITGR + C+SKY+ PS AFS++L+  +++  +L +K+H+
Sbjct  83   EDDFTEIFAPNCGVELPTFGTITGRIVGCRSKYLEPSLAFSNVLVPDKRTLSVLSNKSHS  142

Query  484  EvggavsgsdgggPYFWCVLFSNGKS  561
            E  G        GP+FWCVLFS+G++
Sbjct  143  E-VGVGMVGVHKGPFFWCVLFSSGRT  167



>emb|CDY15124.1| BnaC05g00030D [Brassica napus]
Length=222

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 93/145 (64%), Gaps = 2/145 (1%)
 Frame = +1

Query  127  KVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPD  306
            K   NPA E+V  LN NRTA KL  L+ +PGL C+ALQY +  EG+C+ V  +   +PP+
Sbjct  24   KSHGNPASEMVNVLNQNRTAWKLGKLHESPGLGCIALQYAELCEGNCN-VNNTLTCEPPE  82

Query  307  SSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTE  486
              F + FAPNCGV++ T   ITG  L C + Y +P  +FSDIL R  KS  +L +++HTE
Sbjct  83   DDFTQVFAPNCGVELPTFGTITGHVLGCGTHYATPEASFSDILFRDNKSLLVLRNRSHTE  142

Query  487  vggavsgsdgggPYFWCVLFSNGKS  561
            VG  ++    G  YFWC+LFS+G +
Sbjct  143  VGVGMARLHKGT-YFWCILFSDGGT  166



>ref|NP_171720.2| ferredoxin-like protein [Arabidopsis thaliana]
 dbj|BAC42294.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27397.1| ferredoxin-like protein [Arabidopsis thaliana]
Length=226

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 89/139 (64%), Gaps = 2/139 (1%)
 Frame = +1

Query  139  NPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSSFV  318
            N A E+V+ LN NRTA+KL  L  +PGL C+ALQY++  EG+C+ V  + + + P+  F 
Sbjct  29   NSAHEMVSILNQNRTARKLGKLNESPGLGCMALQYVELCEGNCN-VNNTLSCEHPEDDFT  87

Query  319  ETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvgga  498
            + FAPNCGV++ T   ITG  L C SKY +P  AFSDIL R   +  +L +++HTE  G 
Sbjct  88   QVFAPNCGVELPTFGTITGHILGCSSKYAAPEVAFSDILFRDSSALSVLRNRSHTE-VGV  146

Query  499  vsgsdgggPYFWCVLFSNG  555
                   G +FWC+LFS+G
Sbjct  147  GMARLHKGTFFWCLLFSDG  165



>ref|XP_011469540.1| PREDICTED: uncharacterized protein LOC101295667 [Fragaria vesca 
subsp. vesca]
Length=230

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 92/150 (61%), Gaps = 2/150 (1%)
 Frame = +1

Query  109  SANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSD  288
            +A   SK   NPA++LV  +NNNRT+ KL  L  +PGL C+ALQ+ K+ +G+C   G  +
Sbjct  20   AALVSSKHHGNPANDLVEIINNNRTSHKLSKLNDSPGLGCMALQFAKSCKGNCSRNGTIN  79

Query  289  AKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILY  468
               P +  F E FAPNCGV++ T   ITG  + C SKY+ PS AF ++L+   K+  IL 
Sbjct  80   CT-PSEDDFTEVFAPNCGVELPTFGTITGHIVGCHSKYLEPSLAFINVLVGSNKALSILR  138

Query  469  SKNHTEvggavsgsdgggPYFWCVLFSNGK  558
            +++H E  G        GP+FW VLFS+GK
Sbjct  139  NRSHNE-VGVGMVGVHKGPFFWTVLFSSGK  167



>ref|XP_009603590.1| PREDICTED: uncharacterized protein LOC104098542 [Nicotiana tomentosiformis]
 ref|XP_009603591.1| PREDICTED: uncharacterized protein LOC104098542 [Nicotiana tomentosiformis]
Length=230

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            SK   N A++LV  +N NRT +KLP L ++PGL C+ALQY +   G+C +    + + PP
Sbjct  25   SKYHGNSANDLVDIINKNRTTQKLPQLSNSPGLGCIALQYAEECMGNCTSNSSVNCQ-PP  83

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            +  F E FAPNCGV++ T   I+G  L CQ KY+ PS+AFS+ L+  +++  +L +K HT
Sbjct  84   EDDFTEVFAPNCGVELPTFGTISGYILGCQQKYLEPSEAFSNALVHDKRTLSLLRNKTHT  143

Query  484  Evggavsgs-dgggPYFWCVLFSNGK  558
            EVG  +  +    GPY WCVLFS+ +
Sbjct  144  EVGVGIIKAPKHKGPYLWCVLFSSSQ  169



>ref|XP_006838443.1| hypothetical protein AMTR_s00002p00129520 [Amborella trichopoda]
 gb|ERN01012.1| hypothetical protein AMTR_s00002p00129520 [Amborella trichopoda]
Length=276

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 93/142 (65%), Gaps = 1/142 (1%)
 Frame = +1

Query  130  VTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDS  309
            ++ NPAD+LV  +N NRTA K+P+L +NPGL C+ALQY +  E +C     +   K  + 
Sbjct  79   ISGNPADDLVDIINKNRTAHKVPTLQNNPGLGCMALQYTEHCERNCSK-NNTLTCKTQEE  137

Query  310  SFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEv  489
              VE FAPNCGV++ T+  I+G  + C  KY+ PS+ F  +L+R +K+   + SK H EV
Sbjct  138  DIVEVFAPNCGVELPTVNIISGHIVGCWYKYLEPSEIFGAVLVREKKALSFILSKEHKEV  197

Query  490  ggavsgsdgggPYFWCVLFSNG  555
            G  +S S+G  P+FWCVLFS+G
Sbjct  198  GVGLSSSNGKPPFFWCVLFSSG  219



>ref|XP_009767512.1| PREDICTED: uncharacterized protein LOC104218669 [Nicotiana sylvestris]
Length=230

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPP  303
            S+   N A++LV  +N NRT +KLP L ++PGL C+ALQY +   G+C +    + + PP
Sbjct  25   SEYHGNSANDLVDIINKNRTTQKLPQLSNSPGLGCIALQYAEECMGNCTSNNSVNCQ-PP  83

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            +  F E FAPNCGV++ T   I+G  L CQ KY+ PS+AFS+ L+  +++  +L +K HT
Sbjct  84   EDDFTEVFAPNCGVELPTFGTISGYILGCQHKYLEPSEAFSNALVHDKRTLSLLRNKTHT  143

Query  484  Ev-ggavsgsdgggPYFWCVLFSNGK  558
            EV  G +      GPY WCVLFS+ +
Sbjct  144  EVGVGIIKAHKHNGPYLWCVLFSSSQ  169



>ref|XP_010691985.1| PREDICTED: uncharacterized protein LOC104905223 [Beta vulgaris 
subsp. vulgaris]
Length=236

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 105/165 (64%), Gaps = 4/165 (2%)
 Frame = +1

Query  67   LQWFLLLCIFFTSASAN--AQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQ  240
            + ++L+LC+F+    A+     K   N A E+V  +N NRTA KLP+LY + GL C+ALQ
Sbjct  7    ISFYLVLCLFYGLLLADEVCSKKAHGNTAKEIVDLINRNRTAIKLPALYDSAGLGCMALQ  66

Query  241  YIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQA  420
            + +  + +C +   S + +P +  F E +AP+CGV++ T++ I+G+ + C SKY++PS+A
Sbjct  67   FAEVCKDNCTS-SNSVSCRPLEDDFTEVYAPDCGVELPTISTISGKIVGCWSKYLAPSEA  125

Query  421  FSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNG  555
            FS +++R + +  ++ +K HTE  G    S   G +FWCVL S+G
Sbjct  126  FSQVIVRDRNTLSLITNKTHTE-VGVGVASTRKGHFFWCVLLSSG  169



>emb|CDP09383.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = +1

Query  76   FLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAF  255
             ++LC  F +A  +  SK   NPAD+LV  +N NRTA KLP L ++PGL C+ALQ  +  
Sbjct  8    LIVLCSLFLAAVVS--SKHHGNPADDLVELINMNRTAHKLPELSNSPGLGCVALQCAEEC  65

Query  256  EGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDIL  435
            + +C +    +   P    F E FAPNCGV++ T   I+G  + C  K ++PS+AFS++L
Sbjct  66   QANCTSDNAINCH-PSADDFTEIFAPNCGVELPTFGTISGHVVGCHHKDLTPSEAFSNVL  124

Query  436  IRGQKSFDILYSKNHTEvggav-sgsdgggPYFWCVLFSNGKS  561
             R +KSF +L +++H EVG  +       GPY WCVLFS+ ++
Sbjct  125  FRDKKSFSLLGNRSHNEVGIGIFRAHKHKGPYLWCVLFSSSQT  167



>ref|XP_011085419.1| PREDICTED: uncharacterized protein LOC105167410 [Sesamum indicum]
Length=232

 Score =   125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 98/167 (59%), Gaps = 9/167 (5%)
 Frame = +1

Query  64   FLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQY  243
            FL   LLL  F         SK   N A++L+  +N NRTA+KLP L  +PGL C+ALQY
Sbjct  15   FLSSILLLAHF-------VYSKNHGNAANDLLDIINANRTAQKLPKLNPSPGLGCIALQY  67

Query  244  IKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAF  423
             +   G+C     +   +PP+  F E FAPNCGV++ T   I+G  L C+ KY+ P +AF
Sbjct  68   AEQCNGNCSR-NNTIHCQPPEDDFTEVFAPNCGVELPTFGTISGYMLGCRQKYLQPPEAF  126

Query  424  SDILIRGQKSFDILYSKNHTEv-ggavsgsdgggPYFWCVLFSNGKS  561
            S IL++ Q+S  +L ++  TEV  G +      GPY WCVLFSN ++
Sbjct  127  SHILVQDQRSLSLLRNRTLTEVGVGIIGVHKHKGPYIWCVLFSNSQT  173



>ref|XP_010056460.1| PREDICTED: uncharacterized protein LOC104444487 [Eucalyptus grandis]
 gb|KCW73216.1| hypothetical protein EUGRSUZ_E01677 [Eucalyptus grandis]
Length=224

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 90/148 (61%), Gaps = 3/148 (2%)
 Frame = +1

Query  106  ASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGS  285
            A+A   SK   NPA++LV  +N NRTA KLP+L  +PG+ C+ALQYI+  +G+C      
Sbjct  21   AAALVCSKNHGNPANDLVDTINKNRTALKLPALNDSPGIGCMALQYIELCKGNC--TNNV  78

Query  286  DAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDIL  465
                  +  F E FAPNCGV++ T   +TG+ + C SKY+ PS AFS +L++   S  +L
Sbjct  79   PHCNVTEDDFTEIFAPNCGVELPTFGTLTGQIVGCHSKYLEPSLAFSQVLVKDNTSLSLL  138

Query  466  YSKNHTEvggavsgsdgggPYFWCVLFS  549
             +K+HTE  G        GP FWCVLFS
Sbjct  139  RNKSHTE-VGVGLVRAHKGPSFWCVLFS  165



>ref|XP_010056472.1| PREDICTED: uncharacterized protein LOC104444502 [Eucalyptus grandis]
 gb|KCW73238.1| hypothetical protein EUGRSUZ_E01705 [Eucalyptus grandis]
Length=224

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 90/148 (61%), Gaps = 3/148 (2%)
 Frame = +1

Query  106  ASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGS  285
            A+A   SK   NPA++LV  +N NRTA KLP+L  +PG+ C+ALQYI+  +G+C      
Sbjct  21   AAALVCSKNHGNPANDLVDMINKNRTALKLPALNDSPGIGCMALQYIELCKGNC--TNNV  78

Query  286  DAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDIL  465
                  +  F E FAPNCGV++ T   +TG+ + C SKY+ PS AFS +L++   S  +L
Sbjct  79   PHCNVTEDDFTEIFAPNCGVELPTFGTLTGQIVGCHSKYLEPSLAFSQVLVKDNTSLSLL  138

Query  466  YSKNHTEvggavsgsdgggPYFWCVLFS  549
             +K+HTE  G        GP FWCVLFS
Sbjct  139  RNKSHTE-VGVGLVRAHKGPSFWCVLFS  165



>ref|XP_004145028.1| PREDICTED: uncharacterized protein LOC101213121 [Cucumis sativus]
 ref|XP_004153036.1| PREDICTED: uncharacterized protein LOC101209494 [Cucumis sativus]
 gb|KGN46297.1| hypothetical protein Csa_6G080400 [Cucumis sativus]
Length=220

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 100/161 (62%), Gaps = 4/161 (2%)
 Frame = +1

Query  79   LLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFE  258
             +LC F ++   +  SK   NPA++LV  +N NRTA K+  L  + GL C+ALQ++   +
Sbjct  11   FMLCSFLSAVLVS--SKFHGNPANDLVDIINRNRTAAKISHLSDSAGLGCMALQFVNFCK  68

Query  259  GDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILI  438
            G+C +    +   P   +F E FAP+CGV++ T   ITG+ +ACQ +Y+ P++AFS  L+
Sbjct  69   GNCTSNNTVNCN-PSSDNFTEIFAPDCGVELPTFDTITGQIVACQHEYLEPTEAFSRALV  127

Query  439  RGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
              +K+  ++ +K+HTE  G        GP+FWCVLFS+GK+
Sbjct  128  SDKKTLSLMKNKSHTE-VGVGIVGVHKGPFFWCVLFSSGKT  167



>ref|XP_004160685.1| PREDICTED: uncharacterized protein LOC101226210 [Cucumis sativus]
Length=230

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 100/161 (62%), Gaps = 4/161 (2%)
 Frame = +1

Query  79   LLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFE  258
             +LC F ++   +  SK   NPA++LV  +N NRTA K+  L  + GL C+ALQ++   +
Sbjct  11   FMLCSFLSAVLVS--SKFHGNPANDLVDIINRNRTAAKISHLSDSAGLGCMALQFVNFCK  68

Query  259  GDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILI  438
            G+C +    +   P   +F E FAP+CGV++ T   ITG+ +ACQ +Y+ P++AFS  L+
Sbjct  69   GNCTSNNTVNCN-PSSDNFTEIFAPDCGVELPTFDTITGQIVACQHEYLEPTEAFSRALV  127

Query  439  RGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
              +K+  ++ +K+HTE  G        GP+FWCVLFS+GK+
Sbjct  128  SDKKTLSLMKNKSHTE-VGVGIVGVHKGPFFWCVLFSSGKT  167



>ref|XP_009407978.1| PREDICTED: uncharacterized protein LOC103990528 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=222

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 99/162 (61%), Gaps = 4/162 (2%)
 Frame = +1

Query  76   FLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAF  255
            F + C+    A   A++K   NPA+E+V  +N NRTA KLP LY++PGL C+ALQ++   
Sbjct  9    FYIFCLIVLVAVVWAENK--GNPANEIVDFVNKNRTATKLPKLYNSPGLGCMALQFLLEC  66

Query  256  EGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDIL  435
              +C +   + A +P +    E +APNCGV++ T+  I+G+ + C   +++P QAFS +L
Sbjct  67   TQNCTS-NNTLACQPAEIDITEVYAPNCGVELPTIDTISGQLVGCYWSHLNPEQAFSTVL  125

Query  436  IRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            +  +KS  +++SK H E  G        GP+ WC+LFS+G +
Sbjct  126  VPTKKSLSVIHSKEHHE-VGVGYVRGHHGPFLWCILFSSGNA  166



>ref|XP_006354640.1| PREDICTED: uncharacterized protein LOC102586844 [Solanum tuberosum]
Length=230

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 98/166 (59%), Gaps = 9/166 (5%)
 Frame = +1

Query  64   FLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQY  243
            F  W LL+ +  +S       K   N A++LV  +N NRT +KLP L ++PGL C+ALQY
Sbjct  12   FALWSLLMAVLVSS-------KHHGNSANDLVDIINKNRTDQKLPQLSNSPGLGCIALQY  64

Query  244  IKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAF  423
             +   G+C +    +   P +  F E FAPNCGV++ T   I+G  L CQ KY+ P +AF
Sbjct  65   AEECMGNCSSNNSVNCH-PSEDDFTEIFAPNCGVELPTFGTISGHILGCQPKYLEPLEAF  123

Query  424  SDILIRGQKSFDILYSKNHTEv-ggavsgsdgggPYFWCVLFSNGK  558
            S++L+  +++  +L +K +TEV  G +      GPY WC+LFS+ +
Sbjct  124  SNVLVHDKRTLSLLRNKTYTEVGVGIIKAHKHKGPYLWCILFSSSQ  169



>ref|XP_008460047.1| PREDICTED: uncharacterized protein LOC103498980 [Cucumis melo]
Length=220

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 99/161 (61%), Gaps = 4/161 (2%)
 Frame = +1

Query  79   LLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFE  258
             +LC F  +   +  SK   NPA++LV  +N NRTA KL  L  + GL C+ALQ+I   +
Sbjct  11   FILCSFLFAVLVS--SKFHGNPANDLVDIINRNRTAAKLSHLSDSAGLGCMALQFINFCK  68

Query  259  GDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILI  438
            G+C +    +   P   +F E FAP+CGV++ T   ITG+ +ACQ +Y+ P++AFS  L+
Sbjct  69   GNCTSNNTVNCN-PSSDNFTEIFAPDCGVELPTFDTITGQIVACQLEYLEPTEAFSRALV  127

Query  439  RGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
              +K+  +L +K+HTE  G        GP+FWCVLFS+GK+
Sbjct  128  PDKKTLSLLKNKSHTE-VGVGLVGVHKGPFFWCVLFSSGKT  167



>ref|XP_009407979.1| PREDICTED: uncharacterized protein LOC103990528 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=210

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 92/145 (63%), Gaps = 2/145 (1%)
 Frame = +1

Query  127  KVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPD  306
            ++  NPA+E+V  +N NRTA KLP LY++PGL C+ALQ++     +C +   + A +P +
Sbjct  12   EIHGNPANEIVDFVNKNRTATKLPKLYNSPGLGCMALQFLLECTQNCTS-NNTLACQPAE  70

Query  307  SSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTE  486
                E +APNCGV++ T+  I+G+ + C   +++P QAFS +L+  +KS  +++SK H E
Sbjct  71   IDITEVYAPNCGVELPTIDTISGQLVGCYWSHLNPEQAFSTVLVPTKKSLSVIHSKEHHE  130

Query  487  vggavsgsdgggPYFWCVLFSNGKS  561
              G        GP+ WC+LFS+G +
Sbjct  131  -VGVGYVRGHHGPFLWCILFSSGNA  154



>ref|XP_004229711.1| PREDICTED: uncharacterized protein LOC101247064 [Solanum lycopersicum]
Length=232

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 87/142 (61%), Gaps = 2/142 (1%)
 Frame = +1

Query  127  KVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPD  306
            K   N A++LV  +N NRT +KLP L ++ GL C+ALQY K   G+C +    +   P +
Sbjct  27   KHHGNSANDLVDIINKNRTGQKLPQLSNSRGLGCIALQYAKECMGNCSSSKSVNCH-PSE  85

Query  307  SSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTE  486
              F E FAPNCGV++ T   I+G  L CQ KY+ P +AFS++L+  +++  +L +K HTE
Sbjct  86   DDFTEIFAPNCGVELPTFGTISGFILGCQPKYLEPLEAFSNVLVHDKRTLSLLKNKTHTE  145

Query  487  v-ggavsgsdgggPYFWCVLFS  549
            V  G +      GPY WC+LFS
Sbjct  146  VGVGIIKAHKHKGPYLWCILFS  167



>gb|KCW73237.1| hypothetical protein EUGRSUZ_E01705 [Eucalyptus grandis]
Length=221

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 85/139 (61%), Gaps = 3/139 (2%)
 Frame = +1

Query  133  TDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDSS  312
            + N A++LV  +N NRTA KLP+L  +PG+ C+ALQYI+  +G+C            +  
Sbjct  27   SKNHANDLVDMINKNRTALKLPALNDSPGIGCMALQYIELCKGNC--TNNVPHCNVTEDD  84

Query  313  FVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvg  492
            F E FAPNCGV++ T   +TG+ + C SKY+ PS AFS +L++   S  +L +K+HTE  
Sbjct  85   FTEIFAPNCGVELPTFGTLTGQIVGCHSKYLEPSLAFSQVLVKDNTSLSLLRNKSHTE-V  143

Query  493  gavsgsdgggPYFWCVLFS  549
            G        GP FWCVLFS
Sbjct  144  GVGLVRAHKGPSFWCVLFS  162



>ref|XP_006649217.1| PREDICTED: uncharacterized protein LOC102710564 [Oryza brachyantha]
Length=232

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 96/174 (55%), Gaps = 9/174 (5%)
 Frame = +1

Query  67   LQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYI  246
            LQ   +L ++     A + +K+  NPA++LVA +N NRTA KLP L ++ GL C+ALQYI
Sbjct  7    LQLLAMLGLWMLQLGAVSPAKIHGNPANDLVALVNANRTASKLPRLRTSAGLGCMALQYI  66

Query  247  -KAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAF  423
             +   GD  A   + A +PP++   E +A NCGV++ T+  ITGR + C  +      A 
Sbjct  67   SECIGGDACAGDNTVACRPPEAHITEVYAANCGVELPTVDVITGRLVGCHRQRSDAESAL  126

Query  424  SDILIRGQ--------KSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
              +L  G          +  ++  K HT+VG     +   GP+FWC+LFS+G +
Sbjct  127  EAVLSSGNGNGNSTTATALAVIRGKEHTQVGAGFDRAHRHGPFFWCLLFSSGSA  180



>ref|NP_001048640.1| Os02g0834300 [Oryza sativa Japonica Group]
 dbj|BAD28464.1| ferredoxin-like [Oryza sativa Japonica Group]
 dbj|BAD29590.1| ferredoxin-like [Oryza sativa Japonica Group]
 dbj|BAF10554.1| Os02g0834300 [Oryza sativa Japonica Group]
 gb|EAZ25221.1| hypothetical protein OsJ_09022 [Oryza sativa Japonica Group]
 dbj|BAG99761.1| unnamed protein product [Oryza sativa Japonica Group]
Length=230

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 96/176 (55%), Gaps = 18/176 (10%)
 Frame = +1

Query  61   AFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQ  240
            +F  W LLL +      A + +K+  NPA++LVA +N NRTA KLP L ++ GL C+ALQ
Sbjct  7    SFGLWMLLLML-----EAVSPAKIHGNPANDLVALVNANRTATKLPHLRTSAGLGCMALQ  61

Query  241  YIKAFEGDCDAVG------GSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKY  402
            YI     DC  +G       + A +PP++   E +A NCGV++ T+  ITGR L C  + 
Sbjct  62   YIS----DCIGIGIGCAGDNTVACQPPEAHITEVYAANCGVELPTVDVITGRLLGCHRQR  117

Query  403  VSPSQAFSDILIRGQKSF---DILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
                 A   +L     S     ++  K HT+VG     +   GP+FWC+LFS+G +
Sbjct  118  SDAEAALEAVLSGSGNSTAARAVIRGKEHTQVGAGFDRAHRRGPFFWCLLFSSGSA  173



>gb|EAY88130.1| hypothetical protein OsI_09566 [Oryza sativa Indica Group]
Length=228

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 96/176 (55%), Gaps = 18/176 (10%)
 Frame = +1

Query  61   AFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQ  240
            +F  W LLL +      A + +K+  NPA++LVA +N NRTA KLP L ++ GL C+ALQ
Sbjct  7    SFGLWMLLLML-----EAVSPAKIHGNPANDLVALVNANRTATKLPHLRTSAGLGCMALQ  61

Query  241  YIKAFEGDCDAVG------GSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKY  402
            YI     DC  +G       + A +PP++   E +A NCGV++ T+  ITGR L C  + 
Sbjct  62   YIS----DCIGIGIGCAGDNTVACQPPEAHITEVYAANCGVELPTVDVITGRLLGCHRQR  117

Query  403  VSPSQAFSDILIRGQKSF---DILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
                 A   +L     S     ++  K HT+VG     +   GP+FWC+LFS+G +
Sbjct  118  SDAEAALEAVLSGSGNSTAARAVIRGKEHTQVGAGFDRAHRRGPFFWCLLFSSGSA  173



>gb|EYU40325.1| hypothetical protein MIMGU_mgv1a013003mg [Erythranthe guttata]
Length=233

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 91/170 (54%), Gaps = 5/170 (3%)
 Frame = +1

Query  58   MAFLQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLAL  237
            + F  W  L  I   +      SK   N A++L+  +N NRTA+ LP++  N GL C+AL
Sbjct  8    LGFFNWVSLSSILILAPLVC--SKNHGNAANDLLEIINKNRTAQNLPNVTENRGLGCIAL  65

Query  238  QYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQ  417
            QY +   G+C +          D  F E FAPNCGV++ T   I+G  L CQ KY+ P +
Sbjct  66   QYAQQCRGNCTSNNTLHCHAQEDD-FTEIFAPNCGVELPTFGSISGTVLGCQQKYLHPQE  124

Query  418  AFSDILIRGQKSFDILYSKNHTEvggavs--gsdgggPYFWCVLFSNGKS  561
            AFS +L  G K   ++ + + T+VG  +      G GPY WCVLFS+ K 
Sbjct  125  AFSSLLFPGPKKLSLVKNGSFTQVGVGIIGGRKKGKGPYIWCVLFSDSKG  174



>ref|NP_001143617.1| uncharacterized protein LOC100276332 [Zea mays]
 gb|ACF82333.1| unknown [Zea mays]
 gb|ACG33559.1| hypothetical protein [Zea mays]
 gb|AFW61890.1| hypothetical protein ZEAMMB73_398406 [Zea mays]
Length=142

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  304  DSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHT  483
            +SSF +TFAP CGVQ  TL++ITGR +ACQS+Y++P++AF  +L+   K   IL SKNHT
Sbjct  2    ESSFTDTFAPTCGVQATTLSKITGRLVACQSQYLAPAEAFGVLLVNDAKGLQILRSKNHT  61

Query  484  EvggavsgsdgggPYFWCVLFSNGK  558
            EVG AVSG+DGGGPYFWCVLFS+GK
Sbjct  62   EVGAAVSGTDGGGPYFWCVLFSDGK  86



>ref|XP_006445474.1| hypothetical protein CICLE_v10022088mg [Citrus clementina]
 gb|ESR58714.1| hypothetical protein CICLE_v10022088mg [Citrus clementina]
 gb|KDO85420.1| hypothetical protein CISIN_1g027242mg [Citrus sinensis]
Length=168

 Score =   105 bits (263),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +1

Query  229  LALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVS  408
            +ALQY++  +G+C + G +   KPP+  F E FAPNCGV++ T   ITG  + C++KY+ 
Sbjct  1    MALQYVELCKGNC-STGNAVNCKPPEDDFTEVFAPNCGVELPTFGTITGHMVGCKTKYLE  59

Query  409  PSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            PS+AFSD+L++ +K+  +L +K+HTE    V        +FWCVLFS+GK+
Sbjct  60   PSRAFSDVLVKDKKALSLLRNKSHTE--VGVGLVGFHKSFFWCVLFSDGKT  108



>gb|KJB40944.1| hypothetical protein B456_007G084300 [Gossypium raimondii]
 gb|KJB40945.1| hypothetical protein B456_007G084300 [Gossypium raimondii]
Length=163

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (65%), Gaps = 2/111 (2%)
 Frame = +1

Query  229  LALQYIKAFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVS  408
            +ALQY++  +G+C      + K PP   F E FAPNCGV++ T+  ITG  + CQSKY  
Sbjct  1    MALQYVELCKGNCSGNSAVNCK-PPTDDFTEVFAPNCGVELPTIGTITGHIVGCQSKYTE  59

Query  409  PSQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            PS AF+++L++ +KS  +L +K+H+E  G        GP+FWCVLFSNG +
Sbjct  60   PSLAFANVLVKDKKSLTVLRNKSHSE-VGVGLIGFHKGPFFWCVLFSNGGT  109



>ref|XP_002454855.1| hypothetical protein SORBIDRAFT_04g038630 [Sorghum bicolor]
 gb|EES07831.1| hypothetical protein SORBIDRAFT_04g038630 [Sorghum bicolor]
Length=246

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKA--FEGDCDAVGGSDAKK  297
            +K+  NPA++LVA +N  R A KLP+L ++ GL C+ALQYI      G   + G + A +
Sbjct  29   AKIHGNPANDLVALINGKRAASKLPALRNSRGLGCMALQYISECMATGAACSSGNTVACQ  88

Query  298  PPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIR----------GQ  447
            PP++   E +A NCGV++ T+  I+GR + C      P  A   +L              
Sbjct  89   PPEAHITEVYAANCGVELPTVDVISGRLVGCHRDRDGPEDALQAVLASPTGNGNGNSTTT  148

Query  448  KSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
             +  ++  K HT+VG     +   GP+FWC+LFS+G +
Sbjct  149  NALAVIRGKEHTQVGAGFDRAHRRGPFFWCLLFSSGSA  186



>ref|NP_001143408.1| hypothetical protein precursor [Zea mays]
 gb|ACG31783.1| hypothetical protein [Zea mays]
 gb|ACL53876.1| unknown [Zea mays]
 gb|AFW74175.1| hypothetical protein ZEAMMB73_452498 [Zea mays]
Length=226

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 89/168 (53%), Gaps = 14/168 (8%)
 Frame = +1

Query  67   LQWFLLLCIFFTSASANAQSKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYI  246
            L   LLLC     A  ++ +K+  NPA++LVA +N  R A +LP+L ++ GL C+ALQYI
Sbjct  9    LVILLLLCTRTLPAGVSS-AKIHGNPANDLVALINGKREASRLPALRNSRGLGCMALQYI  67

Query  247  K-----AFEGDCDAVGGSDAKKPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSP  411
                     G   + G + A + P++   E +A NCGV++ T+  I+GR   C      P
Sbjct  68   SECMAATTGGAACSSGNTMACQTPEAHITEVYAANCGVELPTVDVISGRLFGCHRDRDGP  127

Query  412  SQAFSDILIRGQKSFDILYSKNHTEvggavsgsdgggPYFWCVLFSNG  555
              A +        +  ++  K HT+     +G D  GP+FWC+LFS+G
Sbjct  128  EDALAS-----ATALSVIRGKEHTQ---VGAGFDRRGPFFWCLLFSSG  167



>ref|XP_004954543.1| PREDICTED: uncharacterized protein LOC101768588 isoform X2 [Setaria 
italica]
Length=224

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 83/149 (56%), Gaps = 3/149 (2%)
 Frame = +1

Query  124  SKVTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSD---AK  294
            +K+  NPA+ELVA +N  R A KLP L ++ GL C+ALQYI        A   SD   A 
Sbjct  21   AKIHGNPANELVALVNGRRAASKLPLLRNSAGLGCMALQYISECMAMAAAACSSDNTVAC  80

Query  295  KPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSK  474
            +PP++   E +A NCGV++ T+  I+GR + C +       A +     G     ++  K
Sbjct  81   QPPEAHITEVYATNCGVELPTVDIISGRLVGCCNHREDVMVASAMANGNGSTQSQMMLGK  140

Query  475  NHTEvggavsgsdgggPYFWCVLFSNGKS  561
             H++VG A+      GP+FWC+LFS+G +
Sbjct  141  EHSQVGAALDRHGRDGPFFWCLLFSSGSA  169



>ref|XP_004954542.1| PREDICTED: uncharacterized protein LOC101768588 isoform X1 [Setaria 
italica]
Length=238

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 76/140 (54%), Gaps = 3/140 (2%)
 Frame = +1

Query  151  ELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSD---AKKPPDSSFVE  321
            ELVA +N  R A KLP L ++ GL C+ALQYI        A   SD   A +PP++   E
Sbjct  44   ELVALVNGRRAASKLPLLRNSAGLGCMALQYISECMAMAAAACSSDNTVACQPPEAHITE  103

Query  322  TFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSKNHTEvggav  501
             +A NCGV++ T+  I+GR + C +       A +     G     ++  K H++VG A+
Sbjct  104  VYATNCGVELPTVDIISGRLVGCCNHREDVMVASAMANGNGSTQSQMMLGKEHSQVGAAL  163

Query  502  sgsdgggPYFWCVLFSNGKS  561
                  GP+FWC+LFS+G +
Sbjct  164  DRHGRDGPFFWCLLFSSGSA  183



>ref|XP_002438638.1| hypothetical protein SORBIDRAFT_10g023450 [Sorghum bicolor]
 gb|EER90005.1| hypothetical protein SORBIDRAFT_10g023450 [Sorghum bicolor]
Length=184

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 78/154 (51%), Gaps = 19/154 (12%)
 Frame = +1

Query  130  VTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDS  309
            V  NP + LVA +N  R   KLP+L ++ GL C+ LQYI +  G+ + V    A +PP++
Sbjct  4    VARNPTNNLVALINGRRAVSKLPALCNSKGLGCMKLQYI-SDSGNSNTV----ACQPPET  58

Query  310  SFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDIL--IRGQKSFD--------  459
               E FA NCGV++ T+  I+G    C      P  A   +L    G  S +        
Sbjct  59   HITEVFAANCGVELPTVDVISG----CHRDRDGPEDALQAVLAAATGNSSTNATQAAALA  114

Query  460  ILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            ++  K HT+VG     +    P+FWC+ F++G +
Sbjct  115  VIRGKEHTQVGAVFDRAHRRKPFFWCLFFTSGSA  148



>ref|XP_002452370.1| hypothetical protein SORBIDRAFT_04g024560 [Sorghum bicolor]
 gb|EES05346.1| hypothetical protein SORBIDRAFT_04g024560 [Sorghum bicolor]
Length=184

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 77/154 (50%), Gaps = 19/154 (12%)
 Frame = +1

Query  130  VTDNPADELVAALNNNRTAKKLPSLYSNPGLACLALQYIKAFEGDCDAVGGSDAKKPPDS  309
            V  NP + LVA +N  R   KLP+L ++ GL C+ LQYI +  G+ + V      +PP++
Sbjct  4    VARNPTNNLVALINGRRAVSKLPALCNSRGLGCMTLQYI-SDSGNSNTV----VCQPPET  58

Query  310  SFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDIL--IRGQKSFD--------  459
               E FA NCGV++ T+  I+G    C      P  A   +L    G  S +        
Sbjct  59   HITEVFAANCGVELPTVDVISG----CHKDRDGPEDALQAVLAAATGNSSTNATQAAALA  114

Query  460  ILYSKNHTEvggavsgsdgggPYFWCVLFSNGKS  561
            ++  K HT+VG     +    P+FWC+ FS+G +
Sbjct  115  VIRGKEHTQVGAGFDRAHRRRPFFWCLFFSSGSA  148



>ref|XP_003570747.1| PREDICTED: uncharacterized protein LOC100838594 [Brachypodium 
distachyon]
Length=237

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 76/148 (51%), Gaps = 20/148 (14%)
 Frame = +1

Query  151  ELVAALNNNRTAKKLPSLYSNPGLACLALQYIK----AFEGDCDAVGGSDAK--------  294
            +LVA +N  RTA KLP L ++ GL C+ALQYI     A    C A   ++          
Sbjct  41   DLVALINAKRTASKLPPLRNSKGLGCMALQYISHCIVANANSCSATTTTNNNNTVTPPVC  100

Query  295  KPPDSSFVETFAPNCGVQVNTLAQITGRFLACQSKYVSPSQAFSDILIRGQKSFDILYSK  474
            + PD+   E +A NCGV++ T+  I+GR   C +   + S   +DI      +  ++  K
Sbjct  101  QAPDTDITEVYAANCGVELPTVDVISGRLAGCSTDAEADS-CLADI------NMTVIRGK  153

Query  475  NHTEvgga-vsgsdgggPYFWCVLFSNG  555
             HT+VG          GP+FWC+LFS+G
Sbjct  154  EHTQVGAGFDRARRHHGPFFWCLLFSSG  181



>gb|AFK43925.1| unknown [Medicago truncatula]
Length=65

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  561  RFAIAEEHTPEIRATAITATHSTANLGVVLAVEYI  457
            RFAIA++HTPEIR  +I+  +S+ +L V+L VEY+
Sbjct  31   RFAIAKQHTPEIRRPSISTGYSSTDLSVILTVEYV  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880