BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H04

Length=500
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626290.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    204   7e-60   Nicotiana tomentosiformis
ref|XP_009789896.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    204   7e-60   Nicotiana sylvestris
ref|XP_004252580.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    201   1e-58   Solanum lycopersicum
ref|XP_006360699.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    201   2e-58   Solanum tuberosum [potatoes]
emb|CDP12110.1|  unnamed protein product                                196   2e-56   Coffea canephora [robusta coffee]
ref|XP_006476449.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    191   6e-55   Citrus sinensis [apfelsine]
ref|XP_006476447.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    191   6e-55   Citrus sinensis [apfelsine]
ref|XP_006439417.1|  hypothetical protein CICLE_v10019859mg             191   6e-55   Citrus clementina [clementine]
gb|AIU64845.1|  6-phosphogluconate dehydrogenase                        191   6e-55   Prunus sibirica [Siberian apricot]
ref|XP_008238987.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    191   7e-55   Prunus mume [ume]
gb|KDO76416.1|  hypothetical protein CISIN_1g010652mg                   191   9e-55   Citrus sinensis [apfelsine]
gb|KDO76415.1|  hypothetical protein CISIN_1g010652mg                   191   9e-55   Citrus sinensis [apfelsine]
gb|KDO76417.1|  hypothetical protein CISIN_1g010652mg                   191   1e-54   Citrus sinensis [apfelsine]
ref|XP_007040418.1|  6-phosphogluconate dehydrogenase family prot...    191   1e-54   
ref|XP_009334464.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    190   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_007040417.1|  6-phosphogluconate dehydrogenase family prot...    191   2e-54   
ref|XP_004149760.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    190   2e-54   
gb|ACM68927.1|  6-phosphogluconate dehydrogenase                        190   2e-54   Cucumis sativus [cucumbers]
ref|XP_004168459.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    190   2e-54   
ref|XP_010105006.1|  6-phosphogluconate dehydrogenase                   190   2e-54   Morus notabilis
emb|CDY34406.1|  BnaA09g11480D                                          179   2e-54   Brassica napus [oilseed rape]
ref|XP_009336262.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    190   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_008451978.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    189   4e-54   Cucumis melo [Oriental melon]
gb|KJB52238.1|  hypothetical protein B456_008G251800                    188   6e-54   Gossypium raimondii
gb|KEH21177.1|  decarboxylating-like 6-phosphogluconate dehydroge...    188   8e-54   Medicago truncatula
ref|XP_002275970.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    187   4e-53   Vitis vinifera
ref|XP_004503648.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    186   5e-53   Cicer arietinum [garbanzo]
gb|EYU40043.1|  hypothetical protein MIMGU_mgv1a019477mg                186   5e-53   Erythranthe guttata [common monkey flower]
emb|CAN63456.1|  hypothetical protein VITISV_008240                     186   7e-53   Vitis vinifera
ref|XP_010545301.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    186   7e-53   Tarenaya hassleriana [spider flower]
ref|XP_010447780.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    186   9e-53   Camelina sativa [gold-of-pleasure]
ref|XP_007160132.1|  hypothetical protein PHAVU_002G295300g             186   9e-53   Phaseolus vulgaris [French bean]
ref|XP_010436115.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    185   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010533610.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphoglu...    185   2e-52   
ref|XP_002868582.1|  6-phosphogluconate dehydrogenase family protein    185   2e-52   
ref|NP_198982.1|  6-phosphogluconate dehydrogenase, decarboxylati...    184   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003533072.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    184   4e-52   Glycine max [soybeans]
ref|XP_009140108.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    184   4e-52   Brassica rapa
emb|CDY39725.1|  BnaA04g11280D                                          184   4e-52   Brassica napus [oilseed rape]
emb|CDY44457.1|  BnaCnng11100D                                          184   4e-52   Brassica napus [oilseed rape]
ref|XP_011080880.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    184   5e-52   Sesamum indicum [beniseed]
ref|XP_002517676.1|  6-phosphogluconate dehydrogenase, putative         183   8e-52   
ref|XP_006286028.1|  hypothetical protein CARUB_v10007559mg             182   9e-52   
ref|XP_011026944.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    182   2e-51   Populus euphratica
ref|XP_010261979.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    182   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_002297992.1|  6-phosphogluconate dehydrogenase family protein    182   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_002509902.1|  6-phosphogluconate dehydrogenase, putative         182   2e-51   Ricinus communis
ref|XP_010441331.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    182   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010273961.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    182   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_011462415.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    181   4e-51   Fragaria vesca subsp. vesca
gb|AAM61057.1|  6-phosphogluconate dehydrogenase                        181   4e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KDP25346.1|  hypothetical protein JCGZ_20502                         181   4e-51   Jatropha curcas
emb|CDY25568.1|  BnaC09g11930D                                          181   4e-51   Brassica napus [oilseed rape]
ref|XP_009112895.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    181   4e-51   Brassica rapa
gb|EPS67575.1|  hypothetical protein M569_07199                         181   5e-51   Genlisea aurea
ref|XP_011073556.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    181   6e-51   Sesamum indicum [beniseed]
ref|XP_006391656.1|  hypothetical protein EUTSA_v10023427mg             181   8e-51   Eutrema salsugineum [saltwater cress]
ref|NP_176601.1|  6-phosphogluconate dehydrogenase, decarboxylati...    180   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525354.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    180   2e-50   Glycine max [soybeans]
ref|XP_010473675.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    179   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006301732.1|  hypothetical protein CARUB_v10022193mg             179   2e-50   Capsella rubella
ref|XP_010430539.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    179   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002886358.1|  6-phosphogluconate dehydrogenase family protein    179   2e-50   Arabidopsis lyrata subsp. lyrata
gb|KCW77439.1|  hypothetical protein EUGRSUZ_D01779                     173   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010054765.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    173   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010418473.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    178   6e-50   Camelina sativa [gold-of-pleasure]
gb|KFK36587.1|  hypothetical protein AALP_AA4G143200                    178   6e-50   Arabis alpina [alpine rockcress]
ref|XP_011022562.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    177   1e-49   Populus euphratica
ref|XP_002304540.1|  6-phosphogluconate dehydrogenase family protein    176   4e-49   Populus trichocarpa [western balsam poplar]
ref|XP_002972874.1|  hypothetical protein SELMODRAFT_98399              176   5e-49   
ref|XP_001764215.1|  predicted protein                                  175   1e-48   
ref|XP_002988062.1|  hypothetical protein SELMODRAFT_127384             174   2e-48   
ref|XP_010905189.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    173   4e-48   Elaeis guineensis
ref|XP_001770880.1|  predicted protein                                  173   5e-48   
ref|XP_008811378.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    172   7e-48   Phoenix dactylifera
ref|XP_007209994.1|  hypothetical protein PRUPE_ppa005270mg             169   8e-47   
ref|XP_010676957.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    171   9e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008805334.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphoglu...    170   9e-47   
ref|XP_010917535.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    169   2e-46   Elaeis guineensis
sp|Q94KU2.1|6PGD2_SPIOL  RecName: Full=6-phosphogluconate dehydro...    169   3e-46   Spinacia oleracea
ref|XP_006856410.1|  hypothetical protein AMTR_s00047p00215210          168   3e-46   Amborella trichopoda
ref|XP_009392493.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    168   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803614.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    167   8e-46   Phoenix dactylifera
ref|XP_009388425.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    167   9e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFF18788.1|  6-phosphogluconate dehydrogenase                        157   1e-45   Dimocarpus longan [longan]
gb|AAC79950.1|  6-phosphogluconate dehydrogenase isoenzyme B            158   2e-45   Zea mays [maize]
ref|XP_006348606.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    165   3e-45   Solanum tuberosum [potatoes]
gb|AFF18789.1|  cytosolic 6-phosphogluconate dehydrogenase              156   4e-45   Dimocarpus longan [longan]
ref|XP_006379723.1|  hypothetical protein POPTR_0008s112802g            157   5e-45   
ref|XP_006857727.1|  hypothetical protein AMTR_s00061p00182310          165   6e-45   Amborella trichopoda
ref|XP_006849590.1|  hypothetical protein AMTR_s00024p00196750          165   6e-45   
ref|XP_010261653.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    164   7e-45   
ref|XP_010261649.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    164   8e-45   Nelumbo nucifera [Indian lotus]
ref|XP_004238989.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    164   9e-45   Solanum lycopersicum
ref|XP_009386035.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    164   9e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC79957.1|  6-phosphogluconate dehydrogenase isoenzyme A            156   1e-44   Zea mays [maize]
ref|XP_007151436.1|  hypothetical protein PHAVU_004G046100g             164   1e-44   Phaseolus vulgaris [French bean]
ref|XP_006441889.1|  hypothetical protein CICLE_v10023851mg             162   2e-44   
ref|XP_009619672.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    163   2e-44   Nicotiana tomentosiformis
ref|XP_009773713.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    163   2e-44   Nicotiana sylvestris
ref|XP_010920025.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    163   3e-44   Elaeis guineensis
ref|XP_008788546.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    162   4e-44   Phoenix dactylifera
gb|AAC79949.1|  6-phosphogluconate dehydrogenase isoenzyme A            154   6e-44   Zea mays [maize]
ref|XP_009399427.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    162   6e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009378306.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    162   6e-44   Pyrus x bretschneideri [bai li]
ref|XP_009399426.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    162   7e-44   
ref|XP_002530803.1|  6-phosphogluconate dehydrogenase, putative         162   7e-44   Ricinus communis
ref|XP_009774328.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    162   7e-44   Nicotiana sylvestris
ref|XP_010257854.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    161   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010933404.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    161   1e-43   Elaeis guineensis
ref|XP_010261635.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    161   1e-43   Nelumbo nucifera [Indian lotus]
gb|KDP24308.1|  hypothetical protein JCGZ_25604                         161   1e-43   Jatropha curcas
ref|XP_009610999.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    161   2e-43   Nicotiana tomentosiformis
ref|XP_008459418.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    160   2e-43   Cucumis melo [Oriental melon]
ref|XP_006601856.1|  PREDICTED: 6-phosphogluconate dehydrogenase ...    160   2e-43   
ref|XP_003557150.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    160   2e-43   Brachypodium distachyon [annual false brome]
emb|CDM86736.1|  unnamed protein product                                160   2e-43   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006603945.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    160   3e-43   
ref|NP_001104911.1|  6-phosphogluconate dehydrogenase2                  160   3e-43   
gb|KJB10518.1|  hypothetical protein B456_001G205600                    160   3e-43   Gossypium raimondii
ref|XP_003531895.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    160   3e-43   Glycine max [soybeans]
gb|KEH21786.1|  decarboxylating-like 6-phosphogluconate dehydroge...    160   3e-43   Medicago truncatula
ref|XP_009373738.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    160   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_008341826.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    160   3e-43   Malus domestica [apple tree]
ref|NP_001266302.1|  6-phosphogluconate dehydrogenase isoenzyme B...    160   4e-43   Zea mays [maize]
ref|XP_006482343.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    160   4e-43   Citrus sinensis [apfelsine]
gb|KDO38968.1|  hypothetical protein CISIN_1g011394mg                   160   4e-43   Citrus sinensis [apfelsine]
ref|XP_010549952.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    160   4e-43   Tarenaya hassleriana [spider flower]
gb|EMS57148.1|  6-phosphogluconate dehydrogenase, decarboxylating       160   4e-43   Triticum urartu
ref|XP_004237068.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    160   4e-43   Solanum lycopersicum
gb|EMT22120.1|  6-phosphogluconate dehydrogenase, decarboxylating       160   5e-43   
gb|AHM10416.1|  6-phosphogluconate dehydrogenase                        159   5e-43   Saccharum hybrid cultivar Yacheng05-179
ref|XP_007032948.1|  6-phosphogluconate dehydrogenase family prot...    159   5e-43   Theobroma cacao [chocolate]
gb|KDO38967.1|  hypothetical protein CISIN_1g011394mg                   159   5e-43   Citrus sinensis [apfelsine]
ref|XP_004964329.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    159   5e-43   Setaria italica
ref|XP_004971196.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    159   5e-43   Setaria italica
ref|XP_006430886.1|  hypothetical protein CICLE_v10011597mg             159   5e-43   Citrus clementina [clementine]
ref|XP_007032950.1|  6-phosphogluconate dehydrogenase family prot...    159   5e-43   
ref|XP_006408422.1|  hypothetical protein EUTSA_v10020604mg             159   6e-43   
ref|XP_007032949.1|  6-phosphogluconate dehydrogenase family prot...    159   6e-43   
ref|XP_010029445.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    159   7e-43   Eucalyptus grandis [rose gum]
ref|XP_006437811.1|  hypothetical protein CICLE_v10031373mg             159   8e-43   Citrus clementina [clementine]
ref|XP_003555038.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    159   8e-43   Glycine max [soybeans]
ref|XP_004304174.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    159   8e-43   Fragaria vesca subsp. vesca
gb|EMS64512.1|  6-phosphogluconate dehydrogenase, decarboxylating       160   9e-43   Triticum urartu
ref|XP_002882225.1|  6-phosphogluconate dehydrogenase family protein    159   1e-42   
ref|XP_010485479.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    159   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010477172.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    159   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006297535.1|  hypothetical protein CARUB_v10013557mg             159   1e-42   Capsella rubella
gb|KDO70202.1|  hypothetical protein CISIN_1g0115012mg                  159   1e-42   Citrus sinensis [apfelsine]
ref|XP_006484295.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    159   1e-42   Citrus sinensis [apfelsine]
ref|XP_006363551.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    159   1e-42   Solanum tuberosum [potatoes]
ref|XP_008379478.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    159   1e-42   Malus domestica [apple tree]
gb|KCW56358.1|  hypothetical protein EUGRSUZ_I02092                     159   1e-42   Eucalyptus grandis [rose gum]
ref|XP_006655710.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    158   1e-42   Oryza brachyantha
ref|XP_007139369.1|  hypothetical protein PHAVU_008G023700g             158   1e-42   Phaseolus vulgaris [French bean]
ref|XP_002270984.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    158   1e-42   Vitis vinifera
gb|KJB22742.1|  hypothetical protein B456_004G063900                    158   2e-42   Gossypium raimondii
ref|XP_011085569.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    158   2e-42   Sesamum indicum [beniseed]
gb|ADP03318.1|  6-phosphogluconate dehydrogenase                        158   2e-42   Pinus pinaster [cluster pine]
gb|ADP03059.1|  6-phosphogluconate dehydrogenase                        158   2e-42   Pinus sylvestris [Scotch pine]
gb|ADP03083.1|  6-phosphogluconate dehydrogenase                        158   2e-42   Pinus sylvestris [Scotch pine]
ref|NP_001056586.1|  Os06g0111500                                       158   2e-42   
gb|ADP03057.1|  6-phosphogluconate dehydrogenase                        158   2e-42   Pinus sylvestris [Scotch pine]
gb|EYU44260.1|  hypothetical protein MIMGU_mgv1a005435mg                158   2e-42   Erythranthe guttata [common monkey flower]
tpg|DAA55929.1|  TPA: 6-phosphogluconate dehydrogenase2                 157   2e-42   
ref|XP_008230333.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    158   2e-42   Prunus mume [ume]
gb|ACN35899.1|  unknown                                                 157   2e-42   Zea mays [maize]
ref|XP_011099073.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    157   2e-42   Sesamum indicum [beniseed]
ref|NP_186885.1|  6-phosphogluconate dehydrogenase, decarboxylati...    157   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007045684.1|  6-phosphogluconate dehydrogenase family prot...    157   3e-42   Theobroma cacao [chocolate]
gb|ADP03065.1|  6-phosphogluconate dehydrogenase                        157   3e-42   Pinus sylvestris [Scotch pine]
gb|ADP03055.1|  6-phosphogluconate dehydrogenase                        157   3e-42   Pinus sylvestris [Scotch pine]
gb|ADP03058.1|  6-phosphogluconate dehydrogenase                        157   3e-42   Pinus sylvestris [Scotch pine]
ref|NP_001104910.1|  NADPH producing dehydrogenase of the oxidati...    157   3e-42   
gb|ADP03070.1|  6-phosphogluconate dehydrogenase                        157   3e-42   Pinus sylvestris [Scotch pine]
ref|XP_004141482.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    157   3e-42   Cucumis sativus [cucumbers]
ref|XP_007217218.1|  hypothetical protein PRUPE_ppa004860mg             157   3e-42   Prunus persica
ref|XP_002305978.2|  phosphogluconate dehydrogenase family protein      157   4e-42   
ref|XP_010558538.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    157   4e-42   Tarenaya hassleriana [spider flower]
gb|AHL19963.1|  6-phosphogluconate dehydrogenase                        157   5e-42   Hibiscus cannabinus [bimli-jute]
ref|XP_010463641.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    157   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_004491970.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphoglu...    157   5e-42   
gb|KJB10517.1|  hypothetical protein B456_001G205600                    157   6e-42   Gossypium raimondii
gb|EMT33408.1|  6-phosphogluconate dehydrogenase, decarboxylating       159   1e-41   
sp|Q94KU1.1|6PGD1_SPIOL  RecName: Full=6-phosphogluconate dehydro...    155   1e-41   Spinacia oleracea
emb|CDY43238.1|  BnaC05g48310D                                          154   2e-41   Brassica napus [oilseed rape]
emb|CDP00510.1|  unnamed protein product                                155   2e-41   Coffea canephora [robusta coffee]
emb|CDY34724.1|  BnaA01g33010D                                          154   2e-41   Brassica napus [oilseed rape]
ref|XP_006373519.1|  phosphogluconate dehydrogenase family protein      155   2e-41   Populus trichocarpa [western balsam poplar]
ref|NP_001236726.1|  6-phosphogluconate dehydrogenase                   155   2e-41   
ref|XP_010091678.1|  6-phosphogluconate dehydrogenase                   155   3e-41   Morus notabilis
gb|EPS70190.1|  hypothetical protein M569_04567                         155   3e-41   Genlisea aurea
ref|XP_009147357.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    155   3e-41   Brassica rapa
ref|XP_011021140.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    155   3e-41   Populus euphratica
emb|CBI27441.3|  unnamed protein product                                146   3e-41   Vitis vinifera
emb|CDY57527.1|  BnaA05g33580D                                          153   4e-41   Brassica napus [oilseed rape]
ref|XP_001785214.1|  predicted protein                                  154   4e-41   
ref|XP_010100892.1|  6-phosphogluconate dehydrogenase                   154   5e-41   Morus notabilis
ref|XP_002305977.2|  hypothetical protein POPTR_0004s10870g             154   7e-41   
ref|XP_002966753.1|  hypothetical protein SELMODRAFT_168478             153   2e-40   Selaginella moellendorffii
ref|XP_010681308.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    152   2e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|AAB41553.1|  6-phosphogluconate dehydrogenase                        152   3e-40   Medicago sativa [alfalfa]
ref|XP_001759464.1|  predicted protein                                  152   3e-40   
gb|EEC79859.1|  hypothetical protein OsI_21344                          141   1e-39   Oryza sativa Indica Group [Indian rice]
gb|KDP31431.1|  hypothetical protein JCGZ_11807                         149   2e-39   Jatropha curcas
ref|XP_009117953.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    145   6e-38   Brassica rapa
gb|AFW60760.1|  putative 6-phosphogluconate dehydrogenase               142   1e-36   
ref|NP_001241786.1|  6-phosphogluconate dehydrogenase, decarboxyl...    142   1e-36   
ref|XP_002449496.1|  hypothetical protein SORBIDRAFT_05g016740          140   5e-36   Sorghum bicolor [broomcorn]
ref|XP_011011766.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    140   5e-36   Populus euphratica
dbj|BAG32445.1|  6-phosphogluconate dehydrogenase                       139   8e-36   Gloeochaete wittrockiana
ref|XP_003060927.1|  predicted protein                                  139   9e-36   Micromonas pusilla CCMP1545
dbj|BAK00156.1|  predicted protein                                      139   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003557402.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    139   1e-35   Brachypodium distachyon [annual false brome]
ref|XP_004979278.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    139   1e-35   Setaria italica
ref|XP_002953515.1|  hypothetical protein VOLCADRAFT_109207             137   7e-35   Volvox carteri f. nagariensis
ref|NP_001067912.1|  Os11g0484500                                       136   2e-34   
ref|XP_010941448.1|  PREDICTED: 6-phosphogluconate dehydrogenase,...    130   2e-34   Elaeis guineensis
dbj|BAG32444.1|  6-phosphogluconate dehydrogenase                       134   6e-34   Cyanophora paradoxa
emb|CAN67602.1|  hypothetical protein VITISV_032572                     134   6e-34   Vitis vinifera
ref|XP_008610309.1|  6-phosphogluconate dehydrogenase (decarboxyl...    134   8e-34   Saprolegnia diclina VS20
ref|XP_001696881.1|  6-phosphogluconate dehydrogenase, decarboxyl...    134   9e-34   Chlamydomonas reinhardtii
ref|XP_004343090.1|  6-phosphogluconate dehydrogenase                   134   1e-33   Capsaspora owczarzaki ATCC 30864
ref|XP_001696880.1|  6-phosphogluconate dehydrogenase, decarboxyl...    134   1e-33   Chlamydomonas reinhardtii
ref|XP_008872677.1|  6-phosphogluconate dehydrogenase (decarboxyl...    133   2e-33   Aphanomyces invadans
ref|XP_009832556.1|  6-phosphogluconate dehydrogenase (decarboxyl...    133   2e-33   Aphanomyces astaci
gb|KDO26201.1|  6-phosphogluconate dehydrogenase                        132   3e-33   Saprolegnia parasitica CBS 223.65
gb|ETL93890.1|  6-phosphogluconate dehydrogenase (decarboxylating)      131   9e-33   Phytophthora parasitica
ref|XP_008905173.1|  6-phosphogluconate dehydrogenase (decarboxyl...    131   1e-32   Phytophthora parasitica INRA-310
ref|XP_009524396.1|  hypothetical protein PHYSODRAFT_557596             130   2e-32   Phytophthora sojae
emb|CBJ29697.1|  6-phosphogluconate dehydrogenase                       130   2e-32   Ectocarpus siliculosus
ref|XP_002902568.1|  6-phosphogluconate dehydrogenase                   130   3e-32   Phytophthora infestans T30-4
ref|XP_001418779.1|  predicted protein                                  129   4e-32   Ostreococcus lucimarinus CCE9901
ref|XP_002502811.1|  predicted protein                                  129   5e-32   Micromonas commoda
ref|XP_007513389.1|  6-phosphogluconate dehydrogenase                   127   4e-31   Bathycoccus prasinos
dbj|BAG32441.1|  6-phosphogluconate dehydrogenase                       125   1e-30   Euglena gracilis
emb|CEF98862.1|  6-phosphogluconate dehydrogenase,decarboxylating       125   2e-30   Ostreococcus tauri
gb|EJK45824.1|  hypothetical protein THAOC_35540                        122   5e-30   Thalassiosira oceanica
dbj|BAG32446.1|  6-phosphogluconate dehydrogenase                       123   5e-30   Cyanoptyche gloeocystis
ref|XP_002179525.1|  6-phosphogluconate dehydrogenase                   123   7e-30   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002179526.1|  6-phosphogluconate dehydrogenase                   123   8e-30   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_011400114.1|  6-phosphogluconate dehydrogenase, decarboxyl...    122   9e-30   Auxenochlorella protothecoides
emb|CCA16382.1|  6phosphogluconate dehydrogenase putative               123   1e-29   Albugo laibachii Nc14
ref|XP_003080519.1|  6-phosphogluconate dehydrogenase (ISS)             124   1e-29   
emb|CCI10945.1|  unnamed protein product                                122   1e-29   Albugo candida
ref|XP_002289820.1|  6-phosphogluconate dehydrogenase                   122   1e-29   Thalassiosira pseudonana CCMP1335
gb|EEE52109.1|  hypothetical protein OsJ_33909                          122   2e-29   Oryza sativa Japonica Group [Japonica rice]
emb|CAQ52407.1|  6-phosphogluconate dehydrogenase                       122   2e-29   Laminaria digitata
gb|EJK62811.1|  hypothetical protein THAOC_16563                        121   3e-29   Thalassiosira oceanica
emb|CAB61332.1|  6-phosphogluconate dehydrogenase                       120   1e-28   Laminaria digitata
gb|AAP33506.2|  cytosolic 6-phosphogluconate dehydrogenase              119   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EWM28595.1|  6-phosphogluconate dehydrogenase                        119   3e-28   Nannochloropsis gaditana
ref|XP_005651440.1|  decarboxylating 6-phosphogluconate dehydroge...    119   3e-28   Coccomyxa subellipsoidea C-169
ref|XP_005709029.1|  6-phosphogluconate dehydrogenase (decarboxyl...    118   9e-28   Galdieria sulphuraria
gb|EEC79860.1|  hypothetical protein OsI_21345                          115   4e-27   Oryza sativa Indica Group [Indian rice]
gb|KDD75074.1|  6-phosphogluconate dehydrogenase                        114   3e-26   Helicosporidium sp. ATCC 50920
ref|XP_005536704.1|  6-phosphogluconate dehydrogenase                   110   5e-26   Cyanidioschyzon merolae strain 10D
ref|XP_004156224.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    112   7e-26   
ref|XP_002185945.1|  G6PDH/6PGDH fusion protein                         113   2e-25   Phaeodactylum tricornutum CCAP 1055/1
dbj|BAD36765.1|  6-phosphogluconate dehydrogenase                       111   3e-25   Cyanidioschyzon merolae
ref|XP_005537109.1|  6-phosphogluconate dehydrogenase                   111   3e-25   Cyanidioschyzon merolae strain 10D
ref|XP_002681464.1|  6-phosphogluconate dehydrogenase                   109   5e-25   Naegleria gruberi strain NEG-M
ref|WP_041843932.1|  6-phosphogluconate dehydrogenase                   109   7e-25   Thermotoga sp. RQ7
ref|XP_005536718.1|  6-phosphogluconate dehydrogenase                   110   1e-24   Cyanidioschyzon merolae strain 10D
ref|WP_038066411.1|  6-phosphogluconate dehydrogenase                   108   1e-24   Thermotoga neapolitana
gb|ACM22410.1|  6-phosphogluconate dehydrogenase, decarboxylating       108   1e-24   Thermotoga neapolitana DSM 4359
ref|WP_008192055.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     108   1e-24   Thermotoga
ref|WP_038033579.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     108   1e-24   Thermotoga
ref|WP_012895867.1|  6-phosphogluconate dehydrogenase                   108   1e-24   Thermotoga naphthophila
ref|WP_004081528.1|  6-phosphogluconate dehydrogenase                   108   2e-24   Thermotoga maritima
ref|WP_012310577.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     108   2e-24   Thermotoga
ref|WP_011943120.1|  6-phosphogluconate dehydrogenase                   108   2e-24   Thermotoga petrophila
ref|XP_001394208.2|  6-phosphogluconate dehydrogenase, decarboxyl...    105   2e-23   Aspergillus niger CBS 513.88
ref|WP_042102328.1|  6-phosphogluconate dehydrogenase                   105   3e-23   Parachlamydiaceae bacterium HS-T3
ref|WP_040341911.1|  6-phosphogluconate dehydrogenase                   103   5e-23   Bacillus smithii
gb|EHL73831.1|  6-phosphogluconate dehydrogenase, decarboxylating 2     103   5e-23   Bacillus smithii 7_3_47FAA
ref|WP_008100995.1|  6-phosphogluconate dehydrogenase                   103   7e-23   Verrucomicrobiae bacterium DG1235
dbj|BAG32442.1|  6-phosphogluconate dehydrogenase                       103   8e-23   Peranema trichophorum
gb|ETO28562.1|  hypothetical protein RFI_08569                          102   1e-22   
ref|WP_012548791.1|  6-phosphogluconate dehydrogenase                   102   1e-22   
ref|WP_026587774.1|  6-phosphogluconate dehydrogenase                   102   2e-22   
gb|AAL76321.1|AF394511_1  6-phosphogluconate dehydrogenase              102   2e-22   
ref|XP_001819351.1|  6-phosphogluconate dehydrogenase, decarboxyl...    102   2e-22   
ref|XP_008814076.1|  6-phosphogluconate dehydrogenase (decarboxyl...    102   2e-22   
ref|WP_012582611.1|  6-phosphogluconate dehydrogenase                   102   2e-22   
ref|WP_035083294.1|  6-phosphogluconate dehydrogenase                   102   3e-22   
ref|XP_001615843.1|  6-phosphogluconate dehydrogenase, decarboxyl...    102   3e-22   
ref|XP_006960024.1|  6-phosphogluconate dehydrogenase                   101   5e-22   
ref|XP_002260328.1|  6-phosphogluconate dehydrogenase,decarboxyla...    101   5e-22   
ref|WP_035469547.1|  6-phosphogluconate dehydrogenase                   101   7e-22   
ref|WP_004097883.1|  6-phosphogluconate dehydrogenase                   100   7e-22   
ref|WP_016886716.1|  6-phosphogluconate dehydrogenase                   100   7e-22   
ref|WP_012162595.1|  6-phosphogluconate dehydrogenase                   100   7e-22   
gb|EUR62398.1|  6-phosphogluconate dehydrogenase (decarboxylating)      100   8e-22   
ref|XP_001348694.1|  6-phosphogluconate dehydrogenase, decarboxyl...    100   8e-22   
ref|WP_006637460.1|  6-phosphogluconate dehydrogenase                   100   8e-22   
ref|WP_029419400.1|  6-phosphogluconate dehydrogenase                   100   8e-22   
ref|XP_007877719.1|  hypothetical protein PFL1_02017                    100   8e-22   
ref|WP_035088947.1|  6-phosphogluconate dehydrogenase                   100   9e-22   
gb|AGY57488.1|  6-phosphogluconate dehydrogenase                        100   9e-22   
ref|WP_020452102.1|  MULTISPECIES: NADP+-dependent 6-P-gluconate ...    100   1e-21   
ref|WP_003183299.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     100   1e-21   
gb|AAL76319.1|AF394509_1  6-phosphogluconate dehydrogenase              100   1e-21   
ref|WP_035029131.1|  6-phosphogluconate dehydrogenase                   100   1e-21   
ref|WP_009352833.1|  6-phosphogluconate dehydrogenase                   100   1e-21   
gb|EED06433.1|  6-phosphogluconate dehydrogenase, decarboxylating       100   1e-21   
emb|CCJ31454.1|  unnamed protein product                                101   1e-21   
ref|WP_010044592.1|  6-phosphogluconate dehydrogenase                   100   1e-21   
ref|WP_033009036.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     100   1e-21   
ref|WP_015375340.1|  6-phosphogluconate dehydrogenase                   100   1e-21   
ref|WP_020755289.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     100   2e-21   
ref|WP_011231826.1|  6-phosphogluconate dehydrogenase                   100   2e-21   
ref|WP_033016466.1|  6-phosphogluconate dehydrogenase                   100   2e-21   
ref|WP_014196285.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     100   2e-21   
ref|WP_042382474.1|  6-phosphogluconate dehydrogenase                   100   2e-21   
ref|WP_012820646.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase     100   2e-21   
ref|WP_023633514.1|  6-phosphogluconate dehydrogenase                   100   2e-21   
ref|XP_003684043.1|  hypothetical protein TPHA_0A05350                  100   2e-21   
ref|WP_033844132.1|  6-phosphogluconate dehydrogenase                 99.8    2e-21   
ref|WP_025948594.1|  6-phosphogluconate dehydrogenase                 99.8    2e-21   
ref|WP_011006394.1|  6-phosphogluconate dehydrogenase                   100   2e-21   
ref|WP_041077363.1|  6-phosphogluconate dehydrogenase                 99.8    2e-21   
ref|WP_042664875.1|  MULTISPECIES: hypothetical protein               99.8    2e-21   
ref|WP_031408437.1|  6-phosphogluconate dehydrogenase                 99.8    2e-21   
ref|WP_035390773.1|  6-phosphogluconate dehydrogenase                 99.8    2e-21   
ref|WP_017367561.1|  6-phosphogluconate dehydrogenase                 99.8    2e-21   
ref|WP_012810440.1|  6-phosphogluconate dehydrogenase                 99.8    2e-21   
ref|WP_009609959.1|  6-phosphogluconate dehydrogenase                 99.8    2e-21   
ref|WP_011026083.1|  6-phosphogluconate dehydrogenase                 99.8    2e-21   
ref|WP_017357947.1|  6-phosphogluconate dehydrogenase                 99.4    2e-21   
ref|WP_044730912.1|  6-phosphogluconate dehydrogenase                 99.4    2e-21   
ref|WP_007501118.1|  6-phosphogluconate dehydrogenase                 99.4    2e-21   
ref|WP_025207592.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   99.4    2e-21   
ref|WP_022588483.1|  6-phosphogluconate dehydrogenase                 99.4    2e-21   
ref|WP_008342251.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   99.4    2e-21   
ref|WP_034661210.1|  6-phosphogluconate dehydrogenase                 99.4    3e-21   
ref|WP_024422907.1|  6-phosphogluconate dehydrogenase                 99.4    3e-21   
ref|WP_034280291.1|  6-phosphogluconate dehydrogenase                 99.4    3e-21   
dbj|GAA84025.1|  6-phosphogluconate dehydrogenase                     99.8    3e-21   
emb|CAK40566.1|  unnamed protein product                              99.8    3e-21   
ref|WP_024428028.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   99.4    3e-21   
ref|WP_034622350.1|  6-phosphogluconate dehydrogenase                 99.4    3e-21   
ref|WP_025093007.1|  6-phosphogluconate dehydrogenase                 99.4    3e-21   
ref|WP_041086071.1|  6-phosphogluconate dehydrogenase                 99.4    3e-21   
gb|ACE96443.1|  expressed protein                                     95.9    3e-21   
gb|ACE96441.1|  expressed protein                                     95.9    3e-21   
gb|KIA77379.1|  hypothetical protein DB43_GK00100                     95.9    3e-21   
gb|ACE96470.1|  expressed protein                                     95.9    3e-21   
gb|ACE96439.1|  expressed protein                                     95.9    3e-21   
ref|WP_033023567.1|  6-phosphogluconate dehydrogenase                 99.0    3e-21   
pdb|2W8Z|A  Chain A, Geobacillus Stearothermophilus 6-Phosphogluc...  99.0    3e-21   
pdb|2W90|A  Chain A, Geobacillus Stearothermophilus 6-Phosphogluc...  99.0    3e-21   
ref|WP_011141117.1|  6-phosphogluconate dehydrogenase                 99.4    4e-21   
gb|ELU43227.1|  6-phosphogluconate dehydrogenase                        100   4e-21   
gb|ACE96440.1|  expressed protein                                     95.9    4e-21   
ref|WP_039179776.1|  6-phosphogluconate dehydrogenase                 99.0    4e-21   
gb|ACE96462.1|  expressed protein                                     95.9    4e-21   
ref|WP_041244422.1|  6-phosphogluconate dehydrogenase                 99.0    4e-21   
tpe|CBF75018.1|  TPA: hypothetical protein similar to 6-phosphogl...  99.4    4e-21   
ref|WP_006569466.1|  6-phosphogluconate dehydrogenase                 99.0    4e-21   
ref|WP_012010492.1|  6-phosphogluconate dehydrogenase                 99.0    4e-21   
ref|WP_011966108.1|  6-phosphogluconate dehydrogenase                 99.0    4e-21   
ref|WP_040948521.1|  6-phosphogluconate dehydrogenase                 99.0    4e-21   
ref|WP_037993082.1|  6-phosphogluconate dehydrogenase                 99.0    4e-21   
ref|WP_005863005.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   99.0    4e-21   
ref|WP_036615688.1|  6-phosphogluconate dehydrogenase                 99.0    4e-21   
ref|WP_009275038.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   99.0    4e-21   
ref|WP_018194141.1|  MULTISPECIES: hypothetical protein               97.8    4e-21   
ref|WP_042833553.1|  6-phosphogluconate dehydrogenase                 98.6    4e-21   
ref|WP_010470771.1|  6-phosphogluconate dehydrogenase                 99.0    5e-21   
ref|WP_008779706.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   99.0    5e-21   
ref|WP_029689386.1|  6-phosphogluconate dehydrogenase                 98.6    5e-21   
ref|WP_008772422.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   99.0    5e-21   
ref|WP_021656649.1|  phosphogluconate dehydrogenase                   98.6    5e-21   
ref|WP_044544830.1|  6-phosphogluconate dehydrogenase                 98.6    6e-21   
ref|WP_008655870.1|  6-phosphogluconate dehydrogenase, decarboxyl...  98.6    6e-21   
ref|WP_043905384.1|  6-phosphogluconate dehydrogenase                 98.6    6e-21   
ref|WP_008668939.1|  6-phosphogluconate dehydrogenase, decarboxyl...  98.6    6e-21   
ref|WP_007339488.1|  6-phosphogluconate dehydrogenase, decarboxyl...  98.6    6e-21   
ref|WP_004404778.1|  MULTISPECIES: 6-phosphogluconate dehydrogena...  98.2    6e-21   
ref|WP_007335167.1|  6-phosphogluconate dehydrogenase                 98.6    6e-21   
ref|WP_018192793.1|  MULTISPECIES: hypothetical protein               98.2    6e-21   
ref|WP_007328138.1|  6-phosphogluconate dehydrogenase                 98.6    6e-21   
ref|WP_005857716.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   98.6    7e-21   
ref|WP_015183400.1|  6-phosphogluconate dehydrogenase                 98.2    7e-21   
emb|CEL58219.1|  6-phosphogluconate dehydrogenase                     99.0    8e-21   
ref|WP_035101452.1|  6-phosphogluconate dehydrogenase                 98.2    8e-21   
ref|WP_034319791.1|  6-phosphogluconate dehydrogenase                 98.2    8e-21   
ref|WP_018473437.1|  6-phosphogluconate dehydrogenase                 98.2    8e-21   
ref|WP_044141026.1|  6-phosphogluconate dehydrogenase                 97.8    9e-21   
gb|EFA28146.1|  6-phosphogluconate dehydrogenase                      94.0    9e-21   
ref|WP_003215871.1|  6-phosphogluconate dehydrogenase                 97.8    9e-21   
ref|WP_011119037.1|  6-phosphogluconate dehydrogenase                 98.2    9e-21   
ref|WP_003866631.1|  6-phosphogluconate dehydrogenase                 97.8    1e-20   
ref|WP_014063253.1|  6-phosphogluconate dehydrogenase                 97.8    1e-20   
gb|EPP36061.1|  NAD binding domain of 6-phosphogluconate dehydrog...  92.8    1e-20   
ref|XP_001728891.1|  hypothetical protein MGL_3885                    97.8    1e-20   
ref|WP_008358805.1|  6-phosphogluconate dehydrogenase                 97.8    1e-20   
ref|XP_004223987.1|  6-phosphogluconate dehydrogenase decarboxyla...  97.4    1e-20   
ref|WP_013932410.1|  6-phosphogluconate dehydrogenase                 97.4    1e-20   
emb|CBQ72954.1|  probable 6-phosphogluconate dehydrogenase            97.8    1e-20   
ref|WP_044009476.1|  6-phosphogluconate dehydrogenase                 97.8    1e-20   
ref|WP_029098773.1|  6-phosphogluconate dehydrogenase                 97.4    1e-20   
ref|WP_021111259.1|  6-phosphogluconate dehydrogenase, decarboxyl...  97.8    1e-20   
ref|WP_012621942.1|  6-phosphogluconate dehydrogenase                 97.8    1e-20   
ref|WP_021116132.1|  6-phosphogluconate dehydrogenase, decarboxyl...  97.8    1e-20   
ref|WP_035297117.1|  6-phosphogluconate dehydrogenase                 97.4    1e-20   
ref|WP_028549393.1|  6-phosphogluconate dehydrogenase                 97.4    1e-20   
emb|CCF52787.1|  probable 6-phosphogluconate dehydrogenase            97.8    1e-20   
ref|WP_006556345.1|  6-phosphogluconate dehydrogenase, decarboxyl...  97.4    1e-20   
gb|ETS64853.1|  hypothetical protein PaG_00822                        97.8    1e-20   
ref|WP_008879769.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   97.4    1e-20   
ref|WP_003249346.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   97.4    1e-20   
ref|WP_039191324.1|  MULTISPECIES: hypothetical protein               97.4    1e-20   
ref|WP_017435253.1|  6-phosphogluconate dehydrogenase                 97.4    1e-20   
ref|WP_016533039.1|  6-phosphogluconate dehydrogenase                 92.4    1e-20   
gb|AIC34707.1|  6-phosphogluconate dehydrogenase                      97.4    1e-20   
ref|WP_021255211.1|  6-phosphogluconate dehydrogenase                 93.2    1e-20   
dbj|GAF01858.1|  6-phosphogluconate dehydrogenase                     94.7    2e-20   
ref|WP_017800220.1|  6-phosphogluconate dehydrogenase                 97.4    2e-20   
ref|WP_013043820.1|  6-phosphogluconate dehydrogenase                 97.8    2e-20   
ref|WP_044618670.1|  6-phosphogluconate dehydrogenase                 97.4    2e-20   
ref|WP_003325524.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   97.1    2e-20   
ref|WP_020960457.1|  6-phosphogluconate dehydrogenase                 97.1    2e-20   
ref|WP_021118364.1|  6-phosphogluconate dehydrogenase                 97.4    2e-20   
ref|WP_041269706.1|  6-phosphogluconate dehydrogenase                 97.1    2e-20   
gb|EKV06310.1|  6-phosphogluconate dehydrogenase, decarboxylating     97.4    2e-20   
ref|WP_015312449.1|  6-phosphogluconate dehydrogenase, decarboxyl...  97.1    2e-20   
ref|WP_013298810.1|  6-phosphogluconate dehydrogenase                 97.1    2e-20   
ref|WP_019533584.1|  6-phosphogluconate dehydrogenase                 97.1    2e-20   
gb|ACS24987.1|  6-phosphogluconate dehydrogenase, decarboxylating     97.1    2e-20   
ref|WP_013917626.1|  6-phosphogluconate dehydrogenase                 97.1    2e-20   
ref|WP_016594541.1|  hypothetical protein                             93.2    2e-20   
ref|WP_044354222.1|  6-phosphogluconate dehydrogenase                 97.1    2e-20   
ref|XP_661558.1|  hypothetical protein AN3954.2                       97.1    2e-20   
gb|KDN38867.1|  putative 6-phosphogluconate dehydrogenase             97.1    2e-20   
ref|WP_015267951.1|  6-phosphogluconate dehydrogenase                 97.1    2e-20   
emb|CEJ05430.1|  Putative 6-phosphogluconate dehydrogenase, decar...  94.0    2e-20   
emb|CEI88006.1|  Putative 6-phosphogluconate dehydrogenase, decar...  94.0    2e-20   
ref|XP_002615362.1|  hypothetical protein CLUG_04244                  97.1    3e-20   
ref|WP_013144813.1|  6-phosphogluconate dehydrogenase                 96.7    3e-20   
ref|WP_014652229.1|  6-phosphogluconate dehydrogenase                 96.7    3e-20   
gb|AFC32017.1|  YqjI                                                  96.7    3e-20   
ref|WP_038561694.1|  6-phosphogluconate dehydrogenase                 96.7    3e-20   
ref|WP_041967959.1|  6-phosphogluconate dehydrogenase                 96.7    3e-20   
ref|XP_011388980.1|  putative phosphogluconate dehydrogenase (dec...  96.7    3e-20   
ref|WP_021841265.1|  6-phosphogluconate dehydrogenase decarboxyla...  96.7    3e-20   
emb|CEG83815.1|  Putative 6-phosphogluconate dehydrogenase, decar...  93.6    3e-20   
ref|WP_013925290.1|  6-phosphogluconate dehydrogenase                 96.7    3e-20   
ref|WP_006460335.1|  6-phosphogluconate dehydrogenase                 96.7    3e-20   
gb|AAO32456.1|  GND1                                                  96.7    3e-20   
gb|KDE03730.1|  6-phosphogluconate dehydrogenase, decarboxylating 1   96.7    3e-20   
ref|WP_033885463.1|  6-phosphogluconate dehydrogenase                 93.6    3e-20   
ref|WP_006340084.1|  6-phosphogluconate dehydrogenase                 96.7    3e-20   
ref|WP_005705395.1|  6-phosphogluconate dehydrogenase                 96.7    3e-20   
ref|WP_026611937.1|  6-phosphogluconate dehydrogenase                 96.7    3e-20   
emb|CDI53454.1|  probable 6-phosphogluconate dehydrogenase            96.7    3e-20   
ref|WP_005707684.1|  6-phosphogluconate dehydrogenase                 96.7    3e-20   
ref|WP_034568886.1|  6-phosphogluconate dehydrogenase                 96.3    4e-20   
ref|XP_005538849.1|  6-phosphogluconate dehydrogenase, decarboxyl...  96.7    4e-20   
ref|WP_026916375.1|  6-phosphogluconate dehydrogenase                 96.3    4e-20   
ref|WP_043868625.1|  6-phosphogluconate dehydrogenase                 96.3    4e-20   
ref|WP_032125047.1|  6-phosphogluconate dehydrogenase                 96.3    4e-20   
ref|WP_036850331.1|  6-phosphogluconate dehydrogenase                 96.3    4e-20   
ref|WP_028554669.1|  6-phosphogluconate dehydrogenase                 96.3    4e-20   
ref|WP_042089976.1|  hypothetical protein                             92.0    4e-20   
ref|WP_036847343.1|  6-phosphogluconate dehydrogenase                 96.3    4e-20   
ref|WP_042906719.1|  6-phosphogluconate dehydrogenase                 96.3    4e-20   
ref|WP_021113706.1|  6-phosphogluconate dehydrogenase, decarboxyl...  96.3    4e-20   
dbj|GAC94110.1|  6-phosphogluconate dehydrogenase                     96.7    4e-20   
gb|ABD78980.1|  HI0553-like protein                                   94.4    4e-20   
ref|WP_003927484.1|  6-phosphogluconate dehydrogenase                 96.3    5e-20   
ref|WP_036853814.1|  6-phosphogluconate dehydrogenase                 96.3    5e-20   
ref|WP_041695712.1|  6-phosphogluconate dehydrogenase                 95.9    5e-20   
ref|WP_015076771.1|  6-phosphogluconate dehydrogenase                 95.9    5e-20   
ref|WP_044747917.1|  6-phosphogluconate dehydrogenase                 95.9    5e-20   
gb|AEJ43046.1|  6-phosphogluconate dehydrogenase, decarboxylating     96.3    5e-20   
gb|AAA27330.1|  6-phosphogluconate dehydrogenase                      95.9    5e-20   
ref|WP_035519964.1|  6-phosphogluconate dehydrogenase                 96.3    5e-20   
ref|WP_005823607.1|  6-phosphogluconate dehydrogenase                 96.3    5e-20   
ref|WP_011243770.1|  6-phosphogluconate dehydrogenase                 95.9    5e-20   
ref|WP_028930241.1|  6-phosphogluconate dehydrogenase                 95.9    5e-20   
ref|WP_021117335.1|  6-phosphogluconate dehydrogenase, decarboxyl...  96.3    5e-20   
ref|WP_026573299.1|  6-phosphogluconate dehydrogenase                 95.9    5e-20   
ref|WP_021112599.1|  6-phosphogluconate dehydrogenase, decarboxyl...  96.3    5e-20   
gb|EYE95105.1|  6-phosphogluconate dehydrogenase                      96.3    5e-20   
ref|WP_002358499.1|  6-phosphogluconate dehydrogenase, decarboxyl...  94.0    5e-20   
ref|WP_014705987.1|  6-phosphogluconate dehydrogenase                 96.3    5e-20   
ref|WP_038459101.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   95.9    5e-20   
ref|WP_010054207.1|  6-phosphogluconate dehydrogenase                 95.9    5e-20   
ref|WP_039063298.1|  6-phosphogluconate dehydrogenase                 95.9    5e-20   
ref|WP_031499922.1|  6-phosphogluconate dehydrogenase                 96.3    5e-20   
ref|WP_007408395.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   95.9    5e-20   
ref|WP_043991876.1|  6-phosphogluconate dehydrogenase                 95.9    5e-20   
ref|WP_021119023.1|  6-phosphogluconate dehydrogenase, decarboxyl...  95.9    5e-20   
ref|WP_006249556.1|  6-phosphogluconate dehydrogenase                 95.9    5e-20   
gb|EDJ90174.1|  6-phosphogluconate dehydrogenase                      94.4    5e-20   
ref|WP_011377413.1|  MULTISPECIES: 6-phosphogluconate dehydrogenase   95.9    5e-20   
ref|WP_035522242.1|  6-phosphogluconate dehydrogenase                 95.9    5e-20   



>ref|XP_009626290.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nicotiana tomentosiformis]
Length=495

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 1/108 (1%)
 Frame = +2

Query  179  MEVAA-AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLP  355
            ME AA AQALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RAQREGQLP
Sbjct  1    MEGAATAQALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAQREGQLP  60

Query  356  LVGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            L GQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAAL+EHMEPGDTII
Sbjct  61   LTGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALAEHMEPGDTII  108



>ref|XP_009789896.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Nicotiana sylvestris]
Length=495

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/108 (94%), Positives = 105/108 (97%), Gaps = 1/108 (1%)
 Frame = +2

Query  179  MEVAA-AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLP  355
            ME AA AQALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RAQREGQLP
Sbjct  1    MEGAATAQALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAQREGQLP  60

Query  356  LVGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            L GQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAAL+EHMEPGDTII
Sbjct  61   LTGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALAEHMEPGDTII  108



>ref|XP_004252580.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Solanum lycopersicum]
Length=496

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 1/108 (1%)
 Frame = +2

Query  179  MEVAA-AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLP  355
            ME AA AQALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RAQ EGQLP
Sbjct  1    MEGAATAQALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAQNEGQLP  60

Query  356  LVGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            L+GQYNPRDFVLSIQRPRSVIILVKAG+PVDQTIAALSE+MEPGDTII
Sbjct  61   LIGQYNPRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEYMEPGDTII  108



>ref|XP_006360699.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Solanum tuberosum]
Length=495

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 105/108 (97%), Gaps = 1/108 (1%)
 Frame = +2

Query  179  MEVAA-AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLP  355
            ME AA AQALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RAQ EGQLP
Sbjct  1    MEGAATAQALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAQNEGQLP  60

Query  356  LVGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            L+GQYNPRDFVLSIQRPRSVIILVKAG+PVDQTIAALSE+MEPGDTII
Sbjct  61   LIGQYNPRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEYMEPGDTII  108



>emb|CDP12110.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +2

Query  185  VAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVG  364
            +A A ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA REG LPL G
Sbjct  1    MATADALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRADREGHLPLFG  60

Query  365  QYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            QYNP+DFVLSIQRPRSVIILVKAGAPVDQTIAALS++MEPGDTII
Sbjct  61   QYNPKDFVLSIQRPRSVIILVKAGAPVDQTIAALSQYMEPGDTII  105



>ref|XP_006476449.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like isoform X3 [Citrus sinensis]
Length=493

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDET++RA REGQLPL G Y 
Sbjct  3    ASALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYT  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRSVIILVKAG+PVDQTIAALSEHM PGD II
Sbjct  63   PRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCII  104



>ref|XP_006476447.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006476448.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like isoform X2 [Citrus sinensis]
Length=494

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDET++RA REGQLPL G Y 
Sbjct  3    ASALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYT  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRSVIILVKAG+PVDQTIAALSEHM PGD II
Sbjct  63   PRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCII  104



>ref|XP_006439417.1| hypothetical protein CICLE_v10019859mg [Citrus clementina]
 gb|ESR52657.1| hypothetical protein CICLE_v10019859mg [Citrus clementina]
Length=494

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDET++RA REGQLPL G Y 
Sbjct  3    ASALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYT  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRSVIILVKAG+PVDQTIAALSEHM PGD II
Sbjct  63   PRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCII  104



>gb|AIU64845.1| 6-phosphogluconate dehydrogenase [Prunus sibirica]
Length=495

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA  EG LPL GQY
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALS HMEPGD II
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSAHMEPGDAII  105



>ref|XP_008238987.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Prunus mume]
Length=495

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA  EG LPL GQY
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALS HMEPGD II
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSAHMEPGDAII  105



>gb|KDO76416.1| hypothetical protein CISIN_1g010652mg [Citrus sinensis]
Length=505

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDET++RA REGQLPL G Y 
Sbjct  3    ASALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYT  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRSVIILVKAG+PVDQTIAALSEHM PGD II
Sbjct  63   PRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCII  104



>gb|KDO76415.1| hypothetical protein CISIN_1g010652mg [Citrus sinensis]
Length=503

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDET++RA REGQLPL G Y 
Sbjct  3    ASALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYT  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRSVIILVKAG+PVDQTIAALSEHM PGD II
Sbjct  63   PRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCII  104



>gb|KDO76417.1| hypothetical protein CISIN_1g010652mg [Citrus sinensis]
Length=505

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDET++RA REGQLPL G Y 
Sbjct  3    ASALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLPLTGHYT  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRSVIILVKAG+PVDQTIAALSEHM PGD II
Sbjct  63   PRDFVLSIQRPRSVIILVKAGSPVDQTIAALSEHMSPGDCII  104



>ref|XP_007040418.1| 6-phosphogluconate dehydrogenase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY24919.1| 6-phosphogluconate dehydrogenase family protein isoform 2 [Theobroma 
cacao]
Length=492

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETV+RAQ EGQLPL GQY
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVQRAQEEGQLPLFGQY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +PR+FVLS+QRPRSV+ILVKAG+PVDQTIAALS+HMEPGD II
Sbjct  63   SPREFVLSVQRPRSVVILVKAGSPVDQTIAALSDHMEPGDCII  105



>ref|XP_009334464.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Pyrus x bretschneideri]
Length=495

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/100 (92%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA  EG LPL GQYNPR
Sbjct  6    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAHNEGNLPLFGQYNPR  65

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSI+RPRSVIILVKAGAPVDQTIAALS HMEPGD II
Sbjct  66   DFVLSIERPRSVIILVKAGAPVDQTIAALSAHMEPGDAII  105



>ref|XP_007040417.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24918.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=520

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETV+RAQ EGQLPL GQY
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVQRAQEEGQLPLFGQY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +PR+FVLS+QRPRSV+ILVKAG+PVDQTIAALS+HMEPGD II
Sbjct  63   SPREFVLSVQRPRSVVILVKAGSPVDQTIAALSDHMEPGDCII  105



>ref|XP_004149760.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
 gb|KGN53379.1| 6-phosphogluconate dehydrogenase, decarboxylating [Cucumis sativus]
Length=495

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA  EG LPL GQY
Sbjct  3    ASTALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            NPRDFVLSIQRPRSVIILVKAG PVDQTIAALS+H+EPGD II
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGLPVDQTIAALSDHLEPGDAII  105



>gb|ACM68927.1| 6-phosphogluconate dehydrogenase [Cucumis sativus]
Length=495

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA  EG LPL GQY
Sbjct  3    ASTALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            NPRDFVLSIQRPRSVIILVKAG PVDQTIAALS+H+EPGD II
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGLPVDQTIAALSDHLEPGDAII  105



>ref|XP_004168459.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
Length=495

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA  EG LPL GQY
Sbjct  3    ASTALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            NPRDFVLSIQRPRSVIILVKAG PVDQTIAALS+H+EPGD II
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGLPVDQTIAALSDHLEPGDAII  105



>ref|XP_010105006.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
 gb|EXC02963.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
Length=495

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA  EG LPL GQY
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            NPRDFVLSIQRPRSVIILVKAGAPVDQTIAAL++H+EPGD II
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALADHLEPGDAII  105



>emb|CDY34406.1| BnaA09g11480D [Brassica napus]
Length=118

 Score =   179 bits (454),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLS+QRPRS+IILVKAGAPVDQTIAA SE+MEPGD II
Sbjct  65   DFVLSLQRPRSLIILVKAGAPVDQTIAAFSEYMEPGDCII  104



>ref|XP_009336262.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic isoform X1 [Pyrus x bretschneideri]
 ref|XP_009336264.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic isoform X2 [Pyrus x bretschneideri]
Length=495

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA  EG LPL GQY
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            NPRDFVLSI+RPRSVIILVKAGAPVDQTIAALS HMEPGD II
Sbjct  63   NPRDFVLSIERPRSVIILVKAGAPVDQTIAALSAHMEPGDAII  105



>ref|XP_008451978.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Cucumis melo]
Length=495

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA  EG LPL GQY
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            NPRDFVLSIQRPRSVIILVKAG PVDQTIAALS+H+EPGD II
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGLPVDQTIAALSDHLEPGDAII  105



>gb|KJB52238.1| hypothetical protein B456_008G251800 [Gossypium raimondii]
Length=444

 Score =   188 bits (477),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETV+RAQ EGQLPL G Y
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVQRAQDEGQLPLFGHY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             PR+FVLSI+RPRSV+ILVKAG+PVDQTIAALS+HMEPGD II
Sbjct  63   TPREFVLSIKRPRSVVILVKAGSPVDQTIAALSDHMEPGDCII  105



>gb|KEH21177.1| decarboxylating-like 6-phosphogluconate dehydrogenase [Medicago 
truncatula]
Length=495

 Score =   188 bits (478),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA REG LPL GQY+
Sbjct  3    ASTLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHREGSLPLTGQYS  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PR+FVLS+QRPRSVIILVKAGAPVDQTI+ALS+HMEPGD II
Sbjct  63   PREFVLSLQRPRSVIILVKAGAPVDQTISALSDHMEPGDCII  104



>ref|XP_002275970.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Vitis vinifera]
Length=494

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA REG LPL G Y+
Sbjct  3    ASTLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAHREGHLPLSGHYS  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRS++ILVKAGAPVDQTIAALSEHME GD II
Sbjct  63   PRDFVLSIQRPRSIVILVKAGAPVDQTIAALSEHMEAGDCII  104



>ref|XP_004503648.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Cicer arietinum]
Length=494

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            +  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA REG LPL GQY+
Sbjct  3    SSTLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHREGSLPLTGQYS  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PR+FVLS+QRPRSVIILVKAG PVDQTIAALS+HMEPGD II
Sbjct  63   PREFVLSLQRPRSVIILVKAGNPVDQTIAALSDHMEPGDCII  104



>gb|EYU40043.1| hypothetical protein MIMGU_mgv1a019477mg [Erythranthe guttata]
Length=460

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALS+IGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVDET++RA REGQLPL G YNP+
Sbjct  5    ALSQIGLAGLAVMGQNLALNIAEKGFPISVYNRTISKVDETLDRAHREGQLPLTGHYNPK  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSI++PRS+IILVKAGAPVDQTIAALS HMEPGDTII
Sbjct  65   DFVLSIKKPRSIIILVKAGAPVDQTIAALSAHMEPGDTII  104



>emb|CAN63456.1| hypothetical protein VITISV_008240 [Vitis vinifera]
Length=494

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA REG LPL G Y 
Sbjct  3    ASTLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAHREGHLPLSGHYX  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRS++ILVKAGAPVDQTIAALSEHME GD II
Sbjct  63   PRDFVLSIQRPRSIVILVKAGAPVDQTIAALSEHMEAGDCII  104



>ref|XP_010545301.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Tarenaya hassleriana]
Length=491

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG+LP+ GQY+PRD
Sbjct  6    LSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAEEGKLPVSGQYSPRD  65

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FVLSIQRPRSV+ILVKAGAPVDQTIAALSEHMEPGD II
Sbjct  66   FVLSIQRPRSVVILVKAGAPVDQTIAALSEHMEPGDCII  104



>ref|XP_010447780.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Camelina sativa]
Length=487

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG+LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASDEGKLPVAGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRSVIILVKAGAPVDQTI+ALSE+MEPGD II
Sbjct  65   DFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCII  104



>ref|XP_007160132.1| hypothetical protein PHAVU_002G295300g [Phaseolus vulgaris]
 gb|ESW32126.1| hypothetical protein PHAVU_002G295300g [Phaseolus vulgaris]
Length=492

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVDETV+RA+ EG LPL GQYNPR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVDRARNEGFLPLTGQYNPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +FVLSIQRPRSVIILVKAGAPVDQTIAALS+H+EPGD II
Sbjct  65   EFVLSIQRPRSVIILVKAGAPVDQTIAALSDHLEPGDCII  104



>ref|XP_010436115.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Camelina sativa]
Length=487

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG+LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASDEGKLPVAGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRSVIILVKAGAPVDQTI+ALSE+MEPGD II
Sbjct  65   DFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCII  104



>ref|XP_010533610.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphogluconate dehydrogenase, 
decarboxylating 2, chloroplastic [Tarenaya hassleriana]
Length=481

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PRD
Sbjct  6    LSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAADEGNLPVSGQYSPRD  65

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGD II
Sbjct  66   FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDCII  104



>ref|XP_002868582.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44841.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=487

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASDEGNLPVAGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRSVIILVKAGAPVDQTI+ALSE+MEPGD II
Sbjct  65   DFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCII  104



>ref|NP_198982.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
 ref|NP_851113.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
 sp|Q9FFR3.1|6PGD2_ARATH RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Arabidopsis thaliana]
 dbj|BAB11473.1| 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
 gb|AAM78095.1| AT5g41670/MBK23_20 [Arabidopsis thaliana]
 gb|AAN72272.1| At5g41670/MBK23_20 [Arabidopsis thaliana]
 gb|AED94705.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
 gb|AED94706.1| 6-phosphogluconate dehydrogenase, decarboxylating 2 [Arabidopsis 
thaliana]
Length=487

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDET++RA  EG+LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASNEGKLPVAGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRSVIILVKAGAPVDQTI+ALSE+MEPGD II
Sbjct  65   DFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCII  104



>ref|XP_003533072.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Glycine max]
Length=495

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVDETV+RA+ EG LPL GQY PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVDRARNEGSLPLTGQYTPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLS+QRPRSVIILVKAGAPVDQTIAALS+H++PGD II
Sbjct  65   DFVLSLQRPRSVIILVKAGAPVDQTIAALSDHLDPGDCII  104



>ref|XP_009140108.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Brassica rapa]
Length=487

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDET++RA  EG+LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASEEGKLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRSVIILVKAGAPVDQTI+ALSE+MEPGD II
Sbjct  65   DFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCII  104



>emb|CDY39725.1| BnaA04g11280D [Brassica napus]
Length=487

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDET++RA  EG+LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASEEGKLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRSVIILVKAGAPVDQTI+ALSE+MEPGD II
Sbjct  65   DFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCII  104



>emb|CDY44457.1| BnaCnng11100D [Brassica napus]
Length=487

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDET++RA  EG+LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASEEGKLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRSVIILVKAGAPVDQTI+ALSE+MEPGD II
Sbjct  65   DFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCII  104



>ref|XP_011080880.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Sesamum indicum]
Length=488

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            A+S+IGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA REGQLPL GQY P+
Sbjct  5    AMSQIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAHREGQLPLFGQYTPK  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSI++PRS+IILVKAGAPVDQTIAALS +MEPGDTII
Sbjct  65   DFVLSIKKPRSIIILVKAGAPVDQTIAALSAYMEPGDTII  104



>ref|XP_002517676.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
 gb|EEF44840.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNR+TSKVDET+ RAQ EG  PL G Y
Sbjct  3    ASVALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETIHRAQNEGPFPLTGHY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             PRDFVLS+QRPRSVIILVKAGAPVDQTIAALSEHME GD II
Sbjct  63   TPRDFVLSLQRPRSVIILVKAGAPVDQTIAALSEHMEAGDCII  105



>ref|XP_006286028.1| hypothetical protein CARUB_v10007559mg [Capsella rubella]
 gb|EOA18926.1| hypothetical protein CARUB_v10007559mg [Capsella rubella]
Length=476

 Score =   182 bits (463),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLA LAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG+LP+ GQY+PR
Sbjct  5    ALSRIGLASLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASDEGKLPVAGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRSVIILVKAGAPVDQTI+ALSE+MEPGD II
Sbjct  65   DFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCII  104



>ref|XP_011026944.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Populus euphratica]
Length=494

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET+ RAQ EG  PL GQY+
Sbjct  3    ASTLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLHRAQSEGPFPLTGQYS  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRS+IILVKAG PVDQTI+AL+E MEPGDTII
Sbjct  63   PRDFVLSIQRPRSIIILVKAGNPVDQTISALTEFMEPGDTII  104



>ref|XP_010261979.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Nelumbo nucifera]
Length=495

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET+ERA+ EG LPL G Y
Sbjct  3    ASTALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLERAKEEGNLPLTGHY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +PRDFVLS+QRPRSVIILVKAG+PVDQTI ALS+ M+PGD II
Sbjct  63   SPRDFVLSLQRPRSVIILVKAGSPVDQTIGALSQFMDPGDCII  105



>ref|XP_002297992.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE82797.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=494

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET+ RAQ EG  PL GQY+
Sbjct  3    ASTLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLHRAQSEGPFPLTGQYS  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRS+IILVKAG PVDQTI+AL+E MEPGDTII
Sbjct  63   PRDFVLSIQRPRSIIILVKAGNPVDQTISALTEFMEPGDTII  104



>ref|XP_002509902.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
 gb|EEF51289.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNR+TSKVD+T+ RAQ EG  PL G Y
Sbjct  3    ASVALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDDTIHRAQNEGPFPLTGHY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             PRDFVLS+QRPRSVIILVKAGAPVDQTIAALSEHME GD II
Sbjct  63   TPRDFVLSLQRPRSVIILVKAGAPVDQTIAALSEHMEAGDCII  105



>ref|XP_010441331.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Camelina sativa]
Length=487

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG+L + GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASDEGKLRVAGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRSVIILVKAGAPVDQTI+ALSE+MEPGD II
Sbjct  65   DFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCII  104



>ref|XP_010273961.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nelumbo nucifera]
 ref|XP_010273962.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nelumbo nucifera]
 ref|XP_010273963.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Nelumbo nucifera]
Length=518

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTT+KVDET+ERAQ+EG LPL G Y
Sbjct  3    ASMTLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTTKVDETLERAQQEGNLPLTGHY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +PRDFVLS+QRPRSVIILVKAG+PVDQTIAALSE ME GD II
Sbjct  63   SPRDFVLSLQRPRSVIILVKAGSPVDQTIAALSEFMEAGDCII  105



>ref|XP_011462415.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Fragaria vesca subsp. vesca]
Length=494

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRT+SKVDETV RA  EG LPL GQY
Sbjct  3    ASTALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTSSKVDETVHRAATEGDLPLSGQY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             P+DFVLS+QRPRSVIILVKAGAPVDQTIAALS +MEPGD II
Sbjct  63   TPKDFVLSLQRPRSVIILVKAGAPVDQTIAALSAYMEPGDAII  105



>gb|AAM61057.1| 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
Length=486

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+A+KGFPISVYNRTT KVDET++RA  EG+LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTPKVDETLDRASNEGKLPVAGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRSVIILVKAGAPVDQTI ALSE+MEPGD II
Sbjct  65   DFVLSIQRPRSVIILVKAGAPVDQTITALSEYMEPGDCII  104



>gb|KDP25346.1| hypothetical protein JCGZ_20502 [Jatropha curcas]
Length=492

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVDET+ RA  EG  PL G Y
Sbjct  3    ASIALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTGSKVDETIHRAHNEGPFPLTGHY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +PRDFVLSIQRPRSVIILVKAG PVDQTIAALSEH+EPGD II
Sbjct  63   SPRDFVLSIQRPRSVIILVKAGKPVDQTIAALSEHLEPGDCII  105



>emb|CDY25568.1| BnaC09g11930D [Brassica napus]
Length=487

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLS+QRPRS+IILVKAGAPVDQTIAA SE+MEPGD II
Sbjct  65   DFVLSLQRPRSLIILVKAGAPVDQTIAAFSEYMEPGDCII  104



>ref|XP_009112895.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Brassica rapa]
Length=487

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLS+QRPRS+IILVKAGAPVDQTIAA SE+MEPGD II
Sbjct  65   DFVLSLQRPRSLIILVKAGAPVDQTIAAFSEYMEPGDCII  104



>gb|EPS67575.1| hypothetical protein M569_07199, partial [Genlisea aurea]
Length=485

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTT+KVDETVERA REG LPL G+Y+P+
Sbjct  2    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTTKVDETVERAHREGHLPLFGKYSPQ  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +FVLSIQ+PRS+IILVKAGAPVDQTIAALS  M+PGDTII
Sbjct  62   EFVLSIQKPRSIIILVKAGAPVDQTIAALSAFMDPGDTII  101



>ref|XP_011073556.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Sesamum indicum]
Length=488

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LS+IGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA REGQLPL G Y P+D
Sbjct  6    LSQIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAHREGQLPLSGHYTPKD  65

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FVLSI++PRS+IILVKAGAPVDQTIAALS +MEPGDTII
Sbjct  66   FVLSIKKPRSIIILVKAGAPVDQTIAALSAYMEPGDTII  104



>ref|XP_006391656.1| hypothetical protein EUTSA_v10023427mg [Eutrema salsugineum]
 gb|ESQ28942.1| hypothetical protein EUTSA_v10023427mg [Eutrema salsugineum]
Length=487

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRASVEGNLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRS+IILVKAGAPVD TIAA SE+MEPGD II
Sbjct  65   DFVLSIQRPRSLIILVKAGAPVDHTIAAFSEYMEPGDCII  104



>ref|NP_176601.1| 6-phosphogluconate dehydrogenase, decarboxylating 1 [Arabidopsis 
thaliana]
 sp|Q9SH69.1|6PGD1_ARATH RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Arabidopsis thaliana]
 gb|AAF24560.1|AC007764_2 F22C12.5 [Arabidopsis thaliana]
 gb|AAO42814.1| At1g64190 [Arabidopsis thaliana]
 dbj|BAE99587.1| putative 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
 gb|AEE34207.1| 6-phosphogluconate dehydrogenase, decarboxylating 1 [Arabidopsis 
thaliana]
Length=487

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRS+IILVKAGAPVDQTI A SE+MEPGD II
Sbjct  65   DFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCII  104



>ref|XP_003525354.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Glycine max]
Length=495

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVD+TV+RA+ EG LPL GQY PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDQTVDRARNEGSLPLTGQYTPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLS+QRPRSVIILVKAG+PVD TIAALS+H++PGD II
Sbjct  65   DFVLSLQRPRSVIILVKAGSPVDHTIAALSDHLDPGDCII  104



>ref|XP_010473675.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Camelina sativa]
Length=487

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRS+IILVKAGAPVDQTI A SE+MEPGD II
Sbjct  65   DFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCII  104



>ref|XP_006301732.1| hypothetical protein CARUB_v10022193mg [Capsella rubella]
 gb|EOA34630.1| hypothetical protein CARUB_v10022193mg [Capsella rubella]
Length=487

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRS+IILVKAGAPVDQTI A SE+MEPGD II
Sbjct  65   DFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCII  104



>ref|XP_010430539.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic [Camelina sativa]
Length=487

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRS+IILVKAGAPVDQTI A SE+MEPGD II
Sbjct  65   DFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCII  104



>ref|XP_002886358.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH62617.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=487

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRS+IILVKAGAPVDQTI A SE+MEPGD II
Sbjct  65   DFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCII  104



>gb|KCW77439.1| hypothetical protein EUGRSUZ_D01779, partial [Eucalyptus grandis]
Length=246

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALNVA+KGFPISVYNRT SKVDET++RA  EG LPL G Y
Sbjct  3    ASVALSRIGLAGLAVMGQNLALNVADKGFPISVYNRTASKVDETLDRAAAEGGLPLSGHY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +PRDFVLSI+ PRSVIILVKAGAPVDQTIAAL++HM PGD II
Sbjct  63   SPRDFVLSIRPPRSVIILVKAGAPVDQTIAALADHMSPGDCII  105



>ref|XP_010054765.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like, partial [Eucalyptus grandis]
Length=248

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALNVA+KGFPISVYNRT SKVDET++RA  EG LPL G Y
Sbjct  3    ASVALSRIGLAGLAVMGQNLALNVADKGFPISVYNRTASKVDETLDRAAAEGGLPLSGHY  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +PRDFVLSI+ PRSVIILVKAGAPVDQTIAAL++HM PGD II
Sbjct  63   SPRDFVLSIRPPRSVIILVKAGAPVDQTIAALADHMSPGDCII  105



>ref|XP_010418473.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Camelina sativa]
Length=487

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET++RA  EG LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSIQRPRS+IILVKAGAPVDQTI A SE+M+PGD II
Sbjct  65   DFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMDPGDCII  104



>gb|KFK36587.1| hypothetical protein AALP_AA4G143200 [Arabis alpina]
Length=488

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTT+KVDET++RA  EG+LP+ GQY+PR
Sbjct  5    ALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTTKVDETLDRAIIEGKLPVTGQYSPR  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DF+LSIQRPRS+IILVKAG+PVDQTI A S++MEPGDTII
Sbjct  65   DFILSIQRPRSIIILVKAGSPVDQTIDAFSQYMEPGDTII  104



>ref|XP_011022562.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Populus euphratica]
Length=494

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET+ RAQ EG   L GQY+
Sbjct  3    ASTLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLIRAQSEGPFSLTGQYS  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRS+IILVKAG PVDQTI+AL+E MEPGDTII
Sbjct  63   PRDFVLSIQRPRSIIILVKAGNPVDQTISALTEFMEPGDTII  104



>ref|XP_002304540.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE79519.1| 6-phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=492

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET+ RAQ EG   L G Y+
Sbjct  3    ASTLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLIRAQSEGPFSLTGHYS  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSIQRPRS+IILVKAG PVDQTI+AL+E MEPGDTII
Sbjct  63   PRDFVLSIQRPRSIIILVKAGNPVDQTISALTEFMEPGDTII  104



>ref|XP_002972874.1| hypothetical protein SELMODRAFT_98399 [Selaginella moellendorffii]
 gb|EFJ26095.1| hypothetical protein SELMODRAFT_98399 [Selaginella moellendorffii]
Length=491

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQNLALN+ EKGFPISVYNRT SKVDETVERA+ EG LPL G  N
Sbjct  3    ATALSRIGLAGLAVMGQNLALNIGEKGFPISVYNRTASKVDETVERAKAEGNLPLAGYRN  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P+DFVLSIQRPRSVIILVKAGAPVDQTIA L++ MEPGD II
Sbjct  63   PQDFVLSIQRPRSVIILVKAGAPVDQTIATLAQFMEPGDCII  104



>ref|XP_001764215.1| predicted protein [Physcomitrella patens]
 gb|EDQ71056.1| predicted protein [Physcomitrella patens]
Length=500

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  173  VAMEVAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQL  352
            +A  VAA   +SRIGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVDETVERA+ EG L
Sbjct  1    MAEAVAAGVGVSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTDSKVDETVERAKEEGDL  60

Query  353  PLVGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PLVG  +P++FVLSIQ+PRS+IILVKAGAPVDQTI  LS++MEPGD II
Sbjct  61   PLVGFKDPKEFVLSIQKPRSIIILVKAGAPVDQTIQTLSQYMEPGDCII  109



>ref|XP_002988062.1| hypothetical protein SELMODRAFT_127384 [Selaginella moellendorffii]
 gb|EFJ10854.1| hypothetical protein SELMODRAFT_127384 [Selaginella moellendorffii]
Length=491

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQNLALN+ EKGFPISVYNRT  KVDETVERA+ EG LPL G  N
Sbjct  3    ATALSRIGLAGLAVMGQNLALNIGEKGFPISVYNRTAGKVDETVERAKAEGNLPLAGYRN  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P+DFVLSIQRPRSVIILVKAGAPVDQTIA L++ MEPGD II
Sbjct  63   PQDFVLSIQRPRSVIILVKAGAPVDQTIATLAQFMEPGDCII  104



>ref|XP_010905189.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Elaeis guineensis]
Length=496

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A A+SRIGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVDETV RA  EG LPL+G + 
Sbjct  3    AAAMSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVGRASAEGGLPLIGHHT  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSI RPRS+IILVKAGAPVDQTIAALS+ M+PGD II
Sbjct  63   PRDFVLSIARPRSIIILVKAGAPVDQTIAALSQFMDPGDAII  104



>ref|XP_001770880.1| predicted protein [Physcomitrella patens]
 gb|EDQ64210.1| predicted protein [Physcomitrella patens]
Length=500

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  173  VAMEVAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQL  352
            +A  VAA   +SRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG L
Sbjct  1    MAEAVAAGVGVSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKEEGDL  60

Query  353  PLVGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PL G  +P++FV+SIQ+PRS+I+LVKAGAPVDQTI  L+++MEPGD II
Sbjct  61   PLTGYKDPKEFVMSIQKPRSIILLVKAGAPVDQTIQTLAQYMEPGDCII  109



>ref|XP_008811378.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1, chloroplastic-like [Phoenix dactylifera]
Length=496

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVDETV RA  EG LPL G ++
Sbjct  3    AAALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVGRASVEGGLPLTGHHS  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSI RPRS++ILVKAGAPVDQT+AALS+ M+PGD+II
Sbjct  63   PRDFVLSISRPRSIVILVKAGAPVDQTVAALSQFMDPGDSII  104



>ref|XP_007209994.1| hypothetical protein PRUPE_ppa005270mg [Prunus persica]
 gb|EMJ11193.1| hypothetical protein PRUPE_ppa005270mg [Prunus persica]
Length=469

 Score =   169 bits (429),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+ ALSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA  EG LPL GQ 
Sbjct  3    ASPALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVDRAHNEGNLPLFGQN  62

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALS  469
            NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALS
Sbjct  63   NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALS  95



>ref|XP_010676957.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=582

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            ++IGLAGLAVMGQNLALN+AEKGFPISVYNRT+SKVDET+ RA+ EG LPL+G Y PRDF
Sbjct  94   AQIGLAGLAVMGQNLALNIAEKGFPISVYNRTSSKVDETLNRAKIEGDLPLIGHYTPRDF  153

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            VLSIQRPRS+IILVKAG+PVDQTI +LS  MEPGDTII
Sbjct  154  VLSIQRPRSIIILVKAGSPVDQTINSLSSFMEPGDTII  191



>ref|XP_008805334.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphogluconate dehydrogenase, 
decarboxylating 1, chloroplastic-like [Phoenix dactylifera]
Length=495

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQNLALN+A+KGFPISVYNRT SKVDETV RA  EG LPL G ++
Sbjct  3    AAALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTASKVDETVGRAAVEGGLPLSGHHS  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSI RPRSVIILVKAGAPVDQTIA LS+ M+PGD+II
Sbjct  63   PRDFVLSIARPRSVIILVKAGAPVDQTIATLSQFMDPGDSII  104



>ref|XP_010917535.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Elaeis guineensis]
Length=496

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRT SKVDETV RA  EG  PL G ++
Sbjct  3    AAALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTASKVDETVGRAAAEGGPPLSGHHS  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PRDFVLSI RPRS+IILVKAGAPVDQTIA LS+ M+PGD+II
Sbjct  63   PRDFVLSIARPRSIIILVKAGAPVDQTIATLSQFMDPGDSII  104



>sp|Q94KU2.1|6PGD2_SPIOL RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic; Flags: Precursor [Spinacia oleracea]
 gb|AAK49897.1|AF295670_1 plastidic 6-phosphogluconate dehydrogenase [Spinacia oleracea]
Length=537

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            A S+IGL GLAVMGQNLALN+AEKGFPISVYNRT SKVDET++RA+ EG LPL G Y PR
Sbjct  47   AASQIGLVGLAVMGQNLALNIAEKGFPISVYNRTASKVDETLDRAKSEGDLPLSGHYTPR  106

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSI+RPRS++ILVKAG+PVDQTIA+L+  MEPGDTII
Sbjct  107  DFVLSIERPRSIVILVKAGSPVDQTIASLASFMEPGDTII  146



>ref|XP_006856410.1| hypothetical protein AMTR_s00047p00215210 [Amborella trichopoda]
 gb|ERN17877.1| hypothetical protein AMTR_s00047p00215210 [Amborella trichopoda]
Length=492

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 92/107 (86%), Gaps = 3/107 (3%)
 Frame = +2

Query  179  MEVAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPL  358
            MEVA    LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVD+TV RA  EG LPL
Sbjct  1    MEVAT---LSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDDTVHRADAEGGLPL  57

Query  359  VGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +G  +P+DF+LSIQRPRSV+ILVKAG PVDQTIA LS  MEPGD +I
Sbjct  58   LGHRSPQDFILSIQRPRSVVILVKAGRPVDQTIATLSAFMEPGDCLI  104



>ref|XP_009392493.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=494

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRT SKVDETV RA  EG LPL G  +P+
Sbjct  5    ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTASKVDETVSRAATEGGLPLSGHRSPQ  64

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLS++RPR+V+ILVKAGAPVDQTIAALS  MEPGD II
Sbjct  65   DFVLSLRRPRAVVILVKAGAPVDQTIAALSHFMEPGDAII  104



>ref|XP_008803614.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Phoenix dactylifera]
Length=488

 Score =   167 bits (423),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+REG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR +I+LVKAGAPVDQTIA LS HME GD II
Sbjct  62   SFVKSIQKPRVIIMLVKAGAPVDQTIATLSAHMEKGDCII  101



>ref|XP_009388425.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009388426.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Musa acuminata subsp. malaccensis]
Length=484

 Score =   167 bits (422),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+REG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR +I+LVKAGAPVDQTIA LS HME GD II
Sbjct  62   SFVNSIQKPRVIIMLVKAGAPVDQTIATLSSHMEKGDCII  101



>gb|AFF18788.1| 6-phosphogluconate dehydrogenase, partial [Dimocarpus longan]
Length=131

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LP+ G ++P  F
Sbjct  1    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPVYGYHDPEAF  60

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  61   VQSIQKPRVIIMLVKAGAPVDQTIKTLSTYMEKGDCII  98



>gb|AAC79950.1| 6-phosphogluconate dehydrogenase isoenzyme B [Zea mays]
Length=178

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKAEGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD II
Sbjct  62   SFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCII  101



>ref|XP_006348606.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Solanum tuberosum]
Length=485

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            VLSIQ+PR +IILVKAGAPVDQTI  LS +ME GD II
Sbjct  65   VLSIQKPRVIIILVKAGAPVDQTIKTLSSYMEKGDCII  102



>gb|AFF18789.1| cytosolic 6-phosphogluconate dehydrogenase, partial [Dimocarpus 
longan]
Length=135

 Score =   156 bits (395),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G  +P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFRDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  65   VQSIQKPRVIIMLVKAGAPVDQTIKTLSVYMEKGDCII  102



>ref|XP_006379723.1| hypothetical protein POPTR_0008s112802g, partial [Populus trichocarpa]
 gb|ERP57520.1| hypothetical protein POPTR_0008s112802g, partial [Populus trichocarpa]
Length=185

 Score =   157 bits (398),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTT KVDETVERA++EG LPL G ++P  
Sbjct  4    LTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTLKVDETVERAKQEGDLPLYGFHDPES  63

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQ+PR +IILVKAGAPVDQTI  LS +ME GD II
Sbjct  64   FVKSIQKPRVIIILVKAGAPVDQTIKTLSVYMEKGDCII  102



>ref|XP_006857727.1| hypothetical protein AMTR_s00061p00182310 [Amborella trichopoda]
 gb|ERN19194.1| hypothetical protein AMTR_s00061p00182310 [Amborella trichopoda]
Length=488

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A++LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+REG L L G ++
Sbjct  2    AESLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLHLRGFHD  61

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P+ FV SIQ+PR VI+LVKAGAPVDQTI  LS +ME GD II
Sbjct  62   PKSFVQSIQKPRVVIMLVKAGAPVDQTIQTLSTYMEKGDCII  103



>ref|XP_006849590.1| hypothetical protein AMTR_s00024p00196750 [Amborella trichopoda]
 gb|ERN11171.1| hypothetical protein AMTR_s00024p00196750 [Amborella trichopoda]
Length=492

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVD+TV RA  EG LPL G  +
Sbjct  3    AATLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDDTVHRANAEGGLPLFGHRS  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P+DF+LSIQRPRS++ILVKAG PVDQTI  LS  MEPGD +I
Sbjct  63   PQDFILSIQRPRSIVILVKAGRPVDQTIETLSTFMEPGDCLI  104



>ref|XP_010261653.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X3 [Nelumbo nucifera]
Length=486

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+REG LPL G ++P  
Sbjct  5    LTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPLYGFHDPES  64

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQRPR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  65   FVRSIQRPRVIIMLVKAGAPVDQTIKTLSVYMEKGDCII  103



>ref|XP_010261649.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Nelumbo nucifera]
Length=490

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+REG LPL G ++P  
Sbjct  5    LTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPLYGFHDPES  64

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQRPR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  65   FVRSIQRPRVIIMLVKAGAPVDQTIKTLSVYMEKGDCII  103



>ref|XP_004238989.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Solanum lycopersicum]
Length=485

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LPL G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKNEGNLPLYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            VLSIQ+PR +IILVKAGAPVDQTI  LS +ME GD II
Sbjct  65   VLSIQKPRVIIILVKAGAPVDQTIKTLSSYMEKGDCII  102



>ref|XP_009386035.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=496

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LSRIGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVDETV RA  EG LP+ G  + +D
Sbjct  8    LSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVSRAAAEGGLPMSGHRSAQD  67

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FVLS++RPRSVIILVKAGAPVDQTIAALS  MEPGD II
Sbjct  68   FVLSLRRPRSVIILVKAGAPVDQTIAALSHFMEPGDAII  106



>gb|AAC79957.1| 6-phosphogluconate dehydrogenase isoenzyme A [Zea mays]
Length=178

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVFGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H++ GD I+
Sbjct  62   SFVSSIQKPRVVIMLVKAGAPVDQTIATLAAHLDQGDCIV  101



>ref|XP_007151436.1| hypothetical protein PHAVU_004G046100g [Phaseolus vulgaris]
 gb|ESW23430.1| hypothetical protein PHAVU_004G046100g [Phaseolus vulgaris]
Length=490

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERAQ+EG+LP+ G ++P+ 
Sbjct  7    LTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAQKEGKLPVYGYHDPKS  66

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD II
Sbjct  67   FVQSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCII  105



>ref|XP_006441889.1| hypothetical protein CICLE_v10023851mg [Citrus clementina]
 gb|ESR55129.1| hypothetical protein CICLE_v10023851mg [Citrus clementina]
Length=438

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A ALSRIGLAGLAVMGQ LALNVAEKGFPISVYNRTTSKVDET++RA REGQL L G Y 
Sbjct  3    ASALSRIGLAGLAVMGQKLALNVAEKGFPISVYNRTTSKVDETLDRAHREGQLRLTGHYT  62

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSE  472
             RDFVLS+QRPRSVIILVKAG+PVDQTI ALSE
Sbjct  63   RRDFVLSLQRPRSVIILVKAGSPVDQTITALSE  95



>ref|XP_009619672.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana tomentosiformis]
 ref|XP_009619673.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana tomentosiformis]
 ref|XP_009619674.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana tomentosiformis]
Length=484

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNR+TSKVDETVERA++EG LPL G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGNLPLYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            VLSIQ+PR +IILVKAGAPVDQTI  LS +ME GD II
Sbjct  65   VLSIQKPRVIIILVKAGAPVDQTIKTLSAYMEKGDCII  102



>ref|XP_009773713.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana sylvestris]
 ref|XP_009773720.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana sylvestris]
 ref|XP_009773725.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Nicotiana sylvestris]
Length=484

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNR+TSKVDETVERA++EG LPL G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGNLPLYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            VLSIQ+PR +IILVKAGAPVDQTI  LS +ME GD II
Sbjct  65   VLSIQKPRVIIILVKAGAPVDQTIKTLSAYMEKGDCII  102



>ref|XP_010920025.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Elaeis guineensis]
Length=488

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
             L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LP+ G ++P 
Sbjct  2    GLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR +IILVKAGAPVDQTIA LS HME GD II
Sbjct  62   SFVHSIQKPRVIIILVKAGAPVDQTIATLSAHMEEGDCII  101



>ref|XP_008788546.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Phoenix dactylifera]
Length=488

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
             L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LP+ G ++P 
Sbjct  2    GLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR +I+LVKAGAPVDQTIA LS HME GD II
Sbjct  62   SFVHSIQKPRVIIMLVKAGAPVDQTIATLSTHMEKGDCII  101



>gb|AAC79949.1| 6-phosphogluconate dehydrogenase isoenzyme A [Zea mays]
Length=178

 Score =   154 bits (390),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVY+RTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYDRTTSKVDETVQRAKVEGNLPVFGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H++ GD I+
Sbjct  62   SFVSSIQKPRVVIMLVKAGAPVDQTIATLAAHLDQGDCIV  101



>ref|XP_009399427.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009399428.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=484

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR +I+LVKAGAPVDQTIA LS H+E GD II
Sbjct  62   SFVNSIQKPRVIIMLVKAGAPVDQTIATLSAHLEKGDCII  101



>ref|XP_009378306.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Pyrus x bretschneideri]
 ref|XP_009378308.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Pyrus x bretschneideri]
Length=488

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P+ F
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPQSF  67

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR VI+LVKAGAPVDQTI  LS H+E GD II
Sbjct  68   VKSIQKPRVVIMLVKAGAPVDQTIKTLSVHLEKGDCII  105



>ref|XP_009399426.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=541

 Score =   162 bits (411),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  167  RFVAMEVAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG  346
            R V++ +    AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG
Sbjct  48   RRVSVSLRLNMALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEG  107

Query  347  QLPLVGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             LP+ G ++P  FV SIQ+PR +I+LVKAGAPVDQTIA LS H+E GD II
Sbjct  108  NLPVYGFHDPASFVNSIQKPRVIIMLVKAGAPVDQTIATLSAHLEKGDCII  158



>ref|XP_002530803.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
 gb|EEF31571.1| 6-phosphogluconate dehydrogenase, putative [Ricinus communis]
Length=488

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+REG LPL G ++P  F
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGDLPLYGFHDPESF  67

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  68   VKSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCII  105



>ref|XP_009774328.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nicotiana sylvestris]
 ref|XP_009774330.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nicotiana sylvestris]
 ref|XP_009774331.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nicotiana sylvestris]
Length=485

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +IILVKAGAPVDQTI  LS +ME GD II
Sbjct  65   VNSIQKPRVIIILVKAGAPVDQTIKTLSAYMEKGDCII  102



>ref|XP_010257854.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Nelumbo nucifera]
Length=486

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A  L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++
Sbjct  2    AAPLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHD  61

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P  FV SIQ+PR +IILVKAGAPVDQTI  LS +ME GD II
Sbjct  62   PEAFVQSIQKPRVIIILVKAGAPVDQTIKTLSVYMEKGDCII  103



>ref|XP_010933404.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Elaeis guineensis]
 ref|XP_010933405.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Elaeis guineensis]
Length=488

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPIYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR +I+LVKAGAPVDQTIA LS +ME GD II
Sbjct  62   SFVNSIQKPRVIIMLVKAGAPVDQTIATLSAYMEKGDCII  101



>ref|XP_010261635.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Nelumbo nucifera]
 ref|XP_010261644.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Nelumbo nucifera]
Length=511

 Score =   161 bits (408),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 80/102 (78%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A  L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+REG LPL G ++
Sbjct  2    AVPLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPLYGFHD  61

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P  FV SIQRPR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  62   PESFVRSIQRPRVIIMLVKAGAPVDQTIKTLSVYMEKGDCII  103



>gb|KDP24308.1| hypothetical protein JCGZ_25604 [Jatropha curcas]
Length=488

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+REG LPL G ++P  F
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGDLPLYGFHDPEAF  67

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  68   VQSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCII  105



>ref|XP_009610999.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Nicotiana tomentosiformis]
 ref|XP_009611000.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Nicotiana tomentosiformis]
 ref|XP_009611001.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Nicotiana tomentosiformis]
Length=485

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR  IILVKAGAPVDQTI  LS +ME GD II
Sbjct  65   VNSIQKPRVTIILVKAGAPVDQTIKTLSAYMEKGDCII  102



>ref|XP_008459418.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Cucumis melo]
 ref|XP_008459420.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Cucumis melo]
Length=487

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  185  VAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVG  364
            +AA   L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LPL G
Sbjct  1    MAAPGKLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKAEGNLPLYG  60

Query  365  QYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             ++P  FV SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD II
Sbjct  61   FHDPESFVQSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCII  105



>ref|XP_006601856.1| PREDICTED: 6-phosphogluconate dehydrogenase isoform X1 [Glycine 
max]
 gb|KHN13784.1| 6-phosphogluconate dehydrogenase, decarboxylating [Glycine soja]
Length=486

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            AQ  +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LP+ G ++
Sbjct  2    AQPTTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPVYGYHD  61

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P  FV SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  62   PEAFVHSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCII  103



>ref|XP_003557150.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Brachypodium distachyon]
Length=479

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LPL G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKIEGNLPLYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD II
Sbjct  62   SFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCII  101



>emb|CDM86736.1| unnamed protein product [Triticum aestivum]
Length=479

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LPL G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKLEGNLPLYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD I+
Sbjct  62   SFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIV  101



>ref|XP_006603945.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Glycine max]
 gb|KHN30764.1| 6-phosphogluconate dehydrogenase, decarboxylating [Glycine soja]
Length=488

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            +L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVDETVERA++EG LP+ G ++P+
Sbjct  6    SLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVERAKQEGNLPVYGYHDPK  65

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR +I+LVKAGAPVDQTI  LS H+E GD II
Sbjct  66   FFVQSIQKPRVIIMLVKAGAPVDQTIKTLSAHLEKGDCII  105



>ref|NP_001104911.1| 6-phosphogluconate dehydrogenase2 [Zea mays]
 gb|AAC27703.1| putative cytosolic 6-phosphogluconate dehydrogenase [Zea mays]
Length=482

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKAEGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD II
Sbjct  62   SFVKSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCII  101



>gb|KJB10518.1| hypothetical protein B456_001G205600 [Gossypium raimondii]
Length=485

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPLFGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  65   VQSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCII  102



>ref|XP_003531895.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform 1 [Glycine max]
 gb|KHN14455.1| 6-phosphogluconate dehydrogenase, decarboxylating [Glycine soja]
Length=486

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            AQ  +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LP+ G ++
Sbjct  2    AQPSTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPVYGYHD  61

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P  FV SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  62   PEAFVHSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCII  103



>gb|KEH21786.1| decarboxylating-like 6-phosphogluconate dehydrogenase [Medicago 
truncatula]
Length=486

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            AQ L+RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDETVERA++EG LPL G ++
Sbjct  2    AQPLTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHD  61

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P  FV SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD II
Sbjct  62   PEAFVNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCII  103



>ref|XP_009373738.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Pyrus x bretschneideri]
Length=488

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  185  VAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVG  364
            +AA    +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G
Sbjct  1    MAATPKPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYG  60

Query  365  QYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             ++P  FV SIQ+PR VI+LVKAGAPVDQTI  LS ++E GD II
Sbjct  61   FHDPESFVKSIQKPRVVIMLVKAGAPVDQTIKTLSVYLEKGDCII  105



>ref|XP_008341826.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Malus domestica]
Length=488

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  185  VAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVG  364
            +AA    +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G
Sbjct  1    MAATPKPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYG  60

Query  365  QYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             ++P  FV SIQ+PR VI+LVKAGAPVDQTI  LS ++E GD II
Sbjct  61   FHDPESFVKSIQKPRVVIMLVKAGAPVDQTIKTLSVYLEKGDCII  105



>ref|NP_001266302.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 1 [Zea mays]
 gb|ACF85199.1| unknown [Zea mays]
 gb|ACF87821.1| unknown [Zea mays]
 gb|ACR36789.1| unknown [Zea mays]
 gb|AFW75252.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 1 [Zea mays]
 gb|AFW75253.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 2 [Zea mays]
 gb|AFW75254.1| 6-phosphogluconate dehydrogenase isoenzyme B isoform 3 [Zea mays]
Length=482

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKAEGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD II
Sbjct  62   SFVKSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCII  101



>ref|XP_006482343.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Citrus sinensis]
 ref|XP_006482344.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Citrus sinensis]
Length=487

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
             + L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G  +
Sbjct  4    GKQLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLFGFLD  63

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P  FV SIQ+PR +I+LVKAGAPVD+TI  LS +ME GD II
Sbjct  64   PESFVNSIQKPRVIIMLVKAGAPVDETIKTLSAYMEKGDCII  105



>gb|KDO38968.1| hypothetical protein CISIN_1g011394mg [Citrus sinensis]
Length=474

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
             + L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G  +
Sbjct  4    GKQLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLFGFRD  63

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P  FV SIQ+PR +I+LVKAGAPVD+TI  LS +ME GD II
Sbjct  64   PESFVNSIQKPRVIIMLVKAGAPVDETIKTLSAYMEKGDCII  105



>ref|XP_010549952.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Tarenaya hassleriana]
 gb|ABD96861.1| hypothetical protein [Cleome spinosa]
Length=485

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            A A +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+REG LP+ G ++
Sbjct  2    AVAPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKREGNLPVYGFHD  61

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P  FV SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  62   PESFVNSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEEGDCII  103



>gb|EMS57148.1| 6-phosphogluconate dehydrogenase, decarboxylating [Triticum urartu]
Length=480

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +2

Query  188  AAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQ  367
            A   AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+R + EG LPL G 
Sbjct  99   AYEMALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRTKLEGNLPLYGF  158

Query  368  YNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            ++P  FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD I+
Sbjct  159  HDPASFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIV  202



>ref|XP_004237068.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Solanum lycopersicum]
 ref|XP_010319490.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Solanum lycopersicum]
Length=485

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNR+TSKVDETVERA++EG LPL G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGNLPLYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            VLSIQ+PR +IILVKAG PVDQTI  LS  ME GD II
Sbjct  65   VLSIQKPRVIIILVKAGLPVDQTIKTLSAFMEKGDCII  102



>gb|EMT22120.1| 6-phosphogluconate dehydrogenase, decarboxylating [Aegilops tauschii]
Length=595

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LPL G ++P 
Sbjct  118  ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKLEGNLPLYGFHDPA  177

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD I+
Sbjct  178  SFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIV  217



>gb|AHM10416.1| 6-phosphogluconate dehydrogenase [Saccharum hybrid cultivar Yacheng05-179]
Length=480

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVQRAKVEGNLPVFGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VIILVKAGAPVDQTIA L+ H+E GD II
Sbjct  62   SFVSSIQKPRVVIILVKAGAPVDQTIATLAAHLEHGDCII  101



>ref|XP_007032948.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY03874.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=485

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LP+ G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPVFGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS++ME GD II
Sbjct  65   VQSIQKPRVIIMLVKAGAPVDQTIKTLSKYMEKGDCII  102



>gb|KDO38967.1| hypothetical protein CISIN_1g011394mg [Citrus sinensis]
Length=487

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
             + L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G  +
Sbjct  4    GKQLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLFGFRD  63

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P  FV SIQ+PR +I+LVKAGAPVD+TI  LS +ME GD II
Sbjct  64   PESFVNSIQKPRVIIMLVKAGAPVDETIKTLSAYMEKGDCII  105



>ref|XP_004964329.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X1 [Setaria italica]
 ref|XP_004964330.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X2 [Setaria italica]
Length=481

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKAEGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD II
Sbjct  62   SFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCII  101



>ref|XP_004971196.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like [Setaria italica]
Length=480

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD II
Sbjct  62   SFVSSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCII  101



>ref|XP_006430886.1| hypothetical protein CICLE_v10011597mg [Citrus clementina]
 gb|ESR44126.1| hypothetical protein CICLE_v10011597mg [Citrus clementina]
Length=487

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
             + L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G  +
Sbjct  4    GKQLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPLFGFRD  63

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P  FV SIQ+PR +I+LVKAGAPVD+TI  LS +ME GD II
Sbjct  64   PESFVNSIQKPRVIIMLVKAGAPVDETIKTLSAYMEKGDCII  105



>ref|XP_007032950.1| 6-phosphogluconate dehydrogenase family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY03876.1| 6-phosphogluconate dehydrogenase family protein isoform 3, partial 
[Theobroma cacao]
Length=476

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LP+ G ++P  F
Sbjct  25   TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPVFGFHDPESF  84

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS++ME GD II
Sbjct  85   VQSIQKPRVIIMLVKAGAPVDQTIKTLSKYMEKGDCII  122



>ref|XP_006408422.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
 ref|XP_006408423.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
 gb|ESQ49875.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
 gb|ESQ49876.1| hypothetical protein EUTSA_v10020604mg [Eutrema salsugineum]
Length=488

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P+ F
Sbjct  6    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPKSF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD I+
Sbjct  66   VNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIV  103



>ref|XP_007032949.1| 6-phosphogluconate dehydrogenase family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY03875.1| 6-phosphogluconate dehydrogenase family protein isoform 2, partial 
[Theobroma cacao]
Length=486

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LP+ G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPVFGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS++ME GD II
Sbjct  65   VQSIQKPRVIIMLVKAGAPVDQTIKTLSKYMEKGDCII  102



>ref|XP_010029445.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Eucalyptus grandis]
 gb|KCW56359.1| hypothetical protein EUGRSUZ_I02092 [Eucalyptus grandis]
Length=487

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  185  VAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVG  364
            +AA    +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LP+ G
Sbjct  1    MAAPSQPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEGNLPVYG  60

Query  365  QYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             ++P  FV S+Q+PR +I+LVKAGAPVDQTI  LS HME GD II
Sbjct  61   FHDPESFVNSVQKPRVIIMLVKAGAPVDQTIKTLSAHMEKGDCII  105



>ref|XP_006437811.1| hypothetical protein CICLE_v10031373mg [Citrus clementina]
 gb|ESR51051.1| hypothetical protein CICLE_v10031373mg [Citrus clementina]
Length=484

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLCGFHDPESF  63

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAG+PVDQTI  LS +ME GD II
Sbjct  64   VHSIQKPRVIIMLVKAGSPVDQTIKTLSVYMEKGDCII  101



>ref|XP_003555038.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoformX1 [Glycine max]
Length=533

 Score =   159 bits (403),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +2

Query  179  MEVAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPL  358
            + +A   +L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVDETVERA++EG LP+
Sbjct  44   LTMAQPASLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVERAKQEGNLPV  103

Query  359  VGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             G ++P+ FV SIQ+PR +I+LVKAGAPVDQTI  LS H+E GD II
Sbjct  104  YGYHDPKFFVQSIQKPRVIIMLVKAGAPVDQTIKTLSAHLEKGDCII  150



>ref|XP_004304174.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Fragaria vesca subsp. vesca]
Length=488

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPESF  67

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR VI+LVKAGAPVDQTI  LS ++E GD II
Sbjct  68   VKSIQKPRVVIMLVKAGAPVDQTIKTLSVYLEKGDCII  105



>gb|EMS64512.1| 6-phosphogluconate dehydrogenase, decarboxylating [Triticum urartu]
Length=737

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LPL G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKLEGNLPLYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD I+
Sbjct  62   SFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIV  101


 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LPL G ++P 
Sbjct  444  ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKLEGNLPLYGFHDPA  503

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD I+
Sbjct  504  SFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIV  543



>ref|XP_002882225.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH58484.1| 6-phosphogluconate dehydrogenase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=486

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  6    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPESF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD I+
Sbjct  66   VKSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIV  103



>ref|XP_010485479.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Camelina sativa]
 ref|XP_010485480.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Camelina sativa]
Length=486

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  6    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPESF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD I+
Sbjct  66   VKSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIV  103



>ref|XP_010477172.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Camelina sativa]
 ref|XP_010478251.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 isoform X1 [Camelina sativa]
 ref|XP_010478914.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 isoform X2 [Camelina sativa]
Length=486

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  6    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPESF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD I+
Sbjct  66   VKSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIV  103



>ref|XP_006297535.1| hypothetical protein CARUB_v10013557mg [Capsella rubella]
 gb|EOA30433.1| hypothetical protein CARUB_v10013557mg [Capsella rubella]
Length=486

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  6    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPESF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD I+
Sbjct  66   VKSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIV  103



>gb|KDO70202.1| hypothetical protein CISIN_1g0115012mg [Citrus sinensis]
Length=484

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPESF  63

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAG+PVDQTI  LS +ME GD II
Sbjct  64   VHSIQKPRVIIMLVKAGSPVDQTIKTLSVYMEKGDCII  101



>ref|XP_006484295.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Citrus sinensis]
Length=484

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  4    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPESF  63

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAG+PVDQTI  LS +ME GD II
Sbjct  64   VHSIQKPRVIIMLVKAGSPVDQTIKTLSVYMEKGDCII  101



>ref|XP_006363551.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X1 [Solanum tuberosum]
 ref|XP_006363552.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like isoform X2 [Solanum tuberosum]
Length=485

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNR+TSKVDETVERA++EG LPL G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGNLPLYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            VLSIQ+PR +IILVKAG PVDQTI  LS  M+ GD II
Sbjct  65   VLSIQKPRVIIILVKAGLPVDQTIKTLSAFMDKGDCII  102



>ref|XP_008379478.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Malus domestica]
 ref|XP_008379479.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Malus domestica]
Length=488

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            SRIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  8    SRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPESF  67

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR VI+LVKAG PVDQTI  LS ++E GD II
Sbjct  68   VKSIQKPRVVIMLVKAGVPVDQTIKTLSVYLEKGDCII  105



>gb|KCW56358.1| hypothetical protein EUGRSUZ_I02092 [Eucalyptus grandis]
Length=496

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  185  VAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVG  364
            +AA    +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LP+ G
Sbjct  1    MAAPSQPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEGNLPVYG  60

Query  365  QYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             ++P  FV S+Q+PR +I+LVKAGAPVDQTI  LS HME GD II
Sbjct  61   FHDPESFVNSVQKPRVIIMLVKAGAPVDQTIKTLSAHMEKGDCII  105



>ref|XP_006655710.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X1 [Oryza brachyantha]
 ref|XP_006655711.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1-like isoform X2 [Oryza brachyantha]
Length=481

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            A++RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    AVTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKAEGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD II
Sbjct  62   SFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCII  101



>ref|XP_007139369.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
 ref|XP_007139370.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
 gb|ESW11363.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
 gb|ESW11364.1| hypothetical protein PHAVU_008G023700g [Phaseolus vulgaris]
Length=483

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LP+ G ++P+ F
Sbjct  6    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPVYGYHDPKAF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            VLSI++PR VI+LVKAGAPVDQTI  LS  ME GD II
Sbjct  66   VLSIRKPRVVIMLVKAGAPVDQTIKTLSAFMEKGDCII  103



>ref|XP_002270984.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Vitis vinifera]
 ref|XP_010654343.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Vitis vinifera]
Length=485

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            +SRIGL+GLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  
Sbjct  4    VSRIGLSGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPES  63

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD II
Sbjct  64   FVNSIQKPRVIIMLVKAGAPVDQTIKTLSGYLEKGDCII  102



>gb|KJB22742.1| hypothetical protein B456_004G063900 [Gossypium raimondii]
 gb|KJB22743.1| hypothetical protein B456_004G063900 [Gossypium raimondii]
Length=485

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LP+ G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGDLPVYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR VI+LVKAGAPVDQTI  LS ++E GD II
Sbjct  65   VQSIQKPRVVIMLVKAGAPVDQTIKTLSAYLEKGDCII  102



>ref|XP_011085569.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
Length=489

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LP+ G ++P  
Sbjct  8    LTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKVEGNLPVFGFHDPES  67

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQ+PR +++LVKAGAPVDQTI  LS +ME GD II
Sbjct  68   FVQSIQKPRVIVMLVKAGAPVDQTIKTLSAYMEKGDCII  106



>gb|ADP03318.1| 6-phosphogluconate dehydrogenase [Pinus pinaster]
Length=483

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNR++ KVDETVERA+ EG LP+ G +
Sbjct  2    ASSGLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFH  61

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P+DFV SIQ+PR +I+LVKAG PVD+TI  LS HME GD I+
Sbjct  62   DPKDFVNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIV  104



>gb|ADP03059.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03067.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03068.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03076.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03079.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03082.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03088.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNR++ KVDETVERA+ EG LP+ G +
Sbjct  2    ASSGLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFH  61

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P+DFV SIQ+PR +I+LVKAG PVD+TI  LS HME GD I+
Sbjct  62   DPKDFVNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIV  104



>gb|ADP03083.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNR++ KVDETVERA+ EG LP+ G +
Sbjct  2    ASSGLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFH  61

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P+DFV SIQ+PR +I+LVKAG PVD+TI  LS HME GD I+
Sbjct  62   DPKDFVNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIV  104



>ref|NP_001056586.1| Os06g0111500 [Oryza sativa Japonica Group]
 sp|Q9LI00.1|6PGD1_ORYSJ RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
1; Short=OsG6PGH1 [Oryza sativa Japonica Group]
 gb|AAL92029.1|AF486280_1 cytosolic 6-phosphogluconate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAA93024.1| putative phosphogluconate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAF18500.1| Os06g0111500 [Oryza sativa Japonica Group]
 gb|EAZ35578.1| hypothetical protein OsJ_19864 [Oryza sativa Japonica Group]
 dbj|BAG89736.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AJB98434.1| 6-phosphogluconate dehydrogenase, partial [Oryza sativa]
Length=480

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            A++RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    AVTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD II
Sbjct  62   SFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCII  101



>gb|ADP03057.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03066.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03080.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNR++ KVDETVERA+ EG LP+ G +
Sbjct  2    ASSGLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVRGFH  61

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P+DFV SIQ+PR +I+LVKAG PVD+TI  LS HME GD I+
Sbjct  62   DPKDFVNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIV  104



>gb|EYU44260.1| hypothetical protein MIMGU_mgv1a005435mg [Erythranthe guttata]
 gb|EYU44261.1| hypothetical protein MIMGU_mgv1a005435mg [Erythranthe guttata]
Length=483

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LPL G ++P  
Sbjct  8    LNRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPLFGFHDPES  67

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQ+PR +I+LVKAG+PVDQTI  LS ++E GD II
Sbjct  68   FVQSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCII  106



>tpg|DAA55929.1| TPA: 6-phosphogluconate dehydrogenase2 [Zea mays]
Length=480

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVFGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H++ GD I+
Sbjct  62   SFVSSIQKPRVVIMLVKAGAPVDQTIATLAAHLDQGDCIV  101



>ref|XP_008230333.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Prunus mume]
 ref|XP_008230334.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Prunus mume]
Length=488

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LPL G ++P  F
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKNEGNLPLYGFHDPESF  67

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD+II
Sbjct  68   VKSIQKPRVIIMLVKAGAPVDQTIKTLSVYLEKGDSII  105



>gb|ACN35899.1| unknown [Zea mays]
Length=480

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVFGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H++ GD I+
Sbjct  62   SFVSSIQKPRVVIMLVKAGAPVDQTIATLAAHLDQGDCIV  101



>ref|XP_011099073.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
 ref|XP_011099074.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
 ref|XP_011099075.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
 ref|XP_011099076.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Sesamum indicum]
Length=487

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDET ERA+ EG LP+ G ++P  
Sbjct  8    LTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETTERAKAEGNLPVFGFHDPES  67

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  68   FVQSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCII  106



>ref|NP_186885.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
 ref|NP_850502.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
 sp|Q9FWA3.1|6GPD3_ARATH RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
3 [Arabidopsis thaliana]
 gb|AAG12595.1|AC068900_1 6-phosphogluconate dehydrogenase, putative; 13029-14489 [Arabidopsis 
thaliana]
 gb|AAL11585.1|AF424591_1 AT3g02360/F11A12_104 [Arabidopsis thaliana]
 gb|AAM64891.1| 6-phosphogluconate dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAN73296.1| At3g02360/F11A12_104 [Arabidopsis thaliana]
 dbj|BAE99202.1| putative 6-phosphogluconate dehydrogenase [Arabidopsis thaliana]
 gb|AEE73796.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
 gb|AEE73797.1| 6-phosphogluconate dehydrogenase, decarboxylating 3 [Arabidopsis 
thaliana]
Length=486

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  6    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPESF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAG+PVDQTI  LS ++E GD I+
Sbjct  66   VKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCIV  103



>ref|XP_007045684.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007045685.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01516.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01517.1| 6-phosphogluconate dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=485

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
             L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P 
Sbjct  3    GLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPE  62

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR +I+LVKAG PVDQTI  LS ++E GD II
Sbjct  63   SFVHSIQKPRVIIMLVKAGPPVDQTIKTLSVYLEKGDCII  102



>gb|ADP03065.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNR++ KVDETVERA+ EG LP+ G +
Sbjct  2    ASSDLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFH  61

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P+DFV SIQ+PR +I+LVKAG PVD+TI  LS HME GD I+
Sbjct  62   DPKDFVNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIV  104



>gb|ADP03055.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03056.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03060.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03061.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03062.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03063.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03064.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03069.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03071.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03072.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03073.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03075.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03077.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03078.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03081.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03085.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03087.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03089.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNR++ KVDETVERA+ EG LP+ G +
Sbjct  2    ASSDLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFH  61

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P+DFV SIQ+PR +I+LVKAG PVD+TI  LS HME GD I+
Sbjct  62   DPKDFVNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIV  104



>gb|ADP03058.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03074.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03084.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
 gb|ADP03086.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNR++ KVDETVERA+ EG LP+ G +
Sbjct  2    ASSDLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFH  61

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P+DFV SIQ+PR +I+LVKAG PVD+TI  LS HME GD I+
Sbjct  62   DPKDFVNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIV  104



>ref|NP_001104910.1| NADPH producing dehydrogenase of the oxidative pentose phosphate 
pathway [Zea mays]
 gb|AAC27702.1| putative cytosolic 6-phosphogluconate dehydrogenase [Zea mays]
Length=484

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVFGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H++ GD I+
Sbjct  62   SFVSSIQKPRVVIMLVKAGAPVDQTIATLAAHLDQGDCIV  101



>gb|ADP03070.1| 6-phosphogluconate dehydrogenase [Pinus sylvestris]
Length=483

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNR++ KVDETVERA+ EG LP+ G +
Sbjct  2    ASSDLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSSEKVDETVERAKVEGNLPVKGFH  61

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P+DFV SIQ+PR +I+LVKAG PVD+TI  LS HME GD I+
Sbjct  62   DPKDFVNSIQKPRVIILLVKAGLPVDKTIETLSAHMEEGDCIV  104



>ref|XP_004141482.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
 ref|XP_004171525.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like 
[Cucumis sativus]
 gb|KGN52541.1| hypothetical protein Csa_5G642720 [Cucumis sativus]
Length=487

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  185  VAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVG  364
            +AA    +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LPL G
Sbjct  1    MAAPGKPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKAEGNLPLYG  60

Query  365  QYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             ++P  FV SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD II
Sbjct  61   FHDPESFVQSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCII  105



>ref|XP_007217218.1| hypothetical protein PRUPE_ppa004860mg [Prunus persica]
 gb|EMJ18417.1| hypothetical protein PRUPE_ppa004860mg [Prunus persica]
Length=488

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LPL G ++P  F
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKNEGNLPLYGFHDPESF  67

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD+II
Sbjct  68   VNSIQKPRVIIMLVKAGAPVDQTIKTLSVYLEKGDSII  105



>ref|XP_002305978.2| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE86489.2| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=488

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  185  VAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVG  364
            +AA    +RIGLAGLAVMGQNLALN+AEKGFPISVYNR+TSKVDETVERA++EG LPL G
Sbjct  1    MAAPTKPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGDLPLYG  60

Query  365  QYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             ++P  FV SIQ+PR +I+LVKAG+PVDQTI  LS ++E GD II
Sbjct  61   FHDPESFVKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCII  105



>ref|XP_010558538.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558539.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558540.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558541.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 ref|XP_010558542.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Tarenaya hassleriana]
 gb|ABD96905.1| hypothetical protein [Cleome spinosa]
Length=483

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA++EG LP+ G ++P  F
Sbjct  3    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKKEGNLPVYGFHDPESF  62

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  63   VNSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEEGDCII  100



>gb|AHL19963.1| 6-phosphogluconate dehydrogenase [Hibiscus cannabinus]
Length=485

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LP+ G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPVYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            + SIQ+PR VI+LVKAGAPVDQTI  LS +M+ GD II
Sbjct  65   IQSIQKPRVVIMLVKAGAPVDQTIKTLSAYMDKGDCII  102



>ref|XP_010463641.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Camelina sativa]
Length=538

 Score =   157 bits (398),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 77/106 (73%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  EVAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLV  361
            E+ A Q  +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL 
Sbjct  51   EIMAVQP-TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLY  109

Query  362  GQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            G ++P  FV SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD I+
Sbjct  110  GFHDPESFVKSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIV  155



>ref|XP_004491970.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphogluconate dehydrogenase, 
decarboxylating 3-like [Cicer arietinum]
Length=493

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L+RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDETVERA++EG LPL G ++P+ 
Sbjct  7    LTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPKA  66

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQ+PR +I+LVKAGAPVDQTI  LS  +E GD II
Sbjct  67   FVESIQKPRVIIMLVKAGAPVDQTIKTLSVFLEKGDCII  105



>gb|KJB10517.1| hypothetical protein B456_001G205600 [Gossypium raimondii]
Length=504

 Score =   157 bits (396),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  24   TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGDLPLFGFHDPESF  83

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  84   VQSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCII  121



>gb|EMT33408.1| 6-phosphogluconate dehydrogenase, decarboxylating [Aegilops tauschii]
Length=996

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            AL+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LPL G ++P 
Sbjct  2    ALTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKLEGNLPLYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             FV SIQ+PR VI+LVKAGAPVDQTIA L+ H+E GD I+
Sbjct  62   SFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIV  101



>sp|Q94KU1.1|6PGD1_SPIOL RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
1 [Spinacia oleracea]
 gb|AAK51690.1|AF307144_1 cytosolic 6-phosphogluconate dehydrogenase [Spinacia oleracea]
Length=483

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVD TI  LS ++E GD II
Sbjct  65   VNSIQKPRVIIMLVKAGAPVDATIKTLSAYLEKGDCII  102



>emb|CDY43238.1| BnaC05g48310D [Brassica napus]
Length=403

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+A KGFPISVYNRTTSKVDETVERA++EG LP+ G ++P  F
Sbjct  6    TRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFHDPESF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD I+
Sbjct  66   VNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIV  103



>emb|CDP00510.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGL GLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LP+ G ++P  F
Sbjct  5    TRIGLCGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPVFGFHDPEAF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +IILVKAG+PVDQTI  LS +ME GD II
Sbjct  65   VQSIQKPRVIIILVKAGSPVDQTIKTLSAYMEKGDCII  102



>emb|CDY34724.1| BnaA01g33010D [Brassica napus]
Length=404

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+A KGFPISVYNRTTSKVDETVERA++EG LP+ G ++P  F
Sbjct  6    TRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFHDPESF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD I+
Sbjct  66   VNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIV  103



>ref|XP_006373519.1| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
 gb|ERP51316.1| phosphogluconate dehydrogenase family protein [Populus trichocarpa]
Length=488

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV RA++EG LPL G ++P  F
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVVRAKKEGDLPLYGFHDPESF  67

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR VI+LVKAG+PVDQTI  LS ++E GD II
Sbjct  68   VKSIQKPRVVIMLVKAGSPVDQTIKTLSAYLEKGDCII  105



>ref|NP_001236726.1| 6-phosphogluconate dehydrogenase [Glycine max]
 dbj|BAA22812.1| 6-phosphogluconate dehydrogenase [Glycine max]
Length=511

 Score =   155 bits (393),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 76/102 (75%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +2

Query  194  AQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYN  373
            AQ  + IGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LP+ G ++
Sbjct  2    AQPSTGIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPVYGYHD  61

Query  374  PRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            P  FV SIQ+PR +I+LVKAGAPVDQTI  LS +ME GD II
Sbjct  62   PEAFVHSIQKPRVIIMLVKAGAPVDQTIKTLSAYMEKGDCII  103



>ref|XP_010091678.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
 gb|EXB44944.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
Length=485

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  209  RIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFV  388
            RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  FV
Sbjct  6    RIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPESFV  65

Query  389  LSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             SIQ+PR +I+LVKAG PVDQTI  LS ++E GD II
Sbjct  66   QSIQKPRVIIMLVKAGPPVDQTIKTLSVYLEKGDCII  102



>gb|EPS70190.1| hypothetical protein M569_04567, partial [Genlisea aurea]
Length=504

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            + + L+RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA+ EG LPL G +
Sbjct  20   STKPLTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKLEGNLPLFGFH  79

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P  FV SIQ+PR +I+LVKAGAPVD TI  L+ ++E GD II
Sbjct  80   DPESFVNSIQKPRVIIMLVKAGAPVDATIKTLTAYLEKGDCII  122



>ref|XP_009147357.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Brassica rapa]
 ref|XP_009147358.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Brassica rapa]
Length=488

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+A KGFPISVYNRTTSKVDETVERA++EG LP+ G ++P  F
Sbjct  6    TRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFHDPESF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVDQTI  LS ++E GD I+
Sbjct  66   VNSIQKPRVIIMLVKAGAPVDQTIKTLSAYLEKGDCIV  103



>ref|XP_011021140.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Populus euphratica]
 ref|XP_011021141.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3 [Populus euphratica]
Length=488

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV RA++EG LPL G ++P  F
Sbjct  8    TRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVVRAKKEGDLPLYGFHDPESF  67

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAG+PVDQTI  LS ++E GD II
Sbjct  68   VKSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCII  105



>emb|CBI27441.3| unnamed protein product [Vitis vinifera]
Length=133

 Score =   146 bits (368),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            +SRIGL+GLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  
Sbjct  19   VSRIGLSGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPES  78

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQ+PR +I+LVKAGAPVDQTI  L   +    +I+
Sbjct  79   FVNSIQKPRVIIMLVKAGAPVDQTIKTLKPWLNWVCSIL  117



>emb|CDY57527.1| BnaA05g33580D [Brassica napus]
Length=404

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+A KGFPISVYNRTTSKVDETVERA++EG LP+ G ++P  F
Sbjct  6    TRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFHDPESF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAG+PVDQTI  LS ++E GD I+
Sbjct  66   VNSIQKPRVIIMLVKAGSPVDQTIKTLSAYLEKGDCIV  103



>ref|XP_001785214.1| predicted protein [Physcomitrella patens]
 gb|EDQ49993.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+  LSRIGLAGLAVMGQNLALN+A+KGFPISVYNR+ +KVDETVERA+ EG LP+ G  
Sbjct  2    ASDGLSRIGLAGLAVMGQNLALNIAQKGFPISVYNRSANKVDETVERAKEEGNLPVKGFK  61

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P +FV SIQ+PR VIILVKAG+PVDQTI  LS+++E GD II
Sbjct  62   DPAEFVNSIQKPRCVIILVKAGSPVDQTIELLSKYLEEGDCII  104



>ref|XP_010100892.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
 gb|EXB85816.1| 6-phosphogluconate dehydrogenase [Morus notabilis]
Length=488

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L+RIGL+GLAVMGQNLALN+AEKGFPISVYNRT SKVDETVERA++EG LPL G ++P  
Sbjct  7    LTRIGLSGLAVMGQNLALNIAEKGFPISVYNRTPSKVDETVERAKQEGNLPLFGFHDPES  66

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQ+PR +I+LVKAGAPVD+TI  LS ++E GD I+
Sbjct  67   FVNSIQKPRVIIMLVKAGAPVDETIKTLSAYLEKGDCIV  105



>ref|XP_002305977.2| hypothetical protein POPTR_0004s10870g [Populus trichocarpa]
 gb|EEE86488.2| hypothetical protein POPTR_0004s10870g [Populus trichocarpa]
Length=472

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  185  VAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVG  364
            +AA    +RIGLAGLAVMGQNLALN+AEKGFP+SVYNR+TSKVDETVERA++EG LPL G
Sbjct  1    MAAPPKPTRIGLAGLAVMGQNLALNIAEKGFPVSVYNRSTSKVDETVERAKKEGDLPLYG  60

Query  365  QYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             ++P  FV SIQ+PR +I+LV AG+PVDQTI  LS ++E GD II
Sbjct  61   FHDPESFVKSIQKPRVIIMLVMAGSPVDQTIKTLSAYLEKGDCII  105



>ref|XP_002966753.1| hypothetical protein SELMODRAFT_168478 [Selaginella moellendorffii]
 ref|XP_002977996.1| hypothetical protein SELMODRAFT_268134 [Selaginella moellendorffii]
 gb|EFJ20653.1| hypothetical protein SELMODRAFT_268134 [Selaginella moellendorffii]
 gb|EFJ32780.1| hypothetical protein SELMODRAFT_168478 [Selaginella moellendorffii]
Length=487

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  197  QALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNP  376
            Q  SR+GLAGLAVMGQNLALNVAEKGFPISVYNRT SKVD+TV+RA REG LPL G  +P
Sbjct  7    QGGSRLGLAGLAVMGQNLALNVAEKGFPISVYNRTASKVDDTVDRAAREGNLPLYGFKDP  66

Query  377  RDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             +FV S+Q+PR +IILVKAG PVD+TI  LS  +EPGD II
Sbjct  67   GEFVASLQKPRVIIILVKAGRPVDETIELLSSFLEPGDCII  107



>ref|XP_010681308.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
1 [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDETVERA++EG LP+ G ++P  F
Sbjct  5    TRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKQEGNLPVYGFHDPESF  64

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR +I+LVKAGAPVD TI  LS ++E GD II
Sbjct  65   VNSIQKPRVIIMLVKAGAPVDATIKTLSVYLEKGDCII  102



>gb|AAB41553.1| 6-phosphogluconate dehydrogenase [Medicago sativa]
Length=486

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L+RIGLAGLAVMGQNLALN+A+KGFPISVYNRTTSKVDETVERA++EG LPL G ++P  
Sbjct  5    LTRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPEA  64

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SI++PR +I+LVKAGAPV+QT   LS ++E GD II
Sbjct  65   FVNSIEKPRVIIMLVKAGAPVEQTTKTLSAYLEKGDCII  103



>ref|XP_001759464.1| predicted protein [Physcomitrella patens]
 gb|EDQ75766.1| predicted protein [Physcomitrella patens]
Length=504

 Score =   152 bits (384),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            A+  LSRIGLAGLAVMGQNLALN+AEKGFPISVYNR+ SKVDETVERA+ EG LP+ G  
Sbjct  2    ASDGLSRIGLAGLAVMGQNLALNIAEKGFPISVYNRSASKVDETVERAKEEGNLPVKGFK  61

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P +FV SIQ+PR +IILVKAG+PVDQTI  LS+++E GD II
Sbjct  62   DPCEFVKSIQKPRCIIILVKAGSPVDQTIELLSKYLEKGDCII  104



>gb|EEC79859.1| hypothetical protein OsI_21344 [Oryza sativa Indica Group]
Length=97

 Score =   141 bits (355),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            A++RIGLAGLAVMGQNLALN+AEKGFPISVYNRTTSKVDETV+RA+ EG LP+ G ++P 
Sbjct  2    AVTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVYGFHDPA  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIA  460
             FV SIQ+PR VI+LVKAGAPVDQTI 
Sbjct  62   SFVNSIQKPRVVIMLVKAGAPVDQTIG  88



>gb|KDP31431.1| hypothetical protein JCGZ_11807 [Jatropha curcas]
Length=485

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L RIGLAGLAVMGQNLALN+AEKGFPISVYNRT SKVDETV RA++EG LPL G  +P  
Sbjct  4    LIRIGLAGLAVMGQNLALNIAEKGFPISVYNRTASKVDETVARAKQEGDLPLYGFRDPES  63

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SIQ+PR +I+LVKAG PVDQTI  LS +ME GD II
Sbjct  64   FVNSIQKPRVIIMLVKAGPPVDQTIKTLSVYMEKGDCII  102



>ref|XP_009117953.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Brassica rapa]
 ref|XP_009117961.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Brassica rapa]
 ref|XP_009117968.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Brassica rapa]
Length=486

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDF  385
            +RIGLAGLAVMGQNLALN+A KG PISV NRTTSKVD+TVERA++EG LP+ G + P  F
Sbjct  6    TRIGLAGLAVMGQNLALNIASKGCPISVSNRTTSKVDKTVERAKKEGNLPVCGFHAPESF  65

Query  386  VLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            V SIQ+PR VI+LVKAGAPVDQTI  LS ++E GD I+
Sbjct  66   VNSIQKPRVVIMLVKAGAPVDQTIKTLSAYLEKGDCIV  103



>gb|AFW60760.1| putative 6-phosphogluconate dehydrogenase [Zea mays]
Length=507

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +2

Query  209  RIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFV  388
            RIGLAGLA MGQNLALN+AEKGFPISVYNRT +KVD T+ RA+ EG LP++G  +PR FV
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLSRARDEGSLPVLGHRDPRGFV  79

Query  389  LSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            LS+ RPR+V++LV+AG  VD TI ALS ++EPGD I+
Sbjct  80   LSLARPRAVVLLVQAGPAVDATIQALSPYLEPGDAIV  116



>ref|NP_001241786.1| 6-phosphogluconate dehydrogenase, decarboxylating [Zea mays]
 gb|ACG41643.1| 6-phosphogluconate dehydrogenase, decarboxylating [Zea mays]
Length=507

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +2

Query  209  RIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFV  388
            RIGLAGLA MGQNLALN+AEKGFPISVYNRT +KVD T+ RA+ EG LP++G  +PR FV
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLSRARDEGSLPVLGHRDPRGFV  79

Query  389  LSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            LS+ RPR+V++LV+AG  VD TI ALS ++EPGD I+
Sbjct  80   LSLARPRAVVLLVQAGPAVDATIQALSPYLEPGDAIV  116



>ref|XP_002449496.1| hypothetical protein SORBIDRAFT_05g016740 [Sorghum bicolor]
 gb|EES08484.1| hypothetical protein SORBIDRAFT_05g016740 [Sorghum bicolor]
Length=504

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +2

Query  209  RIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFV  388
            RIGLAGLA MGQNLALN+AEKGFPISVYNRT +KVD T+ RA+ EG LP++G  +PR FV
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLSRARDEGALPVLGHRDPRGFV  79

Query  389  LSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            LS+ RPR+V++LV+AG  VD TI AL+ ++EPGD I+
Sbjct  80   LSLARPRTVVLLVQAGPAVDATIQALTPYLEPGDAIV  116



>ref|XP_011011766.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Populus euphratica]
 ref|XP_011011767.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
3-like [Populus euphratica]
Length=471

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  236  MGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFVLSIQRPRSV  415
            MGQNLALN+AEKGFPISVYNR+TSKVDETVERA++EG LPL G ++P  FV SIQ+PR +
Sbjct  1    MGQNLALNIAEKGFPISVYNRSTSKVDETVERAKKEGDLPLYGFHDPESFVKSIQKPRVI  60

Query  416  IILVKAGAPVDQTIAALSEHMEPGDTII  499
            I+LVKAG+PVDQTI  LS ++E GD II
Sbjct  61   IMLVKAGSPVDQTIKTLSAYLEKGDCII  88



>dbj|BAG32445.1| 6-phosphogluconate dehydrogenase, partial [Gloeochaete wittrockiana]
Length=440

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +2

Query  224  GLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFVLSIQR  403
            GLAVMGQNLALN+AE+G PISV+NR+ +KVD+TV RA+REGQLPL G  + +DFV SI+R
Sbjct  1    GLAVMGQNLALNIAEEGIPISVFNRSANKVDDTVLRAEREGQLPLYGYKDVKDFVASIER  60

Query  404  PRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            PR++IILVKAGAPVD TIAALS+++E GD II
Sbjct  61   PRAIIILVKAGAPVDDTIAALSQYLEEGDLII  92



>ref|XP_003060927.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54577.1| predicted protein [Micromonas pusilla CCMP1545]
Length=500

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG-QLPLVGQ  367
            A +  SR+GL GLAVMGQNLALNVAEKGF ISV+NR+  K D  V RAQ+EG    LVG 
Sbjct  2    ADEEKSRVGLVGLAVMGQNLALNVAEKGFKISVFNRSGDKTDNAVARAQKEGLGDKLVGY  61

Query  368  YNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             + ++FV S+Q+PRSVIILVKAGAPVD TI  LSEHMEPGD II
Sbjct  62   KDMKEFVNSLQKPRSVIILVKAGAPVDATIKGLSEHMEPGDIII  105



>dbj|BAK00156.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +2

Query  209  RIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFV  388
            RIGLAGLA MGQNLALN+AEKGFPISVYNRT +KVD T+ RA  EG LP++G  +PRDFV
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLSRAAAEGALPVLGHRDPRDFV  79

Query  389  LSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            LS+ RPR+V++LV+AG  VD TI ALS +++ GD I+
Sbjct  80   LSLARPRTVVLLVQAGPAVDATIDALSPYLDAGDAIV  116



>ref|XP_003557402.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic [Brachypodium distachyon]
Length=501

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +2

Query  209  RIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFV  388
            RIGLAGLA MGQNLALN+AEKGFPISVYNRT +KVD T+ RA  EG LP++G  +PRDFV
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLSRAAAEGALPVLGHRDPRDFV  79

Query  389  LSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            LS+ RPR+V++LV+AG  VD TI ALS +++ GD I+
Sbjct  80   LSLARPRTVVLLVQAGPAVDATIDALSPYLDAGDAIV  116



>ref|XP_004979278.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Setaria italica]
Length=504

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +2

Query  209  RIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFV  388
            RIGLAGLA MGQNLALN+AEKGFPISVYNRT +KVD T+ RA+ EG LP++G  +PR FV
Sbjct  20   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDSTLVRARDEGALPVLGHRDPRGFV  79

Query  389  LSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            LS+ RPR+V++LV+AG  VD TI AL+ ++EPGD I+
Sbjct  80   LSLARPRTVVLLVQAGPAVDATIDALTPYLEPGDAIV  116



>ref|XP_002953515.1| hypothetical protein VOLCADRAFT_109207 [Volvox carteri f. nagariensis]
 gb|EFJ45488.1| hypothetical protein VOLCADRAFT_109207 [Volvox carteri f. nagariensis]
Length=566

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +2

Query  176  AMEVAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG-QL  352
            A + ++  A+S IGL GLAVMGQN+ALNVAEKGFPISVYNR+  K +  V+RAQ+EG   
Sbjct  70   ASDKSSPMAVSEIGLVGLAVMGQNMALNVAEKGFPISVYNRSYDKTEAAVKRAQKEGLGD  129

Query  353  PLVGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             L G  + +DFV S+Q+PR VIILVKAGAPVDQTI AL E+MEPGD II
Sbjct  130  KLRGYESVKDFVASLQKPRRVIILVKAGAPVDQTIDALCEYMEPGDIII  178



>ref|NP_001067912.1| Os11g0484500 [Oryza sativa Japonica Group]
 sp|Q2R480.1|6PGD2_ORYSJ RecName: Full=6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic; Short=OsG6PGH2; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|ABA93694.1| 6-phosphogluconate dehydrogenase, decarboxylating, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF28275.1| Os11g0484500 [Oryza sativa Japonica Group]
Length=508

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  209  RIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFV  388
            RIGLAGLA MGQNLALN+AEKGFPISVYNRT +KVD TV RA+ EG LP++G  +PR FV
Sbjct  23   RIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDATVSRAEAEGALPVLGHRDPRGFV  82

Query  389  LSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            LS+ RPR+V++LV+AG  VD TI AL  +++ GD I+
Sbjct  83   LSLSRPRTVVLLVQAGRAVDATIDALVPYLDAGDAIV  119



>ref|XP_010941448.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating 
2, chloroplastic-like [Elaeis guineensis]
Length=177

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALS IGLAGLAVMG NLALN+ EKGFPISVYNRT SKV++        G+LPL    + R
Sbjct  5    ALSLIGLAGLAVMGPNLALNIVEKGFPISVYNRTASKVEDR-RSCDGGGRLPLPSHRSLR  63

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DF+LSI RP S+IILVKAGAPVDQTIA LS+ M+ GD+II
Sbjct  64   DFILSIARPHSIIILVKAGAPVDQTIATLSQFMDLGDSII  103



>dbj|BAG32444.1| 6-phosphogluconate dehydrogenase [Cyanophora paradoxa]
Length=439

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  230  AVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFVLSIQRPR  409
            AVMGQNLALN+AE+G PISV+NR+  KVD+TV RA REG LPL G  N ++FV SI++PR
Sbjct  1    AVMGQNLALNIAEEGLPISVFNRSPDKVDDTVARAAREGNLPLTGFKNVKEFVDSIEKPR  60

Query  410  SVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            S+IILVKAGAPVD TI+ALSEH+E GD II
Sbjct  61   SIIILVKAGAPVDATISALSEHLEEGDLII  90



>emb|CAN67602.1| hypothetical protein VITISV_032572 [Vitis vinifera]
Length=438

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            +SRIGL+GLAVMGQNLALN+AEKGFPISVYNRTTSKVDETVERA++EG LPL G ++P  
Sbjct  4    VSRIGLSGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKQEGNLPLYGFHDPES  63

Query  383  FVLSIQRPRSVIILVKAGAPV  445
            FV SIQ+PR +I+LVKAGAP 
Sbjct  64   FVNSIQKPRVIIMLVKAGAPF  84



>ref|XP_008610309.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Saprolegnia 
diclina VS20]
 gb|EQC36203.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Saprolegnia 
diclina VS20]
Length=491

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALS +GL GLAVMGQN ALN+A  GF +SV NR+  KVD TV+RA+ EG LPLVG  + +
Sbjct  2    ALSDVGLYGLAVMGQNFALNMASHGFSVSVCNRSPDKVDTTVQRAKDEGNLPLVGHKDVK  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSI RPR +I+LV AG PVD TIAA+S+H E GD I+
Sbjct  62   DFVLSIARPRKIILLVMAGKPVDDTIAAISQHCEEGDIIV  101



>ref|XP_001696881.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
 gb|AAL76323.1|AF394513_1 6-phosphogluconate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP00573.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
Length=490

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG-QLPLVGQYNP  376
            A++ IGL GLAVMGQNLALN+AEKGFPISVYNR+  K +  V+RAQ+EG    L G    
Sbjct  2    AVAEIGLVGLAVMGQNLALNIAEKGFPISVYNRSYDKTEAAVKRAQKEGLGEKLHGYEQV  61

Query  377  RDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +DFV S+QRPR VIILVKAGAPVDQTI  L E MEPGD II
Sbjct  62   KDFVQSLQRPRRVIILVKAGAPVDQTIDQLCEFMEPGDIII  102



>ref|XP_004343090.1| 6-phosphogluconate dehydrogenase [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE97355.1| 6-phosphogluconate dehydrogenase [Capsaspora owczarzaki ATCC 
30864]
Length=473

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LS++GL GLAVMGQNLALNVA KGF ISV+NR+  K  +T  RA+ EG LPLVG    +D
Sbjct  3    LSKVGLVGLAVMGQNLALNVASKGFQISVFNRSYEKTQDTERRAKEEGNLPLVGFKEMKD  62

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV S+++PR VIILV+AG PVD+TIA LSEH+E GD I+
Sbjct  63   FVASLEKPRRVIILVQAGKPVDETIAKLSEHLEAGDLIV  101



>ref|XP_001696880.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
 gb|EDP00572.1| 6-phosphogluconate dehydrogenase, decarboxylating [Chlamydomonas 
reinhardtii]
Length=566

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG-QLPLVGQ  367
            A  A++ IGL GLAVMGQNLALN+AEKGFPISVYNR+  K +  V+RAQ+EG    L G 
Sbjct  75   APMAVAEIGLVGLAVMGQNLALNIAEKGFPISVYNRSYDKTEAAVKRAQKEGLGEKLHGY  134

Query  368  YNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
               +DFV S+QRPR VIILVKAGAPVDQTI  L E MEPGD II
Sbjct  135  EQVKDFVQSLQRPRRVIILVKAGAPVDQTIDQLCEFMEPGDIII  178



>ref|XP_008872677.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Aphanomyces 
invadans]
 gb|ETV98480.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Aphanomyces 
invadans]
Length=493

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LS +GL GLAVMGQN ALN+AE GF +SV NR+  KVD TV+RA+ EG LPLVG  + +D
Sbjct  5    LSDVGLYGLAVMGQNFALNMAEHGFSVSVCNRSPDKVDTTVQRAKDEGNLPLVGYKDVKD  64

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FVLS+ RPR +IILV+AG PVD TI A+S+H E GD I+
Sbjct  65   FVLSLSRPRKIIILVQAGKPVDDTIHAISQHCEEGDIIV  103



>ref|XP_009832556.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Aphanomyces 
astaci]
 gb|ETV78219.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Aphanomyces 
astaci]
Length=493

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LS +GL GLAVMGQN ALN+AE GF +SV NR+  KVD TV+RA+ EG LPLVG  + +D
Sbjct  5    LSDVGLYGLAVMGQNFALNMAEHGFSVSVCNRSPDKVDTTVQRAKDEGGLPLVGHKDVKD  64

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FVLS+ RPR +IILV+AG PVD TI A+S+H E GD I+
Sbjct  65   FVLSLSRPRKIIILVQAGKPVDDTIHAISQHCEEGDIIV  103



>gb|KDO26201.1| 6-phosphogluconate dehydrogenase [Saprolegnia parasitica CBS 
223.65]
Length=491

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +2

Query  200  ALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPR  379
            ALS +GL GLAVMGQN ALN+A  GF +SV NR+  KVD TV+RA+ EG LPLVG  + +
Sbjct  2    ALSDVGLYGLAVMGQNFALNMASHGFSVSVCNRSPDKVDTTVQRAKDEGNLPLVGHKDVK  61

Query  380  DFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            DFVLSI RPR +I+LV AG PVD TIAA+++H E GD I+
Sbjct  62   DFVLSIARPRKIILLVMAGKPVDDTIAAIAQHCEEGDIIV  101



>gb|ETL93890.1| 6-phosphogluconate dehydrogenase (decarboxylating), partial [Phytophthora 
parasitica]
Length=524

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LS IGL GLAVMGQN ALN+A  GF +SV NR+  KVD TV+RA+ EG LPLVG  + ++
Sbjct  39   LSDIGLFGLAVMGQNFALNMASHGFKVSVCNRSPDKVDATVQRAKDEGNLPLVGYKDMKE  98

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV S+ RPR V+ILV AG PVD TIAALSE MEPGD II
Sbjct  99   FVASLARPRKVVILVVAGKPVDLTIAALSEFMEPGDIII  137



>ref|XP_008905173.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica INRA-310]
 gb|ETI47388.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica P1569]
 gb|ETK87326.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica]
 gb|ETL40753.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica]
 gb|ETM47129.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica]
 gb|ETN09340.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica INRA-310]
 gb|ETO76060.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica P1976]
 gb|ETP17184.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica CJ01A1]
 gb|ETP45211.1| 6-phosphogluconate dehydrogenase (decarboxylating) [Phytophthora 
parasitica P10297]
Length=489

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LS IGL GLAVMGQN ALN+A  GF +SV NR+  KVD TV+RA+ EG LPLVG  + ++
Sbjct  4    LSDIGLFGLAVMGQNFALNMASHGFKVSVCNRSPDKVDATVQRAKDEGNLPLVGYKDMKE  63

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV S+ RPR V+ILV AG PVD TIAALSE MEPGD II
Sbjct  64   FVASLARPRKVVILVVAGKPVDLTIAALSEFMEPGDIII  102



>ref|XP_009524396.1| hypothetical protein PHYSODRAFT_557596 [Phytophthora sojae]
 gb|EGZ21679.1| hypothetical protein PHYSODRAFT_557596 [Phytophthora sojae]
Length=489

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LS IGL GLAVMGQN ALN+A  GF +SV NR+  KVD TV+RA+ EG LPLVG  + ++
Sbjct  4    LSDIGLYGLAVMGQNFALNMASHGFKVSVCNRSPDKVDATVQRAKDEGNLPLVGYKDMKE  63

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV S+ RPR V+ILV AG PVD TIAALSE MEPGD I+
Sbjct  64   FVASLARPRKVVILVVAGKPVDLTIAALSEFMEPGDIIV  102



>emb|CBJ29697.1| 6-phosphogluconate dehydrogenase [Ectocarpus siliculosus]
Length=496

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  197  QALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNP  376
            QALS IGL GLAVMGQN ALN+A  GF +SV NR+  KVD TVERA+ EG LPLVG   P
Sbjct  9    QALSDIGLYGLAVMGQNFALNMASHGFSVSVCNRSPGKVDATVERAKEEGDLPLVGYKEP  68

Query  377  RDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            ++F+ S+ +PR V++LV+AGA VD TIA LSE ME GD ++
Sbjct  69   KEFIESLAKPRKVVLLVQAGAAVDATIATLSEFMEEGDILV  109



>ref|XP_002902568.1| 6-phosphogluconate dehydrogenase [Phytophthora infestans T30-4]
 gb|AAL76320.1|AF394510_1 6-phosphogluconate dehydrogenase [Phytophthora infestans]
 gb|EEY56494.1| 6-phosphogluconate dehydrogenase [Phytophthora infestans T30-4]
Length=489

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LS IGL GLAVMGQN ALN+A  GF +SV NR+  KVD TV+RA+ EG LPLVG  + ++
Sbjct  4    LSDIGLFGLAVMGQNFALNMASHGFKVSVCNRSPDKVDATVQRAKDEGNLPLVGFKDMKE  63

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV S+ RPR V+ILV AG PVD TIAALSE MEPGD I+
Sbjct  64   FVASLARPRKVVILVVAGKPVDLTIAALSEFMEPGDIIV  102



>ref|XP_001418779.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97072.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=507

 Score =   129 bits (325),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG-QLPLVGQYNPRD  382
            SRIGL GLAVMGQNLALNVAEKGF ISVYNR++ K D  VERA++EG    L G +  +D
Sbjct  17   SRIGLCGLAVMGQNLALNVAEKGFDISVYNRSSDKTDVCVERAKKEGLGAKLRGYHEMKD  76

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV S+ +PR VIILVKAGAPVD TIA LS+ +EPGD II
Sbjct  77   FVASLAKPRCVIILVKAGAPVDATIAGLSQFLEPGDCII  115



>ref|XP_002502811.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64069.1| predicted protein [Micromonas sp. RCC299]
Length=500

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 76/99 (77%), Gaps = 1/99 (1%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG-QLPLVGQYNPRD  382
            S++GL GLAVMGQNLALNVAEKGF ISVYNR+  K D  V RAQ+EG    LVG  +  +
Sbjct  7    SQVGLCGLAVMGQNLALNVAEKGFKISVYNRSGDKTDNAVARAQKEGLGDNLVGFKDMGE  66

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV S+ +PR VIILVKAGAPVD TI  L++HMEPGD II
Sbjct  67   FVQSLAKPRCVIILVKAGAPVDATIEGLAQHMEPGDIII  105



>ref|XP_007513389.1| 6-phosphogluconate dehydrogenase [Bathycoccus prasinos]
 emb|CCO15914.1| 6-phosphogluconate dehydrogenase [Bathycoccus prasinos]
Length=518

 Score =   127 bits (318),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 65/99 (66%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG-QLPLVGQYNPRD  382
            SRIGL GLAVMGQNLALNVAEKGFPISVYNR+  K D  V RA++EG    L G  + ++
Sbjct  26   SRIGLCGLAVMGQNLALNVAEKGFPISVYNRSADKTDGCVNRAEKEGLSSKLRGYKDLKE  85

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV SI++PR +IILVKAGAPVD TI  LS+ +EPGD I+
Sbjct  86   FVESIEKPRHIIILVKAGAPVDATIEGLSQFLEPGDCIV  124



>dbj|BAG32441.1| 6-phosphogluconate dehydrogenase [Euglena gracilis]
Length=488

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +2

Query  212  IGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFVL  391
            +GL GLAVMGQN ALN+AE GF ++V NR+  KVD+TVERA+ EG LPL+G  +P+DFV 
Sbjct  5    VGLYGLAVMGQNFALNMAEHGFTVAVCNRSPGKVDDTVERAKGEGNLPLLGFKDPKDFVQ  64

Query  392  SIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +++RPR ++ILV+AG PVD TIA LS  +E GD I+
Sbjct  65   ALKRPRRIVILVQAGKPVDDTIAHLSGFLEAGDLIV  100



>emb|CEF98862.1| 6-phosphogluconate dehydrogenase,decarboxylating [Ostreococcus 
tauri]
Length=538

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG-QLPLVGQYNPRD  382
            SRIGL GLAVMGQNLALNVA KGF ISVYNR+  K +  VERA++EG    L G  +  D
Sbjct  49   SRIGLCGLAVMGQNLALNVASKGFDISVYNRSGDKTETCVERAKKEGLGEKLRGYQDVGD  108

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV S+ +PR VIILVKAGAPVD TI  LS+ +EPGD II
Sbjct  109  FVDSLAKPRCVIILVKAGAPVDATIEKLSQFLEPGDCII  147



>gb|EJK45824.1| hypothetical protein THAOC_35540, partial [Thalassiosira oceanica]
Length=346

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            L  +GL GLAVMGQN ALN+A KGF + V NR+ SKV+ TV RA+ EG LPLVG   P D
Sbjct  2    LCDVGLYGLAVMGQNFALNMASKGFKVCVGNRSPSKVELTVNRAKEEGSLPLVGSSGPED  61

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV  + +PR ++ILV AG PVD+TIA LS++++ GD I+
Sbjct  62   FVKQLSKPRKIVILVMAGKPVDETIANLSQYLDAGDVIV  100



>dbj|BAG32446.1| 6-phosphogluconate dehydrogenase, partial [Cyanoptyche gloeocystis]
Length=444

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (82%), Gaps = 2/93 (2%)
 Frame = +2

Query  227  LAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG--QLPLVGQYNPRDFVLSIQ  400
            LAVMGQN ALN AEKG PISV+NR+ ++VD+TVERA++EG  + PL G  + +DFV S++
Sbjct  1    LAVMGQNFALNFAEKGIPISVFNRSANRVDDTVERAEKEGGGKYPLHGFKDVKDFVASLE  60

Query  401  RPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            RPR++IILVKAGAPVD TI  L +++EPGD II
Sbjct  61   RPRAIIILVKAGAPVDDTIEQLLQYLEPGDIII  93



>ref|XP_002179525.1| 6-phosphogluconate dehydrogenase [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC49348.1| 6-phosphogluconate dehydrogenase [Phaeodactylum tricornutum CCAP 
1055/1]
Length=519

 Score =   123 bits (309),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 82/125 (66%), Gaps = 9/125 (7%)
 Frame = +2

Query  152  ILQYHRFVAMEVAAAQALSR---------IGLAGLAVMGQNLALNVAEKGFPISVYNRTT  304
            IL +  F    + + Q LS          IGL GLAVMGQN ALN+A  GF ++V NR+ 
Sbjct  5    ILLFAAFCTTTLESIQTLSTNEINRMSCDIGLYGLAVMGQNFALNMASHGFTVAVCNRSP  64

Query  305  SKVDETVERAQREGQLPLVGQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEP  484
            SKVD TV+RA+ EG LPL+G  +P +F+  + +PR V+ILV+AG PVD TI A+SE ME 
Sbjct  65   SKVDTTVQRAKDEGDLPLIGTKSPEEFISKLSKPRKVVILVQAGKPVDLTIEAISEFMEE  124

Query  485  GDTII  499
            GD II
Sbjct  125  GDVII  129



>ref|XP_002179526.1| 6-phosphogluconate dehydrogenase [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC49349.1| 6-phosphogluconate dehydrogenase [Phaeodactylum tricornutum CCAP 
1055/1]
Length=490

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +2

Query  212  IGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFVL  391
            IGL GLAVMGQN ALN+A  GF ++V NR+ SKVD TV+RA+ EG LPL+G  +P +F+ 
Sbjct  5    IGLYGLAVMGQNFALNMASHGFTVAVCNRSPSKVDTTVQRAKDEGDLPLIGTKSPEEFIS  64

Query  392  SIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             + +PR V+ILV+AG PVD TI A+SE ME GD II
Sbjct  65   KLSKPRKVVILVQAGKPVDLTIEAISEFMEEGDVII  100



>ref|XP_011400114.1| 6-phosphogluconate dehydrogenase, decarboxylating [Auxenochlorella 
protothecoides]
 gb|KFM27147.1| 6-phosphogluconate dehydrogenase, decarboxylating [Auxenochlorella 
protothecoides]
Length=473

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = +2

Query  185  VAAAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG-QLPLV  361
            +A+  A S +GL GLAVMGQNLALNVAEKGF ISVYNR+  K D  V RA +EG    L 
Sbjct  1    MASPTAQSEVGLIGLAVMGQNLALNVAEKGFHISVYNRSGDKTDAAVSRAGKEGVGERLH  60

Query  362  GQYNPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            G    +DFV S++RPR VIILVKAGAPVD TI  L++ +EPGD II
Sbjct  61   GYKELKDFVASLKRPRRVIILVKAGAPVDATIKQLTQFLEPGDIII  106



>emb|CCA16382.1| 6phosphogluconate dehydrogenase putative [Albugo laibachii Nc14]
Length=523

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LS +GL GLAVMGQN ALN+A  GF +SV NR+  KVD TVERA++EG LPLVG  +  +
Sbjct  38   LSDVGLYGLAVMGQNFALNMASHGFSVSVCNRSPDKVDTTVERAKQEGDLPLVGFKDVGE  97

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV S+  PR VIILV AG PVD TI+ ++EHME GD I+
Sbjct  98   FVRSLSVPRKVIILVMAGKPVDMTISIIAEHMEAGDIIV  136



>ref|XP_003080519.1| 6-phosphogluconate dehydrogenase (ISS) [Ostreococcus tauri]
Length=702

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = +2

Query  206  SRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREG-QLPLVGQYNPRD  382
            SRIGL GLAVMGQNLALNVA KGF ISVYNR+  K +  VERA++EG    L G  +  D
Sbjct  213  SRIGLCGLAVMGQNLALNVASKGFDISVYNRSGDKTETCVERAKKEGLGEKLRGYQDVGD  272

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV S+ +PR VIILVKAGAPVD TI  LS+ +EPGD II
Sbjct  273  FVDSLAKPRCVIILVKAGAPVDATIEKLSQFLEPGDCII  311



>emb|CCI10945.1| unnamed protein product [Albugo candida]
Length=489

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRD  382
            LS +GL GLAVMGQN ALN+A  GF +SV NR+ +KVD TVERA+ EG LPLVG  +  +
Sbjct  4    LSDVGLYGLAVMGQNFALNMASHGFRVSVCNRSPNKVDTTVERAKLEGDLPLVGYKDVGE  63

Query  383  FVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            FV S+  PR VIILV AG PVD TI+ ++EHME GD I+
Sbjct  64   FVRSLSVPRKVIILVMAGKPVDMTISIIAEHMEAGDIIV  102



>ref|XP_002289820.1| 6-phosphogluconate dehydrogenase [Thalassiosira pseudonana CCMP1335]
 gb|EED93357.1| 6-phosphogluconate dehydrogenase [Thalassiosira pseudonana CCMP1335]
Length=490

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +2

Query  212  IGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFVL  391
            +GL GLAVMGQN ALN+A KGF + V NR+ SKV+ TV RA+ EG LPLVG  +P DF  
Sbjct  5    VGLYGLAVMGQNFALNMASKGFKVCVGNRSPSKVELTVNRAKEEGNLPLVGSSDPEDFCK  64

Query  392  SIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             + +PR +IILV AG PVD TIA LS+++E GD I+
Sbjct  65   QLSKPRKIIILVMAGKPVDDTIATLSQYLEEGDVIV  100



>gb|EEE52109.1| hypothetical protein OsJ_33909 [Oryza sativa Japonica Group]
Length=477

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  236  MGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFVLSIQRPRSV  415
            MGQNLALN+AEKGFPISVYNRT +KVD TV RA+ EG LP++G  +PR FVLS+ RPR+V
Sbjct  1    MGQNLALNIAEKGFPISVYNRTAAKVDATVSRAEAEGALPVLGHRDPRGFVLSLSRPRTV  60

Query  416  IILVKAGAPVDQTIAALSEHMEPGDTII  499
            ++LV+AG  VD TI AL  +++ GD I+
Sbjct  61   VLLVQAGRAVDATIDALVPYLDAGDAIV  88



>emb|CAQ52407.1| 6-phosphogluconate dehydrogenase [Laminaria digitata]
Length=490

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +2

Query  191  AAQALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQY  370
            +A ALS +GL GLAVMGQN ALN+A  GF +SV NR+  KVD TV RA+ EG LPL G  
Sbjct  2    SASALSDVGLYGLAVMGQNFALNMASHGFSVSVSNRSPEKVDATVARAKEEGNLPLRGFK  61

Query  371  NPRDFVLSIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
            +P+ FV S+ +PR +++LV+AGA VD TIA LSE +E GD ++
Sbjct  62   DPKSFVDSLSKPRKIVLLVQAGAAVDATIATLSELLEEGDILV  104



>gb|EJK62811.1| hypothetical protein THAOC_16563 [Thalassiosira oceanica]
Length=490

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +2

Query  212  IGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETVERAQREGQLPLVGQYNPRDFVL  391
            IGL GLAVMGQN ALN+A KGF + V NR+ SKV+ TV RA+ EG LPLVG   P DFV 
Sbjct  5    IGLYGLAVMGQNFALNMASKGFKVCVGNRSPSKVELTVNRAKEEGSLPLVGSSGPEDFVK  64

Query  392  SIQRPRSVIILVKAGAPVDQTIAALSEHMEPGDTII  499
             + +PR ++ILV AG PVD+TIA LS++++ GD I+
Sbjct  65   QLSKPRKIVILVMAGKPVDETIANLSQYLDAGDVIV  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695