BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H03

Length=538
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             163   3e-46   Citrus clementina [clementine]
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          163   3e-46   Citrus sinensis [apfelsine]
ref|XP_002511930.1|  conserved hypothetical protein                     155   6e-43   Ricinus communis
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               154   2e-42   Vitis vinifera
emb|CDP12094.1|  unnamed protein product                                153   2e-42   Coffea canephora [robusta coffee]
gb|KDP25363.1|  hypothetical protein JCGZ_20519                         153   3e-42   Jatropha curcas
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   152   8e-42   Citrus sinensis [apfelsine]
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               151   1e-41   Elaeis guineensis
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             151   1e-41   Citrus clementina [clementine]
gb|KJB24635.1|  hypothetical protein B456_004G154600                    149   1e-41   Gossypium raimondii
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   152   2e-41   Citrus sinensis [apfelsine]
ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               151   3e-41   Solanum lycopersicum
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             151   3e-41   
gb|ABC69764.1|  unknown                                                 149   4e-41   Vitis pseudoreticulata
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               150   5e-41   Vitis vinifera
gb|KJB06452.1|  hypothetical protein B456_001G157900                    148   5e-41   Gossypium raimondii
ref|NP_001056102.1|  Os05g0526400                                       149   9e-41   
gb|KJB24634.1|  hypothetical protein B456_004G154600                    149   1e-40   Gossypium raimondii
gb|EAY98759.1|  hypothetical protein OsI_20691                          149   1e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               148   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               148   2e-40   Nicotiana sylvestris
gb|KJB06451.1|  hypothetical protein B456_001G157900                    148   3e-40   Gossypium raimondii
gb|KHG04885.1|  Reticulon-like protein B5                               148   3e-40   Gossypium arboreum [tree cotton]
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          148   3e-40   Solanum tuberosum [potatoes]
ref|XP_007051689.1|  Reticulon family protein                           147   6e-40   
gb|KJB06453.1|  hypothetical protein B456_001G157900                    147   7e-40   Gossypium raimondii
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               146   9e-40   Elaeis guineensis
gb|KJB24636.1|  hypothetical protein B456_004G154600                    142   1e-39   Gossypium raimondii
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               146   1e-39   Sesamum indicum [beniseed]
gb|KJB37517.1|  hypothetical protein B456_006G208500                    145   1e-39   Gossypium raimondii
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          145   2e-39   Oryza brachyantha
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               146   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               145   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               145   3e-39   Tarenaya hassleriana [spider flower]
ref|NP_001130478.1|  Seed maturation protein                            145   3e-39   Zea mays [maize]
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                145   3e-39   Erythranthe guttata [common monkey flower]
gb|KHG15548.1|  Reticulon-like protein B3                               145   3e-39   Gossypium arboreum [tree cotton]
ref|XP_002509881.1|  conserved hypothetical protein                     145   4e-39   Ricinus communis
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               144   6e-39   Nicotiana sylvestris
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               145   6e-39   Tarenaya hassleriana [spider flower]
ref|NP_001239711.1|  uncharacterized protein LOC100811024               144   6e-39   Glycine max [soybeans]
gb|KHG29253.1|  Reticulon-like protein B5                               144   8e-39   Gossypium arboreum [tree cotton]
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          144   9e-39   Solanum tuberosum [potatoes]
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    144   1e-38   Nicotiana tomentosiformis
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               144   1e-38   Phoenix dactylifera
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 144   1e-38   Elaeis guineensis
ref|XP_006374287.1|  hypothetical protein POPTR_0015s05710g             142   1e-38   
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               143   2e-38   
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          143   2e-38   Solanum tuberosum [potatoes]
ref|XP_006374288.1|  hypothetical protein POPTR_0015s05710g             142   2e-38   
gb|EAY75742.1|  hypothetical protein OsI_03655                          143   2e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_009626481.1|  PREDICTED: reticulon-like protein B5 isoform X2    141   2e-38   
ref|XP_007038874.1|  VIRB2-interacting protein 2                        142   2e-38   Theobroma cacao [chocolate]
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               143   3e-38   Nicotiana sylvestris
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               142   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_002320163.1|  reticulon family protein                           142   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010439153.1|  PREDICTED: reticulon-like protein B1 isoform X2    141   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               144   3e-38   Elaeis guineensis
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             142   4e-38   
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             142   4e-38   Eutrema salsugineum [saltwater cress]
gb|ABK94480.1|  unknown                                                 142   4e-38   Populus trichocarpa [western balsam poplar]
gb|KDP28552.1|  hypothetical protein JCGZ_14323                         142   5e-38   Jatropha curcas
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          143   6e-38   Glycine max [soybeans]
gb|KHG24129.1|  Reticulon-like protein B3                               142   6e-38   Gossypium arboreum [tree cotton]
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               142   6e-38   Nicotiana tomentosiformis
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    142   8e-38   Nicotiana sylvestris
ref|XP_011073415.1|  PREDICTED: reticulon-like protein B1 isoform X2    139   8e-38   
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               141   9e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             141   9e-38   
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    142   9e-38   Nicotiana sylvestris
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               141   1e-37   Brassica rapa
emb|CDY42012.1|  BnaC04g00900D                                          141   1e-37   Brassica napus [oilseed rape]
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               142   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               141   1e-37   Solanum lycopersicum
ref|NP_001149653.1|  LOC100283279                                       141   1e-37   Zea mays [maize]
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               141   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    141   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010462752.1|  PREDICTED: reticulon-like protein B5 isoform X2    137   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               140   2e-37   Phoenix dactylifera
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    140   2e-37   Glycine max [soybeans]
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               140   2e-37   Sesamum indicum [beniseed]
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             140   2e-37   Phaseolus vulgaris [French bean]
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               140   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               140   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1    140   3e-37   Sesamum indicum [beniseed]
emb|CDY57657.1|  BnaC01g15350D                                          140   3e-37   Brassica napus [oilseed rape]
dbj|BAJ89699.1|  predicted protein                                      140   4e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007218267.1|  hypothetical protein PRUPE_ppa008259mg             140   4e-37   
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               140   4e-37   Nicotiana tomentosiformis
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               139   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               139   5e-37   Prunus mume [ume]
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               140   5e-37   Brassica rapa
ref|XP_002880222.1|  reticulon family protein                           139   5e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             139   5e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               139   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             139   6e-37   Capsella rubella
ref|XP_010112604.1|  Reticulon-like protein                             139   7e-37   Morus notabilis
gb|EMS62606.1|  Reticulon-like protein B1                               139   8e-37   Triticum urartu
emb|CDY44123.1|  BnaA01g13310D                                          139   9e-37   Brassica napus [oilseed rape]
ref|NP_001241367.1|  uncharacterized protein LOC100796111               139   9e-37   Glycine max [soybeans]
gb|KHN15986.1|  Reticulon-like protein B5                               138   9e-37   Glycine soja [wild soybean]
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               139   1e-36   Solanum lycopersicum
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             139   1e-36   
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             140   1e-36   
emb|CDY52012.1|  BnaC06g42920D                                          138   1e-36   Brassica napus [oilseed rape]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               138   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               138   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg             137   2e-36   
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          138   2e-36   Oryza brachyantha
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          138   2e-36   Setaria italica
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               138   2e-36   Brassica rapa
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               138   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          138   2e-36   Cicer arietinum [garbanzo]
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             137   2e-36   Capsella rubella
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               137   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               137   2e-36   Camelina sativa [gold-of-pleasure]
gb|AFW80460.1|  hypothetical protein ZEAMMB73_353444                    135   2e-36   
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               137   2e-36   Camelina sativa [gold-of-pleasure]
gb|ACF87936.1|  unknown                                                 136   2e-36   Zea mays [maize]
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             138   2e-36   Eutrema salsugineum [saltwater cress]
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               137   3e-36   Populus euphratica
ref|XP_010462746.1|  PREDICTED: reticulon-like protein B5 isoform X1    135   3e-36   
ref|NP_001118533.1|  reticulon-like protein B5                          135   3e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KDP22201.1|  hypothetical protein JCGZ_26032                         137   4e-36   Jatropha curcas
gb|KJB24286.1|  hypothetical protein B456_004G137000                    134   4e-36   Gossypium raimondii
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          137   4e-36   Oryza brachyantha
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             137   4e-36   Eutrema salsugineum [saltwater cress]
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               137   4e-36   Brassica rapa
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               137   4e-36   Elaeis guineensis
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               137   5e-36   Phoenix dactylifera
gb|ACU23452.1|  unknown                                                 137   5e-36   Glycine max [soybeans]
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               137   5e-36   Tarenaya hassleriana [spider flower]
dbj|BAJ98297.1|  predicted protein                                      137   5e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    137   6e-36   Solanum tuberosum [potatoes]
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               137   6e-36   Camelina sativa [gold-of-pleasure]
ref|NP_176592.1|  reticulon-like protein B3                             136   6e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               136   6e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     135   7e-36   Eucalyptus grandis [rose gum]
emb|CDY25557.1|  BnaC09g11820D                                          136   8e-36   Brassica napus [oilseed rape]
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     135   9e-36   Eucalyptus grandis [rose gum]
ref|XP_002299504.1|  reticulon family protein                           136   9e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               136   1e-35   Eucalyptus grandis [rose gum]
ref|NP_198975.1|  reticulon-like protein B4                             136   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               136   1e-35   
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               136   1e-35   Populus euphratica
ref|NP_001044177.1|  Os01g0736900                                       135   1e-35   
ref|NP_566065.1|  reticulon-like protein B5                             135   1e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDY34396.1|  BnaA09g11380D                                          135   1e-35   Brassica napus [oilseed rape]
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     136   1e-35   Eucalyptus grandis [rose gum]
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             136   1e-35   Prunus persica
dbj|BAJ33905.1|  unnamed protein product                                136   2e-35   Eutrema halophilum
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               135   2e-35   Prunus mume [ume]
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    135   2e-35   Arabis alpina [alpine rockcress]
tpg|DAA52789.1|  TPA: seed maturation protein                           136   2e-35   
dbj|BAB32723.1|  unknown protein                                        136   2e-35   Oryza sativa Japonica Group [Japonica rice]
gb|EAY73097.1|  hypothetical protein OsI_00974                          136   2e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    135   2e-35   
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    138   2e-35   
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               135   2e-35   Brassica rapa
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     136   2e-35   Eucalyptus grandis [rose gum]
ref|NP_194094.1|  VIRB2-interacting protein 1                           135   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150474.1|  seed maturation protein                            135   3e-35   
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               135   3e-35   Tarenaya hassleriana [spider flower]
gb|KJB24287.1|  hypothetical protein B456_004G137000                    134   3e-35   Gossypium raimondii
emb|CDY10954.1|  BnaA03g46130D                                          135   3e-35   Brassica napus [oilseed rape]
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               135   3e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK39432.1|  unknown                                                 132   3e-35   Lotus japonicus
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               134   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             135   4e-35   Capsella rubella
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               134   4e-35   Pyrus x bretschneideri [bai li]
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                134   5e-35   Erythranthe guttata [common monkey flower]
ref|XP_002870630.1|  VIRB2-interacting protein 3                        134   5e-35   
emb|CDY05135.1|  BnaC03g29330D                                          135   5e-35   
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                     133   5e-35   Eucalyptus grandis [rose gum]
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    135   5e-35   
emb|CDY08353.1|  BnaC09g12430D                                          134   6e-35   Brassica napus [oilseed rape]
gb|KJB24285.1|  hypothetical protein B456_004G137000                    134   6e-35   Gossypium raimondii
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               134   6e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    134   7e-35   Camelina sativa [gold-of-pleasure]
gb|AFK42129.1|  unknown                                                 132   7e-35   Medicago truncatula
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             133   8e-35   
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               134   9e-35   Brachypodium distachyon [annual false brome]
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             133   9e-35   Eutrema salsugineum [saltwater cress]
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               133   9e-35   Populus euphratica
ref|XP_010105716.1|  Reticulon-like protein                             134   1e-34   
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               133   1e-34   Cucumis melo [Oriental melon]
ref|XP_002869770.1|  VIRB2-interacting protein 1                        134   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_002874678.1|  VIRB2-interacting protein 2                        134   1e-34   Arabidopsis lyrata subsp. lyrata
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          133   1e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               133   1e-34   Malus domestica [apple tree]
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               133   1e-34   Pyrus x bretschneideri [bai li]
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                133   1e-34   Erythranthe guttata [common monkey flower]
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               133   2e-34   Brachypodium distachyon [annual false brome]
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               132   2e-34   Eucalyptus grandis [rose gum]
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like          133   2e-34   Cucumis sativus [cucumbers]
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5               132   2e-34   Fragaria vesca subsp. vesca
gb|ACJ84486.1|  unknown                                                 133   2e-34   Medicago truncatula
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               133   2e-34   Brassica rapa
ref|NP_192861.1|  reticulon-like protein B2                             133   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               132   2e-34   Malus domestica [apple tree]
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               133   3e-34   Camelina sativa [gold-of-pleasure]
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    132   3e-34   Arabis alpina [alpine rockcress]
gb|KHG20258.1|  Reticulon-like protein B3                               132   3e-34   Gossypium arboreum [tree cotton]
emb|CDY24806.1|  BnaA08g15040D                                          132   3e-34   Brassica napus [oilseed rape]
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               132   3e-34   Solanum lycopersicum
gb|EPS71452.1|  hypothetical protein M569_03311                         132   3e-34   Genlisea aurea
gb|KJB19086.1|  hypothetical protein B456_003G084400                    131   3e-34   Gossypium raimondii
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               132   3e-34   
gb|AFK34557.1|  unknown                                                 132   4e-34   Medicago truncatula
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               132   4e-34   Populus euphratica
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               132   4e-34   Pyrus x bretschneideri [bai li]
ref|NP_191715.2|  reticulon-like protein B6                             131   5e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887921.1|  reticulon family protein                           131   6e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               131   6e-34   Malus domestica [apple tree]
gb|KJB19089.1|  hypothetical protein B456_003G084400                    130   6e-34   Gossypium raimondii
gb|AFK41983.1|  unknown                                                 130   8e-34   Medicago truncatula
gb|KJB19088.1|  hypothetical protein B456_003G084400                    130   1e-33   Gossypium raimondii
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    130   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB19087.1|  hypothetical protein B456_003G084400                    130   1e-33   Gossypium raimondii
gb|KJB19091.1|  hypothetical protein B456_003G084400                    130   1e-33   Gossypium raimondii
gb|AFK48295.1|  unknown                                                 128   2e-33   Lotus japonicus
gb|KHN40449.1|  Reticulon-like protein B5                               130   2e-33   Glycine soja [wild soybean]
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               130   2e-33   
gb|KJB52681.1|  hypothetical protein B456_008G272900                    126   2e-33   Gossypium raimondii
ref|NP_001030913.1|  reticulon-like protein B6                          130   2e-33   
ref|NP_001240231.1|  uncharacterized protein LOC100778096               129   4e-33   Glycine max [soybeans]
emb|CDY41666.1|  BnaC03g62180D                                          130   4e-33   Brassica napus [oilseed rape]
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          129   4e-33   Solanum tuberosum [potatoes]
emb|CDP08746.1|  unnamed protein product                                129   5e-33   Coffea canephora [robusta coffee]
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               129   6e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             129   6e-33   Prunus persica
emb|CDY38194.1|  BnaA09g11950D                                          129   6e-33   Brassica napus [oilseed rape]
gb|KDO86332.1|  hypothetical protein CISIN_1g025719mg                   127   7e-33   Citrus sinensis [apfelsine]
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             128   9e-33   Citrus clementina [clementine]
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   128   9e-33   Citrus sinensis [apfelsine]
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               128   1e-32   Populus euphratica
ref|XP_010092876.1|  Reticulon-like protein                             128   1e-32   Morus notabilis
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               128   1e-32   Nicotiana sylvestris
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               127   2e-32   Eucalyptus grandis [rose gum]
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2               127   2e-32   Fragaria vesca subsp. vesca
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               127   2e-32   Malus domestica [apple tree]
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    127   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB52680.1|  hypothetical protein B456_008G272900                    124   2e-32   Gossypium raimondii
gb|KJB52682.1|  hypothetical protein B456_008G272900                    125   2e-32   Gossypium raimondii
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               127   3e-32   Tarenaya hassleriana [spider flower]
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               127   3e-32   Vitis vinifera
gb|EMT19773.1|  Reticulon-like protein B1                               127   3e-32   
emb|CAN77759.1|  hypothetical protein VITISV_034907                     126   4e-32   Vitis vinifera
ref|XP_004980276.1|  PREDICTED: uncharacterized protein LOC101782657    128   4e-32   Setaria italica
gb|EMS62854.1|  Reticulon-like protein B1                               126   4e-32   Triticum urartu
gb|KJB52679.1|  hypothetical protein B456_008G272900                    126   5e-32   Gossypium raimondii
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          126   5e-32   Setaria italica
ref|XP_002303615.1|  reticulon family protein                           126   6e-32   Populus trichocarpa [western balsam poplar]
emb|CDJ26559.1|  unnamed protein product                                127   6e-32   Triticum aestivum [Canadian hard winter wheat]
gb|EMT06999.1|  Reticulon-like protein B1                               126   6e-32   
gb|KHF99856.1|  Reticulon-like protein B1                               124   6e-32   Gossypium arboreum [tree cotton]
ref|NP_001185307.1|  reticulon-like protein B3                          126   7e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDM81762.1|  unnamed protein product                                125   7e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g             124   8e-32   Phaseolus vulgaris [French bean]
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                125   9e-32   Erythranthe guttata [common monkey flower]
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               125   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             125   1e-31   Phaseolus vulgaris [French bean]
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               125   2e-31   Brassica rapa
gb|EMS49910.1|  Reticulon-like protein B3                               126   3e-31   Triticum urartu
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          124   3e-31   Setaria italica
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               124   3e-31   Malus domestica [apple tree]
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             124   4e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             124   4e-31   Capsella rubella
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               124   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               123   5e-31   Camelina sativa [gold-of-pleasure]
ref|NP_001239653.1|  uncharacterized protein LOC100793862               124   5e-31   Glycine max [soybeans]
ref|XP_002876621.1|  reticulon family protein                           123   6e-31   
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    124   6e-31   Arabis alpina [alpine rockcress]
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like          123   6e-31   Cucumis sativus [cucumbers]
gb|KJB52211.1|  hypothetical protein B456_008G250900                    122   7e-31   Gossypium raimondii
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               123   1e-30   Brassica rapa
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          123   1e-30   Sorghum bicolor [broomcorn]
gb|AFK42059.1|  unknown                                                 122   1e-30   Lotus japonicus
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               122   1e-30   Camelina sativa [gold-of-pleasure]
gb|EPS69502.1|  hypothetical protein M569_05265                         122   1e-30   
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               122   1e-30   
dbj|BAH57206.1|  AT1G64090                                              122   1e-30   
gb|KJB52210.1|  hypothetical protein B456_008G250900                    122   2e-30   
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               122   2e-30   
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               122   2e-30   
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               122   2e-30   
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               121   3e-30   
gb|KHG09260.1|  Reticulon-like protein B3                               121   3e-30   
gb|KJB52212.1|  hypothetical protein B456_008G250900                    120   4e-30   
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               120   8e-30   
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2               120   2e-29   
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    119   2e-29   
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             119   2e-29   
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               119   3e-29   
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             119   3e-29   
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               119   4e-29   
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          118   7e-29   
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             118   8e-29   
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840          118   9e-29   
gb|KHN21799.1|  Reticulon-like protein B1                               117   1e-28   
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    117   2e-28   
emb|CDP05124.1|  unnamed protein product                                116   3e-28   
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               116   3e-28   
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               116   3e-28   
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450          115   4e-28   
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          116   4e-28   
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          116   4e-28   
gb|KHN29299.1|  Reticulon-like protein B5                               115   4e-28   
emb|CDX90792.1|  BnaA03g24720D                                          116   6e-28   
gb|ACN40158.1|  unknown                                                 115   6e-28   
gb|ABR17571.1|  unknown                                                 115   6e-28   
gb|AFW78798.1|  hypothetical protein ZEAMMB73_677867                    112   6e-28   
gb|ACG32549.1|  seed maturation protein                                 115   8e-28   
ref|XP_003592173.1|  Reticulon family protein                           114   2e-27   
gb|EPS73616.1|  hypothetical protein M569_01145                         114   2e-27   
ref|XP_008782788.1|  PREDICTED: reticulon-like protein B1               113   2e-27   
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like          114   2e-27   
gb|KHN12926.1|  Reticulon-like protein B1                               114   2e-27   
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          114   2e-27   
ref|NP_001130268.1|  uncharacterized protein LOC100191362               114   2e-27   
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               113   2e-27   
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               113   3e-27   
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               113   6e-27   
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      113   7e-27   
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               111   8e-27   
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      112   9e-27   
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      113   1e-26   
gb|KCW89794.1|  hypothetical protein EUGRSUZ_A02040                     110   1e-26   
ref|XP_002521590.1|  conserved hypothetical protein                     111   2e-26   
ref|XP_010688858.1|  PREDICTED: reticulon-like protein B8               111   2e-26   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               111   2e-26   
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          111   3e-26   
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               111   3e-26   
ref|XP_002302126.2|  reticulon family protein                           111   3e-26   
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               111   3e-26   
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               111   4e-26   
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    110   4e-26   
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               110   4e-26   
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2    111   4e-26   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     110   5e-26   
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               110   6e-26   
gb|EPS67049.1|  hypothetical protein M569_07727                         109   6e-26   
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230          110   6e-26   
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   110   7e-26   
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    110   7e-26   
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             110   7e-26   
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    110   8e-26   
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    110   9e-26   
emb|CDP18758.1|  unnamed protein product                                109   1e-25   
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               109   1e-25   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                108   1e-25   
ref|XP_004147776.1|  PREDICTED: reticulon-like protein B8-like          108   1e-25   
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               109   1e-25   
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8               109   2e-25   
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          108   2e-25   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like          108   2e-25   
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg             109   2e-25   
ref|XP_008809740.1|  PREDICTED: reticulon-like protein B8 isoform X2    107   2e-25   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               108   3e-25   
ref|XP_008809739.1|  PREDICTED: reticulon-like protein B8 isoform X1    107   3e-25   
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...    109   3e-25   
ref|XP_002306759.1|  reticulon family protein                           108   3e-25   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    108   3e-25   
gb|EAY97489.1|  hypothetical protein OsI_19418                          108   4e-25   
ref|NP_001057713.1|  Os06g0503400                                       108   4e-25   
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          108   4e-25   
emb|CDY41331.1|  BnaA01g31880D                                          107   5e-25   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               107   5e-25   
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               107   5e-25   
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          107   5e-25   
ref|XP_006491907.1|  PREDICTED: reticulon-like protein B5-like is...    108   5e-25   
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...    108   5e-25   
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               107   6e-25   
ref|XP_007048924.1|  Reticulon family protein                           107   7e-25   
ref|NP_001130603.1|  uncharacterized protein LOC100191702               107   7e-25   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    107   7e-25   
emb|CDY56712.1|  BnaC01g38700D                                          108   7e-25   
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               107   8e-25   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    107   9e-25   
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               107   9e-25   
ref|NP_001055164.1|  Os05g0312500                                       107   9e-25   
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1    107   1e-24   
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               106   1e-24   
ref|NP_566371.1|  reticulon-like protein B8                             106   1e-24   
gb|EEC80692.1|  hypothetical protein OsI_23118                          111   1e-24   
dbj|BAK05980.1|  predicted protein                                      106   1e-24   
gb|ACG36034.1|  reticulon                                               106   1e-24   
gb|EEE63204.1|  hypothetical protein OsJ_18014                          108   1e-24   
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like          107   2e-24   
ref|NP_850552.1|  reticulon-like protein B8                             106   2e-24   
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8               106   2e-24   
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             106   2e-24   
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          106   2e-24   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               106   2e-24   
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               106   2e-24   
gb|EPS64109.1|  hypothetical protein M569_10676                         106   2e-24   
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    105   2e-24   
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               106   2e-24   
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               105   3e-24   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    105   3e-24   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    105   3e-24   
gb|AFW82132.1|  hypothetical protein ZEAMMB73_565764                    104   3e-24   
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like          105   4e-24   
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               105   4e-24   
gb|EMT10142.1|  Reticulon-like protein B1                               105   4e-24   
dbj|BAJ94514.1|  predicted protein                                      105   6e-24   
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               104   6e-24   
ref|NP_001150935.1|  seed maturation protein                            104   7e-24   
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          104   9e-24   
dbj|BAK06264.1|  predicted protein                                      104   9e-24   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                         104   1e-23   
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2    103   1e-23   
gb|EAY85291.1|  hypothetical protein OsI_06662                          103   1e-23   
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               104   1e-23   
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...    103   1e-23   
gb|KHN28537.1|  Reticulon-like protein B8                               103   1e-23   
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    103   1e-23   
emb|CDY00916.1|  BnaC05g42840D                                          103   2e-23   
gb|KHG28741.1|  Reticulon-like protein B8                               103   2e-23   
ref|NP_001130091.1|  uncharacterized protein LOC100191184               103   2e-23   
gb|ABK22748.1|  unknown                                                 103   2e-23   
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    103   2e-23   
gb|ABK26525.1|  unknown                                                 103   2e-23   
ref|XP_006602273.1|  PREDICTED: reticulon-like protein B8-like is...    103   3e-23   
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               102   3e-23   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               102   3e-23   
ref|NP_001046501.1|  Os02g0265900                                       102   4e-23   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    102   4e-23   
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          102   6e-23   
gb|EMS52545.1|  Reticulon-like protein B1                               102   6e-23   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               102   6e-23   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             102   7e-23   
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 101   9e-23   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               101   1e-22   
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    101   1e-22   
ref|NP_001149072.1|  LOC100282693                                       101   1e-22   
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    101   1e-22   
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          101   1e-22   
gb|EAY98925.1|  hypothetical protein OsI_20880                          100   1e-22   
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1    101   1e-22   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               101   1e-22   
ref|XP_009416753.1|  PREDICTED: reticulon-like protein B8 isoform X2    100   1e-22   
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               100   2e-22   
ref|XP_011461529.1|  PREDICTED: reticulon-like protein B4               100   2e-22   
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               100   2e-22   
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like          100   2e-22   
gb|KJB71178.1|  hypothetical protein B456_011G126300                  99.4    2e-22   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             100   3e-22   
gb|ABB51093.1|  reticulon                                             99.8    3e-22   
ref|XP_010543528.1|  PREDICTED: reticulon-like protein B8               100   3e-22   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               100   3e-22   
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1    100   3e-22   
gb|KJB71177.1|  hypothetical protein B456_011G126300                  99.0    3e-22   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               100   3e-22   
gb|EMT22798.1|  Reticulon-like protein B8                             96.3    4e-22   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               100   4e-22   
gb|KJB71176.1|  hypothetical protein B456_011G126300                  99.0    4e-22   
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    100   4e-22   
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4  99.8    5e-22   
gb|EMT18983.1|  Reticulon-like protein B1                             99.4    5e-22   
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2  99.8    5e-22   
ref|XP_010228928.1|  PREDICTED: reticulon-like protein B8             99.4    6e-22   
ref|XP_006491908.1|  PREDICTED: reticulon-like protein B5-like is...    100   7e-22   
gb|KJB39437.1|  hypothetical protein B456_007G013600                  99.0    9e-22   
gb|KEH33647.1|  reticulon-like protein B2                             99.0    9e-22   
gb|KJB71174.1|  hypothetical protein B456_011G126300                  99.0    1e-21   
gb|KHG24796.1|  Reticulon-like protein B5                             97.8    1e-21   
ref|XP_009421445.1|  PREDICTED: reticulon-like protein B1             97.1    2e-21   
gb|KJB71173.1|  hypothetical protein B456_011G126300                  98.6    2e-21   
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1  98.2    2e-21   
ref|XP_008380161.1|  PREDICTED: reticulon-like protein B8 isoform X3  97.8    2e-21   
ref|NP_001051461.1|  Os03g0781700                                     97.8    2e-21   
ref|XP_008380159.1|  PREDICTED: reticulon-like protein B8 isoform X1  97.8    3e-21   
ref|XP_011096983.1|  PREDICTED: reticulon-like protein B9             97.1    3e-21   
gb|EAY92056.1|  hypothetical protein OsI_13754                        97.8    3e-21   
gb|EMT22797.1|  Reticulon-like protein B9                             97.1    4e-21   
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9             97.1    4e-21   
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like        97.4    4e-21   
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8             97.4    4e-21   
ref|XP_002319442.2|  hypothetical protein POPTR_0013s15680g           97.1    5e-21   
ref|XP_010313685.1|  PREDICTED: reticulon-like protein B8 isoform X1  97.1    6e-21   
ref|XP_004251554.1|  PREDICTED: reticulon-like protein B8 isoform X2  96.7    6e-21   
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g           96.7    6e-21   
ref|XP_008809164.1|  PREDICTED: reticulon-like protein B4             96.3    7e-21   
ref|XP_006643730.1|  PREDICTED: reticulon-like protein B9-like        95.9    8e-21   
ref|XP_010279360.1|  PREDICTED: reticulon-like protein B9             95.9    8e-21   
ref|XP_009415631.1|  PREDICTED: reticulon-like protein B2             95.9    1e-20   
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8             96.3    1e-20   
emb|CDM80956.1|  unnamed protein product                              95.9    1e-20   
ref|XP_007152723.1|  hypothetical protein PHAVU_004G154000g           95.9    1e-20   
gb|EMT25698.1|  Reticulon-like protein B2                             95.9    1e-20   
ref|XP_006298417.1|  hypothetical protein CARUB_v10014488mg           95.5    2e-20   
gb|ACG31942.1|  seed maturation protein                               95.5    2e-20   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like        95.5    2e-20   
ref|XP_008363374.1|  PREDICTED: reticulon-like protein B4             95.1    2e-20   
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220        94.7    3e-20   
ref|XP_003565315.1|  PREDICTED: reticulon-like protein B4             94.0    3e-20   
gb|ACU15028.1|  unknown                                               92.0    4e-20   
gb|KCW64688.1|  hypothetical protein EUGRSUZ_G02275                   93.6    5e-20   
ref|XP_004963616.1|  PREDICTED: reticulon-like protein B9-like        94.0    5e-20   



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 126/153 (82%), Gaps = 3/153 (2%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MA+E + EE   ES+ EKI +KIH HDSSSSS S   +++KK + SS+  KV RLFGR++
Sbjct  1    MADEHKHEEPAGESVKEKITEKIHGHDSSSSSSSSDSDDDKKSSASSLKTKVFRLFGREK  60

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWRN KIS GVLGGATAIW+LFE+LEYHLLT VCH LI+ALAVLF
Sbjct  61   PVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLIVALAVLF  120

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI KS P IPEV+IPEEPVLQ ASAL
Sbjct  121  LWSNASTFINKSPPRIPEVYIPEEPVLQLASAL  153



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 3/153 (2%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MA+E + EE   ES++EKI +KIH HDSSSSS S   +++KK +TSS+  KV RLFGR++
Sbjct  1    MADEHKHEEPAGESVMEKITEKIHGHDSSSSSSSSDTDDDKKSSTSSLKTKVFRLFGREK  60

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWRN KIS GVLGGATAIW+LF++LEYHLLT VCH LI+ALAVLF
Sbjct  61   PVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLF  120

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI KS P IPEV+IPEEPVLQ ASAL
Sbjct  121  LWSNASTFINKSPPRIPEVYIPEEPVLQLASAL  153



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   155 bits (391),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE      ES++EKI++KIH HDSSSSSDSE + E+K  + SS+ AK+ RLFGR++PVH
Sbjct  1    MAEHPESPIESVMEKISEKIHAHDSSSSSDSESDSEKKPTSPSSVKAKIFRLFGRERPVH  60

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             VLGGGK ADVFLWRN KIS  VLG ATAIWILFE++EYHLLT VCH  IL LA+LFLWS
Sbjct  61   HVLGGGKPADVFLWRNKKISASVLGTATAIWILFELIEYHLLTLVCHISILTLAILFLWS  120

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FI K+ P IP+VHIPEEPVLQ ASAL
Sbjct  121  NAHTFINKTPPRIPQVHIPEEPVLQVASAL  150



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 113/141 (80%), Gaps = 5/141 (4%)
 Frame = +1

Query  112  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  291
            ES++EKI++KIH HDSSSS    ++            AKV R+FGR++PVHKVLGGGK A
Sbjct  13   ESMMEKISEKIHGHDSSSSDSDNEKSSPSA-----FKAKVYRIFGREKPVHKVLGGGKPA  67

Query  292  DVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKS  471
            DV LWRN KIS GVLGGATA+WILFE+LEYHLLT VCH  ILALA+LFLWSNA +FI K+
Sbjct  68   DVVLWRNKKISAGVLGGATAVWILFELLEYHLLTLVCHCSILALAILFLWSNATTFINKA  127

Query  472  AphipevhipeepvLQFASAL  534
             PHIPEVHIPE+PVLQFASAL
Sbjct  128  PPHIPEVHIPEDPVLQFASAL  148



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 113/146 (77%), Gaps = 6/146 (4%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            EED K E SL+EK  DK+H      + DS     + +  TSS+ AKV RLFGR++PVHK+
Sbjct  7    EEDAKAE-SLIEKTRDKVH-----GADDSSSSSSDDEGKTSSLKAKVFRLFGREKPVHKL  60

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGGK ADVF+WRN +IS GVLG ATAIW+LFE+LEYHLLT VCHGLI+ LAVLFLWSNA
Sbjct  61   LGGGKPADVFMWRNKQISAGVLGVATAIWVLFEILEYHLLTLVCHGLIIVLAVLFLWSNA  120

Query  451  XSFIKKSAphipevhipeepvLQFAS  528
             +FI KS P IPEV +PE+PVLQFAS
Sbjct  121  STFINKSPPRIPEVSVPEKPVLQFAS  146



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 128/153 (84%), Gaps = 3/153 (2%)
 Frame = +1

Query  85   MAEEDRKEE--ESLVEKIADKIHRHdsssssdsek-eeeekkkttssMDAKVRRLFGRQQ  255
            MAE  ++E   ES++EKI++KIH HDSSSSSDS+  E+ +   + SSM +K+ R+FGR++
Sbjct  1    MAEHHKEESVIESVMEKISEKIHGHDSSSSSDSDNDEKSKSSSSPSSMKSKIYRIFGREK  60

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK AD+FLWRN KIS GVLGGATAIW+LFE++EYHLLT +CHGLIL+LAVLF
Sbjct  61   PVHKVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHGLILSLAVLF  120

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI KS P IPEV+IPEEPVLQ A AL
Sbjct  121  LWSNASTFINKSPPRIPEVYIPEEPVLQVADAL  153



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   152 bits (383),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 110/149 (74%), Gaps = 4/149 (3%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            A E    ++SLVEKI DKIH HDSSSS   + +            +KV RLFGR++P+H 
Sbjct  5    APEHESSDKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLG GK AD+FLWRN KIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  448  AXSFIKKSAphipevhipeepvLQFASAL  534
            A +FI KS P IP V +PE+ VL+FASAL
Sbjct  121  ASTFINKSPPEIPVVTLPEKFVLEFASAL  149



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 97/129 (75%), Gaps = 3/129 (2%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            +EE   +  SL+EKI DK+H HD SSS    ++ E    +   + A + RLFGR++PVHK
Sbjct  5    SEESSSKPVSLMEKIVDKLHGHDDSSSDSDNEKSEPSASS---IKANIYRLFGRERPVHK  61

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLGGGK ADVFLWRN KIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSN
Sbjct  62   VLGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHCLILSLAILFLWSN  121

Query  448  AXSFIKKSA  474
            A  FI K+ 
Sbjct  122  ASIFINKAP  130



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 110/149 (74%), Gaps = 4/149 (3%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            A E    ++SLVEKI DKIH HDSSSS   + +            +KV RLFGR++P+H 
Sbjct  5    APEHESADKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLG GK AD+FLWRN KIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  448  AXSFIKKSAphipevhipeepvLQFASAL  534
            A +FI KS P IP V +PE+ VL+FASAL
Sbjct  121  ASTFINKSPPEIPVVTLPEKFVLEFASAL  149



>gb|KJB24635.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=179

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 121/153 (79%), Gaps = 4/153 (3%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +S + AK+ RLFGR++
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVH VLGGGK ADVFLWRN KIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LF
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLF  119

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI KS P IPE+H+PEEP LQ ASAL
Sbjct  120  LWSNAHTFIHKSPPRIPEIHLPEEPFLQVASAL  152



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 110/149 (74%), Gaps = 4/149 (3%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            A E    ++SLVEKI DKIH HDSSSS   + +            +KV RLFGR++P+H 
Sbjct  5    APEHESSDKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLG GK AD+FLWRN KIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  448  AXSFIKKSAphipevhipeepvLQFASAL  534
            A +FI KS P IP V +PE+ VL+FASAL
Sbjct  121  ASTFINKSPPEIPVVTLPEKFVLEFASAL  149



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 120/157 (76%), Gaps = 10/157 (6%)
 Frame = +1

Query  94   EDRKEEESLVEKIADKIH----------RHdsssssdsekeeeekkkttssMDAKVRRLF  243
            E  + +ESL++KI++K+H             SS S D +K+       TSS  +KVRRLF
Sbjct  10   EKEEHDESLMDKISEKLHFSNHSSSPAPASSSSDSDDEKKKPTSPAPATSSFGSKVRRLF  69

Query  244  GRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  423
            GR++PVHKV GGGK ADVFLWRN KIS G LGGATAIW+LFEV+EYHLLT +CHGL++AL
Sbjct  70   GRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMIAL  129

Query  424  AVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            A LFLWSNA +FI KSAPHIPEVHIPE+PVL+FASAL
Sbjct  130  AGLFLWSNASTFIHKSAPHIPEVHIPEKPVLEFASAL  166



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 110/149 (74%), Gaps = 4/149 (3%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            A E    ++SLVEKI DKIH HDSSSS   + +            +KV RLFGR++P+H 
Sbjct  5    APEHESADKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLG GK AD+FLWRN KIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  448  AXSFIKKSAphipevhipeepvLQFASAL  534
            A +FI KS P IP V +PE+ VL+FASAL
Sbjct  121  ASTFINKSPPEIPVVTLPEKFVLEFASAL  149



>gb|ABC69764.1| unknown [Vitis pseudoreticulata]
Length=211

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 112/149 (75%), Gaps = 2/149 (1%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            AE      ESL+EKI DK+  HDSSSS      ++    +   + AKV RLFGR++PVH 
Sbjct  5    AEGSGAASESLLEKITDKLQGHDSSSSDSDSDSDKAASPSP--IKAKVFRLFGREKPVHT  62

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLGGGK ADVFLWRN KIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSN
Sbjct  63   VLGGGKHADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLWSN  122

Query  448  AXSFIKKSAphipevhipeepvLQFASAL  534
            A +FI KS P IP+VHIPE+P LQ  +AL
Sbjct  123  ATTFINKSPPRIPDVHIPEDPFLQAVNAL  151



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 112/149 (75%), Gaps = 2/149 (1%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            AE      ESL+EKI DK+  HDSSSS      ++    +   + AKV RLFGR++PVH 
Sbjct  5    AEGSGAASESLLEKITDKLQGHDSSSSGSDSDSDKPASPSP--IKAKVFRLFGREKPVHT  62

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLGGGK ADVFLWRN KIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSN
Sbjct  63   VLGGGKHADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLWSN  122

Query  448  AXSFIKKSAphipevhipeepvLQFASAL  534
            A +FI KS P IPEVHIPE+P LQ  +AL
Sbjct  123  ATTFINKSPPRIPEVHIPEDPFLQAVNAL  151



>gb|KJB06452.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=186

 Score =   148 bits (373),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 124/154 (81%), Gaps = 4/154 (3%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeee-ekkkttssMDAKVRRLFGRQ  252
            MAEE    +   ES++EKI++KIH HDSSSSSDS+ + + EK  + SS+ AK+ RLFGR+
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +P+H VLGGGK ADVFLWRN KIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVL
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVL  120

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSN  +FI K+ P IP+VH+PEEP LQ ASAL
Sbjct  121  FLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASAL  154



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   149 bits (376),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE   KEEESLVE + DKI          S    +   + T+ + AK+ RLFGR++PVH
Sbjct  1    MAE--HKEEESLVESVMDKISDKLHGRGGSSSSSSDSDGERTADLKAKIYRLFGREKPVH  58

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             VLGGGK AD+FLWRN KISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWS
Sbjct  59   SVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWS  118

Query  445  NAXSFIKKSA  474
            NA +FI KS 
Sbjct  119  NASTFINKSP  128



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 121/153 (79%), Gaps = 4/153 (3%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +S + AK+ RLFGR++
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVH VLGGGK ADVFLWRN KIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LF
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLF  119

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI KS P IPE+H+PEEP LQ ASAL
Sbjct  120  LWSNAHTFIHKSPPRIPEIHLPEEPFLQVASAL  152



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE   KEEESLVE + DKI          S    +   + T+ + AK+ RLFGR++PVH
Sbjct  1    MAE--HKEEESLVESVMDKISDKLHGRGGSSSSSSDSDGERTADLKAKIYRLFGREKPVH  58

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             VLGGGK AD+FLWRN KISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWS
Sbjct  59   SVLGGGKPADLFLWRNKKISVGVLTGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWS  118

Query  445  NAXSFIKKSA  474
            NA +FI KS 
Sbjct  119  NASTFINKSP  128



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekee----eekkkttssMDAKVRRLFGRQ  252
            MAE +    ESL+EKI +K H  DSSSS    ++              + AK+ RLFGR+
Sbjct  1    MAEHEESVAESLLEKITEKFHGGDSSSSDSDGEKSSVVDSSAPSAAEVVKAKIYRLFGRE  60

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWRN K+S   LGGATAIW+LFE++EYHLLT VCH LIL+LA++
Sbjct  61   KPVHKVLGGGKPADVFLWRNKKVSAATLGGATAIWVLFELMEYHLLTFVCHSLILSLAIM  120

Query  433  FLWSNAXSFIKKSA  474
            FLWSNA +FI KS 
Sbjct  121  FLWSNASTFINKSP  134



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 119/160 (74%), Gaps = 7/160 (4%)
 Frame = +1

Query  76   ESAMAEEDRKEEESLVEKIADKIH-------RHdsssssdsekeeeekkkttssMDAKVR  234
            E    E+  + EES++EKI + +H          SSS SD +K+       TSS  +KVR
Sbjct  5    EERKVEKSDEHEESVMEKITETLHLSNNNHHSSSSSSDSDDDKKTTSSPPVTSSFKSKVR  64

Query  235  RLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  414
            RLFGR++PVHKV GGGK ADVFLWRN KIS G LGGATAIW+LFEV+EYH LT +CHGLI
Sbjct  65   RLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHGLI  124

Query  415  LALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            +ALA LFLWSNA +FI KSAPHIPEVHIPE+PVL+FA+ L
Sbjct  125  VALAGLFLWSNASAFIHKSAPHIPEVHIPEKPVLEFATGL  164



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 124/154 (81%), Gaps = 4/154 (3%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeee-ekkkttssMDAKVRRLFGRQ  252
            MAEE    +   ES++EKI++KIH HDSSSSSDS+ + + EK  + SS+ AK+ RLFGR+
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +P+H VLGGGK ADVFLWRN KIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVL
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVL  120

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSN  +FI K+ P IP+VH+PEEP LQ ASAL
Sbjct  121  FLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASAL  154



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 123/153 (80%), Gaps = 4/153 (3%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MA+E   ++   ES++EKI++KIH +DSSSSSDS+ + E+    +S + AK+ RLFGR++
Sbjct  1    MADESESKQSAVESMMEKISEKIHGNDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVH VLGGGK ADVFLWRN KIS GVLGGATAIW+LFE++EYHLLT +CH  IL LA+LF
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHISILCLALLF  119

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI KS P IPE+H+PEEP LQ ASAL
Sbjct  120  LWSNAHTFIHKSPPRIPEIHLPEEPFLQVASAL  152



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 118/153 (77%), Gaps = 10/153 (7%)
 Frame = +1

Query  106  EEESLVEKIADKIH----------RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            ++ESL++KI++K+H             SS S D +K+       TSS  +KVRRLFGR++
Sbjct  14   QDESLMDKISEKLHFSNHSSSPAPASSSSDSDDEKKKPTSPAPETSSFGSKVRRLFGRER  73

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKV GGGK ADVFLWRN KIS G LGGATAIW+LFEV+EYHLLT +CHGL++ALA LF
Sbjct  74   PVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMVALAGLF  133

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI KSAPHIPEVHIPE+PVL FASAL
Sbjct  134  LWSNASTFIHKSAPHIPEVHIPEKPVLAFASAL  166



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   147 bits (371),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 4/153 (3%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +  + AK+ RLFGR++
Sbjct  1    MAEESESKQSTVESVMEKISGKIHGHDSSSSSDSDSDHEKPASPSP-VKAKIYRLFGRER  59

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVH VLGGGK ADVFLWRN KIS GVLGGATAIW+LFE++EY+LLT VCH  IL+LA++F
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYNLLTLVCHISILSLALMF  119

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI KS P IPEVH+PEEP LQ A+AL
Sbjct  120  LWSNAHTFIHKSPPRIPEVHLPEEPFLQVAAAL  152



>gb|KJB06453.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=288

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 124/154 (81%), Gaps = 4/154 (3%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeee-ekkkttssMDAKVRRLFGRQ  252
            MAEE    +   ES++EKI++KIH HDSSSSSDS+ + + EK  + SS+ AK+ RLFGR+
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +P+H VLGGGK ADVFLWRN KIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVL
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVL  120

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSN  +FI K+ P IP+VH+PEEP LQ ASAL
Sbjct  121  FLWSNVHTFIHKTPPRIPQVHLPEEPFLQIASAL  154



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   146 bits (369),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            +EE   + ESL+EKIA+K+H     SSS S+ + E+ + + SS+ AK+ RLFGR++PVHK
Sbjct  5    SEEASSKPESLMEKIAEKLH--GDDSSSSSDSDNEKSESSASSVKAKIYRLFGREEPVHK  62

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLGGGK ADVFLWRN KIS GVLGGATA+W+LFE+L+YHLLT V H L+L+LA+LFLWSN
Sbjct  63   VLGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLDYHLLTLVGHCLVLSLAILFLWSN  122

Query  448  AXSFIKK  468
            A +FI K
Sbjct  123  ASTFINK  129



>gb|KJB24636.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=130

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 103/131 (79%), Gaps = 4/131 (3%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +S + AK+ RLFGR++
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVH VLGGGK ADVFLWRN KIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LF
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLF  119

Query  436  LWSNAXSFIKK  468
            LWSNA +FI K
Sbjct  120  LWSNAHTFIHK  130



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 115/153 (75%), Gaps = 3/153 (2%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MA+  ++EE   ESL++K+ DK+H HDSSSSS S    +      + +  KV RLFGR++
Sbjct  1    MADHHKEEENKGESLIDKVTDKMHAHDSSSSSSSSSSSDSDDDRKARLKTKVYRLFGREK  60

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHK+LGGG+ ADV LWR+ K+S GVLGGA A+W LF+VLEYH LT +CHGLIL L  +F
Sbjct  61   PVHKILGGGQGADVLLWRDKKVSAGVLGGAAALWFLFDVLEYHFLTLICHGLILGLVAMF  120

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            L SNA +F+KK+ P IPEV +PEEPVL+FASAL
Sbjct  121  LLSNASTFVKKAPPRIPEVVLPEEPVLKFASAL  153



>gb|KJB37517.1| hypothetical protein B456_006G208500 [Gossypium raimondii]
Length=210

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 111/150 (74%), Gaps = 6/150 (4%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            M E + K EESL+ K+A+KIH HDSSS SD +K  E        + AKV RLFGR++ VH
Sbjct  1    MGEHEEKHEESLMVKLAEKIHGHDSSSDSDIDKPSESS------IKAKVFRLFGRERSVH  54

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             V GGGK AD FLWRN KIS GVLG AT IW+LFE+LEYHLLT VCH LI AL +LFLWS
Sbjct  55   HVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLWS  114

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FI KS   IPEVHIP++PV++FA AL
Sbjct  115  NAYAFINKSPLCIPEVHIPKDPVIEFAEAL  144



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 97/130 (75%), Gaps = 6/130 (5%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE   KEEES+++ I+DK+H         S    +   + T+++ AK+ RLFGR++PVH
Sbjct  1    MAE--HKEEESVMDTISDKLHG----RGGSSSSSLDSDGERTAAVKAKIYRLFGREKPVH  54

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             VLGGGK AD+FLWRN KISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWS
Sbjct  55   SVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCVILTLAILFLWS  114

Query  445  NAXSFIKKSA  474
            NA +FI KS 
Sbjct  115  NASTFINKSP  124



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 122/156 (78%), Gaps = 4/156 (3%)
 Frame = +1

Query  76   ESAMAEE---DRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  246
            ESA+A E   +  E ESL++KI++KIH H S SSS S+ E+E+K  + SS+ AKV RLFG
Sbjct  9    ESALATEPAVEVVERESLLDKISEKIH-HGSDSSSSSDDEDEKKASSPSSLKAKVYRLFG  67

Query  247  RQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  426
            R++PVHKVLGGGK AD+F+WRN K+S  VLGG TA+W+LFE+ EYHLLT +CH LI  +A
Sbjct  68   REKPVHKVLGGGKPADIFMWRNKKMSASVLGGITAVWVLFELAEYHLLTLLCHVLIAVIA  127

Query  427  VLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VLFLWSNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  128  VLFLWSNASMFIHKSPPKIPEVHIPEEPILQLASGL  163



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 116/153 (76%), Gaps = 4/153 (3%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE + EE   ES++EKIA+KI R     SS S   ++EKK + SS+ AK+ RLFGR+ 
Sbjct  1    MAEEHKHEESAAESIIEKIAEKI-RGYDDGSSSSSDSDDEKKASLSSLKAKIYRLFGREN  59

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVH VLGGGK AD+ LWRN K+S GVLG ATA W+LFE+LEYHLL+ VCH  ILALAVLF
Sbjct  60   PVHNVLGGGKPADIVLWRNKKVSGGVLGAATAAWVLFELLEYHLLSLVCHSSILALAVLF  119

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI K+ P IPEVHIPEE VLQ AS L
Sbjct  120  LWSNASTFIHKTPPRIPEVHIPEEHVLQLASGL  152



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 118/153 (77%), Gaps = 4/153 (3%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE + EE   ES++EKIA+KI  HD  SSS S+ ++E+K   +S + AK+ RLFGR++
Sbjct  1    MAEEHKHEESTAESIMEKIAEKIRGHDDGSSSSSDSDDEKKSSPSS-LKAKIYRLFGREK  59

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVH VLGGGK AD+FLWRN K+S G LG ATA W+LFE+LEYHLLT VCH  I ALAVLF
Sbjct  60   PVHSVLGGGKPADIFLWRNKKVSGGALGVATAAWVLFELLEYHLLTLVCHSSIFALAVLF  119

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI K+ P IP VHIPEEPV+Q AS L
Sbjct  120  LWSNASTFIHKTPPRIPHVHIPEEPVIQLASGL  152



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 97/129 (75%), Gaps = 3/129 (2%)
 Frame = +1

Query  97   DRKEEESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            D KEE+S+++KI++K H      SS S D +K+       T +M AK+ RLFGR++PVH 
Sbjct  3    DHKEEQSVMDKISEKFHGGDSSSSSDSDDEKKKGSSSASATEAMKAKIYRLFGRERPVHS  62

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLGGGK AD+ LWRN KIS GVL GATAIW+LFEV+EYHLLT VCH LI++LA+LFLWSN
Sbjct  63   VLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSN  122

Query  448  AXSFIKKSA  474
            A SFI KS 
Sbjct  123  ASSFINKSP  131



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 115/148 (78%), Gaps = 3/148 (2%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            +E+ K  ES +EKIA+KIH H SSSSS S   ++EK  +   + +KV RLFGR++PVHKV
Sbjct  6    KEEEKHGESFMEKIAEKIHGHGSSSSSSSSDSDDEKTAS---LKSKVYRLFGREKPVHKV  62

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGG+ AD+ LW++ K+S GVLGG TAIW+LF++LEYHLL  VCHGLIL L  LFL+SNA
Sbjct  63   LGGGQPADLLLWKDKKVSGGVLGGVTAIWVLFDLLEYHLLALVCHGLILGLVGLFLYSNA  122

Query  451  XSFIKKSAphipevhipeepvLQFASAL  534
             +FIKKS P IP V IPEEPVL FASAL
Sbjct  123  STFIKKSPPKIPVVSIPEEPVLNFASAL  150



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 112/150 (75%), Gaps = 6/150 (4%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            M E + K E SL+EK+A+KIH HDSSS SD++K  E        + AKV RLFGR++ VH
Sbjct  1    MGEHEEKHEGSLMEKLAEKIHGHDSSSDSDNDKPSESS------IKAKVFRLFGRERSVH  54

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             V GGGK AD FLWRN KIS GVLG AT IW+LFE+LEYHLLT VCH LI AL +LFLWS
Sbjct  55   HVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLWS  114

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FI KS   IPEVHIP++PV++FA AL
Sbjct  115  NAYAFINKSPLCIPEVHIPKDPVIEFAEAL  144



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 126/156 (81%), Gaps = 6/156 (4%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsek---eeeekkkttssMDAKVRRLFG  246
            MA+E   EE   ESL++KI++KIH HDSSSSSDS+     + +   + SS+ +K+ RLFG
Sbjct  1    MADEHHHEESKGESLMDKISEKIHGHDSSSSSDSDNDEKLKPKSPSSPSSIKSKIYRLFG  60

Query  247  RQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  426
            R++PVH VLGGGK AD+FLWRN K+S GVLG ATA+W+LFE++EYHLLT +CHG ILALA
Sbjct  61   REKPVHHVLGGGKPADIFLWRNKKVSAGVLGFATAVWVLFELIEYHLLTLICHGFILALA  120

Query  427  VLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            +LFLWSNA +FI KS PHIPEVHIPEEPVLQ A+AL
Sbjct  121  ILFLWSNASTFINKSPPHIPEVHIPEEPVLQVAAAL  156



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 111/141 (79%), Gaps = 3/141 (2%)
 Frame = +1

Query  112  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  291
            ES+++KI DK+H     SSS   ++E+EK     ++ AK+ RLFGR++PVHKVLGGGK A
Sbjct  13   ESVMDKINDKLHH---DSSSSDSEDEKEKISPVEAVKAKIYRLFGREKPVHKVLGGGKPA  69

Query  292  DVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKS  471
            DVFLWR+ KI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSNA +FI KS
Sbjct  70   DVFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTFINKS  129

Query  472  AphipevhipeepvLQFASAL  534
             P IPEV +PE+ VL  ASAL
Sbjct  130  PPQIPEVILPEDIVLGVASAL  150



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   145 bits (365),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 121/164 (74%), Gaps = 15/164 (9%)
 Frame = +1

Query  85   MAEEDRKEE--------------ESLVEKIADKIHRHdsssssdsekeeeekkkttssMD  222
            MAEE + EE              ESL++KI++KIH H   SSS S+ E+E+K  + SS+ 
Sbjct  1    MAEEQKHEETAAAPEPAVEVLERESLLDKISEKIH-HGGDSSSSSDDEDEKKASSLSSLQ  59

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
            AKV RLFGR++PVHKVLGGGK AD+F+WRN K+S GVLGG TA+W+LFE+++YHLLT  C
Sbjct  60   AKVYRLFGREKPVHKVLGGGKPADIFMWRNKKMSGGVLGGITAVWVLFELMQYHLLTLFC  119

Query  403  HGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            H LI+ LAVLFLWSNA  FI KS P IPEVHIPEE +LQ AS L
Sbjct  120  HILIVVLAVLFLWSNASIFINKSPPKIPEVHIPEEHILQLASGL  163



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 113/153 (74%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAE    EE   ESL+EKI+ KI       SS S   + EK   + S+ +KV RLFGR++
Sbjct  1    MAEHHEHEEVKGESLLEKISGKI---HDHDSSSSSDSDNEKTSASDSLKSKVFRLFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            P+H VLGGGK ADVFLWRN KIS   LG ATAIW+LFE+LEYHLLT VCH LIL LAVLF
Sbjct  58   PIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILGLAVLF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI KS P IP+VHIPE+PVL+FASAL
Sbjct  118  LWSNASTFINKSPPKIPQVHIPEKPVLEFASAL  150



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  + ++S VE + +KIH HDSSSSSDS+ + E+     S + AK+ RLFGR++P+H
Sbjct  1    MAEET-ESKQSAVESVMEKIHGHDSSSSSDSDSDHEKPASPIS-VKAKIYRLFGRERPLH  58

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             VLGGGK ADVFLWRN KIS GVLGGATAIW+LFE++EYHLLT +CH  IL LAVLFLWS
Sbjct  59   HVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILCLAVLFLWS  118

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            N  +FI K+ P IP+VH+PEEP LQ ASAL
Sbjct  119  NVHTFIHKTPPRIPQVHLPEEPFLQIASAL  148



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   144 bits (363),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 111/157 (71%), Gaps = 8/157 (5%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIH--------RHdsssssdsekeeeekkkttssMDAKVRRLF  243
            AE    + ESL+EKIADK H          D+ +     K E E +    ++  KV RLF
Sbjct  5    AENSDPKGESLMEKIADKFHGDDSSSSSESDTETKKPVVKSEVEAEPEPETLKNKVWRLF  64

Query  244  GRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  423
            GR++PVHKV GGGK ADVFLWRN KIS  VLGGATAIW+LFE+LEYHLLT +CH LI+ L
Sbjct  65   GREKPVHKVFGGGKPADVFLWRNKKISGTVLGGATAIWVLFELLEYHLLTLICHILIITL  124

Query  424  AVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            AVLFLWSNA +FI K  PHIPEVH+PE P+LQ ASAL
Sbjct  125  AVLFLWSNATTFINKKPPHIPEVHLPEGPILQVASAL  161



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 111/141 (79%), Gaps = 3/141 (2%)
 Frame = +1

Query  112  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  291
            ES+++KI DK+H     SSS   ++E+EK     ++ AK+ RLFGR++PVHKVLGGGK A
Sbjct  13   ESVMDKINDKLHH---DSSSSDSEDEKEKISPVEAVKAKIYRLFGRERPVHKVLGGGKPA  69

Query  292  DVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKS  471
            D+FLWR+ KI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSNA +FI KS
Sbjct  70   DIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTFINKS  129

Query  472  AphipevhipeepvLQFASAL  534
             P IPEV +PE+ VL  ASAL
Sbjct  130  PPQIPEVILPEDIVLGVASAL  150



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 99/119 (83%), Gaps = 2/119 (2%)
 Frame = +1

Query  118  LVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQADV  297
            L+EKIADK+H HDSSSSSDS+ E+ E   ++  + AK+ RLFGR++PVHKVLGGGK ADV
Sbjct  15   LMEKIADKLHGHDSSSSSDSDNEKSEPSASS--VKAKIYRLFGREKPVHKVLGGGKPADV  72

Query  298  FLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKSA  474
             LWRN KIS GVLGGATA+W+LFE+LEYHLLT V H LIL+LA+LFLWSNA +FI K+ 
Sbjct  73   LLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVGHCLILSLAILFLWSNASTFISKTP  131



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +1

Query  85   MAEEDRKE-EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            MAE++ +   ESL+EKI +K H  DSSSSSDS+ E+     ++  + +K+ RLFGR++PV
Sbjct  1    MAEKNEESVGESLMEKITEKFHHEDSSSSSDSDNEKSLPSSSS--VQSKIYRLFGREKPV  58

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            H VLGGGK AD+FLWRN KIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLW
Sbjct  59   HTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLW  118

Query  442  SNAXSFIKKSA  474
            SNA +FI KS 
Sbjct  119  SNATTFINKSP  129



>ref|XP_006374287.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52084.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=193

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = +1

Query  76   ESAMAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  252
            E  MAE E  +E E +VE +ADKI    +     S    +     + ++ +K+ RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWRN KIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVL
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVL  125

Query  433  FLWSNAXSFIKKSA  474
            FLWSNA +F+ KS 
Sbjct  126  FLWSNASNFLNKSP  139



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 111/154 (72%), Gaps = 6/154 (4%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIH------RHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  252
            E    + ESL+EKIADK H        +S + +     + E +  T ++  KV RLFGR+
Sbjct  6    ENSDPKGESLLEKIADKFHGDDSSSSSESDTETKKPAVKSEVEPETETLKNKVWRLFGRE  65

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKV GGGK ADVFLWRN KIS  V+GGATAIW+LFE+LEYHLLT +CH LI+ LAVL
Sbjct  66   KPVHKVFGGGKPADVFLWRNKKISATVIGGATAIWVLFELLEYHLLTLICHILIITLAVL  125

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSNA +FI K  PHIPEVH+PE P+LQ ASAL
Sbjct  126  FLWSNATTFINKKPPHIPEVHLPEGPILQVASAL  159



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 108/148 (73%), Gaps = 2/148 (1%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            E    +EESL+EKIADKIH     SSS   + +       SS+ AK+ RLFGR++PVH V
Sbjct  6    EHSEHKEESLMEKIADKIH--FDRSSSSDSEVKPAAAPEASSVKAKIWRLFGREKPVHHV  63

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
             GGGK ADVFLWRN KIS  VLGGATAIW+LFE+LEY L+  VCH LI  LAVLFLWSNA
Sbjct  64   FGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLWSNA  123

Query  451  XSFIKKSAphipevhipeepvLQFASAL  534
             +FI K  PHIPEV +PEEP+L+ ASAL
Sbjct  124  TTFINKKRPHIPEVQLPEEPILEIASAL  151



>ref|XP_006374288.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52085.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=199

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = +1

Query  76   ESAMAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  252
            E  MAE E  +E E +VE +ADKI    +     S    +     + ++ +K+ RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWRN KIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVL
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVL  125

Query  433  FLWSNAXSFIKKSA  474
            FLWSNA +F+ KS 
Sbjct  126  FLWSNASNFLNKSP  139



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 103/128 (80%), Gaps = 2/128 (2%)
 Frame = +1

Query  97   DRKEEESLVEKIADKIHRHdsssssdsekeeeekkkt--tssMDAKVRRLFGRQQPVHKV  270
            + KEE+S++EK+++K+H   SSSSSDS+ +++    +   ++M AK+ RLFGR++PVH V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSSAAAMKAKIYRLFGRERPVHSV  62

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGGK AD+ LWRN KIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  451  XSFIKKSA  474
             +FI KS 
Sbjct  123  STFIHKSP  130



>ref|XP_009626481.1| PREDICTED: reticulon-like protein B5 isoform X2 [Nicotiana tomentosiformis]
Length=192

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 97/127 (76%), Gaps = 3/127 (2%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            A E     ES+++KI DK+H     SSS   ++E+EK     ++ AK+ RLFGR++PVHK
Sbjct  5    AGEHESVVESVMDKINDKLHH---DSSSSDSEDEKEKISPVEAVKAKIYRLFGRERPVHK  61

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLGGGK AD+FLWR+ KI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSN
Sbjct  62   VLGGGKPADIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSN  121

Query  448  AXSFIKK  468
            A +FI K
Sbjct  122  ASTFINK  128



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 113/142 (80%), Gaps = 3/142 (2%)
 Frame = +1

Query  109  EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQ  288
            EE+LVEK+A++I    SSSSSDS+ ++         + +KV RLFGR++P+H VLG GK 
Sbjct  5    EETLVEKVAEEIQGDASSSSSDSDDDKPFHADA---LKSKVYRLFGREKPIHHVLGAGKP  61

Query  289  ADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKK  468
            ADVFLWR+ KIS GVLGGATA+WILFE+LEYHL+T +CH LIL+LA+LFLWSNA +FI K
Sbjct  62   ADVFLWRDKKISAGVLGGATALWILFEMLEYHLITLLCHTLILSLAILFLWSNASTFINK  121

Query  469  SAphipevhipeepvLQFASAL  534
            S P+IPEV +PE+ VL+ ASAL
Sbjct  122  SPPNIPEVVLPEKCVLEVASAL  143



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 112/157 (71%), Gaps = 9/157 (6%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIH---------RHdsssssdsekeeeekkkttssMDAKVRRLF  243
            E    + ESL+EKIADK H           D+ +   + KEE       SS+  KV RLF
Sbjct  6    ENSDPKGESLMEKIADKFHGGDDSSSSSDSDTETKKPAAKEEVVAAAEPSSVKDKVWRLF  65

Query  244  GRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  423
            GR++PVHKV GGGK ADVFLWRN KIS  VLGGATAIW+LFE+LEYHLLT +CH LI++L
Sbjct  66   GREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISL  125

Query  424  AVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            AVLFLWSNA +FI K  PHIPE+H+P++P LQ ASAL
Sbjct  126  AVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASAL  162



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + A V RLFGRQ+PVHKV GGGK ADVFLWRN KIS GVLGGATA W+LFE+LEYHLLT 
Sbjct  45   VTAAVYRLFGRQKPVHKVFGGGKPADVFLWRNKKISAGVLGGATATWVLFELLEYHLLTL  104

Query  397  VCHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VCH LI++LAVLFL+SNA +F+ K+ P IPEV+IPE+PVLQFASAL
Sbjct  105  VCHCLIVSLAVLFLYSNAIAFMHKTPPRIPEVYIPEDPVLQFASAL  150



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 2/150 (1%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE+     ES++ KI++KIH H+SSSS      E++   + S  D K+ RLFGR++PVH
Sbjct  1    MAEQSENPIESVMGKISEKIH-HESSSSDSESDSEKKSYPSESVKD-KIWRLFGREKPVH  58

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            +VLGGGK ADVFLWRN K+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWS
Sbjct  59   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWS  118

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA SFI KS P IP+VH+PEEPVLQ ASAL
Sbjct  119  NAHSFINKSPPRIPQVHLPEEPVLQVASAL  148



>ref|XP_010439153.1| PREDICTED: reticulon-like protein B1 isoform X2 [Camelina sativa]
Length=199

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 121/164 (74%), Gaps = 11/164 (7%)
 Frame = +1

Query  76   ESAMAEE---DRKEEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMD  222
            ES +A E   +  E ESL++KI++KIH           S    D +K++++K  + SSM 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKKKKKPSSPSSMQ  68

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
            +KV RLFGR++PVHKVLGGGK AD+F+W+N K+S GVLGGATA W+LFE++EYHLLT +C
Sbjct  69   SKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLIC  128

Query  403  HGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            H +I+ LAVLFLWSNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  129  HVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  172



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 105/131 (80%), Gaps = 3/131 (2%)
 Frame = +1

Query  85   MAEEDRKE-EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            MAE++ +   ESL+EKI +K H  DSSSSSDS+ E+ +   ++  + +K+ RLFGR++PV
Sbjct  1    MAEKNEESVGESLMEKITEKFHHEDSSSSSDSDNEKSQPSSSS--VQSKIYRLFGREKPV  58

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            H VLGGGK AD+FLWRN KIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLW
Sbjct  59   HTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLW  118

Query  442  SNAXSFIKKSA  474
            SNA +FI KS 
Sbjct  119  SNATTFINKSP  129



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = +1

Query  76   ESAMAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  252
            E  MAE E  +E E +VE +ADKI    +     S    +     + ++ +K+ RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWRN KIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVL
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVL  125

Query  433  FLWSNAXSFIKKSA  474
            FLWSNA +F+ KS 
Sbjct  126  FLWSNASNFLNKSP  139



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 117/153 (76%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + AK+ RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI K+ P IPEVH+PEE  L  AS+L
Sbjct  118  LWSNAHTFINKTPPQIPEVHVPEEAFLTIASSL  150



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 2/150 (1%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE+     ES++ KI++KIH H+SSSS      E++   + S  D K+ RLFGR++PVH
Sbjct  1    MAEQSEDPIESVMGKISEKIH-HESSSSDSESDSEKKSYPSESVKD-KIWRLFGREKPVH  58

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            +VLGGGK ADVFLWRN K+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWS
Sbjct  59   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWS  118

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA SFI KS P IP+VH+PEEPVLQ ASAL
Sbjct  119  NAHSFINKSPPRIPQVHLPEEPVLQVASAL  148



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 114/151 (75%), Gaps = 1/151 (1%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeee-ekkkttssMDAKVRRLFGRQQPV  261
            MAE      ES++EKI++ IH HDSSSSS     +  +K  + SS+ AK+ RLFGR++PV
Sbjct  1    MAEHHENPIESVMEKISETIHAHDSSSSSSDSDSDSEKKPTSPSSVKAKIFRLFGRERPV  60

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            H VLGGGK ADV LWRN KIS  VLG ATAIW+LFE++EYHLLT  CH LIL+LAVLFLW
Sbjct  61   HHVLGGGKPADVLLWRNKKISASVLGVATAIWVLFELIEYHLLTLACHILILSLAVLFLW  120

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SNA +FI K+ P IP++H+PEEP L  ASAL
Sbjct  121  SNAHTFINKTPPRIPQIHLPEEPFLLVASAL  151



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 110/141 (78%), Gaps = 3/141 (2%)
 Frame = +1

Query  112  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  291
            ESL++KIA+KIH HD SSSS     ++++  +   +  KV RLFGR++PVH VLGGGK A
Sbjct  73   ESLLDKIAEKIHGHDDSSSSSDSDSDKKESSS---IKEKVFRLFGREKPVHSVLGGGKPA  129

Query  292  DVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKS  471
            DV LWRN KIS GVLG ATAIWI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI K+
Sbjct  130  DVLLWRNKKISAGVLGVATAIWIFFELLEYHLLTLVCHISILLLAVLFLWSNAHTFIHKA  189

Query  472  AphipevhipeepvLQFASAL  534
             P IP VHIPEEP+LQFASAL
Sbjct  190  PPRIPVVHIPEEPILQFASAL  210



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   142 bits (357),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 106/140 (76%), Gaps = 5/140 (4%)
 Frame = +1

Query  115  SLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQAD  294
            SL+E+IA+KI   DSSSS     +  E       + AKV RLFGR++PVH VLGGGK AD
Sbjct  12   SLMERIAEKIQGRDSSSSDSDNDKPSESS-----IKAKVFRLFGREKPVHHVLGGGKPAD  66

Query  295  VFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKSA  474
            +FLWRN KIS G LG AT IWILFE+LEYHLLT VCH LILALAVLFLWSNA +FI KS 
Sbjct  67   IFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALAVLFLWSNAATFINKSP  126

Query  475  phipevhipeepvLQFASAL  534
            P IPEV IP++PV++FA AL
Sbjct  127  PRIPEVQIPKDPVMEFAQAL  146



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 111/159 (70%), Gaps = 11/159 (7%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIH-----------RHdsssssdsekeeeekkkttssMDAKVRR  237
            E    + ESL+EKIADK H             ++   +  E+     +   SS+  KV R
Sbjct  6    ENSDPKGESLMEKIADKFHGGDDSSSSSDSDTETKKPAAKEEVVAAAEAEPSSVKDKVWR  65

Query  238  LFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLIL  417
            LFGR++PVHKV GGGK ADVFLWRN KIS  VLGGATAIW+LFE+LEYHLLT +CH LI+
Sbjct  66   LFGREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILII  125

Query  418  ALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            +LAVLFLWSNA +FI K  PHIPE+H+P++P LQ ASAL
Sbjct  126  SLAVLFLWSNATTFINKKPPHIPEIHLPQDPFLQVASAL  164



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 109/151 (72%), Gaps = 5/151 (3%)
 Frame = +1

Query  97   DRKEEESLVEKIADKI-----HRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            + KEEESL+EKI DKI         S S ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIWRLFGREKPV  68

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            H+V GGGK ADVFLWRN KIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SNA +FI K  PHIPE H+ EEP+L+ ASAL
Sbjct  129  SNATTFINKKRPHIPEFHLLEEPILEIASAL  159



>ref|XP_011073415.1| PREDICTED: reticulon-like protein B1 isoform X2 [Sesamum indicum]
Length=172

 Score =   139 bits (350),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 9/148 (6%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            +E+ K++ESL+EKIADK+H HDSSSSS S   +++K  +   + AKV RLFGR++PVH+V
Sbjct  6    KEEEKKDESLIEKIADKVHGHDSSSSSSSSDSDDDKTSS---LKAKVYRLFGREKPVHRV  62

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGGK AD+FLW          GGATAIW+LF+VLEYHLLT VCHGLI+ LA+LFLWS+ 
Sbjct  63   LGGGKPADIFLWXX------XXGGATAIWVLFDVLEYHLLTLVCHGLIVGLALLFLWSSI  116

Query  451  XSFIKKSAphipevhipeepvLQFASAL  534
             +FI KS P IPEV IPEEP L+FASAL
Sbjct  117  MTFINKSPPRIPEVSIPEEPALKFASAL  144



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 92/131 (70%), Gaps = 5/131 (4%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIH-RHdsssssdsekeeee-kkkttssMDAKVRRLFGRQQP  258
            MAE     EESL+EKI +K H RH SS     +++          ++ AK+ RLFGR++P
Sbjct  1    MAEH---REESLLEKITEKFHGRHSSSVVDSDDEKSSRGPSAAAEAVKAKIYRLFGREKP  57

Query  259  VHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  438
            VHKVLGGGK ADVFLWRN K+S    G  TAIW+ FE++EYHL+T VCHGLIL+LA++FL
Sbjct  58   VHKVLGGGKPADVFLWRNKKVSASTFGAVTAIWVFFELMEYHLITLVCHGLILSLAIIFL  117

Query  439  WSNAXSFIKKS  471
            W NA +FI KS
Sbjct  118  WCNATTFISKS  128



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +1

Query  85   MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            MAE E  +E E +VE +ADKI    +     S    +     + ++ +K+ RLFGR++PV
Sbjct  1    MAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGREKPV  59

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            HKVLGGGK ADVFLWRN KIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVLFLW
Sbjct  60   HKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLW  119

Query  442  SNAXSFIKKSA  474
            SNA +F+ KS 
Sbjct  120  SNASNFLNKSP  130



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 109/151 (72%), Gaps = 5/151 (3%)
 Frame = +1

Query  97   DRKEEESLVEKIADKI-----HRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            + KEEESL+EKI DKI         S S ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIWRLFGREKPV  68

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            H+V GGGK ADVFLWRN KIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SNA +FI K  PHIPE H+ EEP+L+ ASAL
Sbjct  129  SNATTFINKKRPHIPEFHLLEEPILEIASAL  159



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 116/153 (76%), Gaps = 8/153 (5%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    E+SL++KI++KIH HDSSS S+ EK +         + AK+ RLFGR++
Sbjct  1    MAEEIEKSMPAEQSLMDKISEKIHHHDSSSDSEYEKPDSPSA-----VKAKIYRLFGREK  55

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  56   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLF  115

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FIKKS P IPE+H+PEEP L  AS+L
Sbjct  116  LWSNAHTFIKKSPPQIPEIHVPEEPFLLIASSL  148



>emb|CDY42012.1| BnaC04g00900D [Brassica napus]
Length=251

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 116/153 (76%), Gaps = 8/153 (5%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    E+SL++KI++KIH HDSSS S+ EK +         + AK+ RLFGR++
Sbjct  1    MAEEIEKSMPAEQSLMDKISEKIHHHDSSSDSEYEKPDSPSA-----VKAKIYRLFGREK  55

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  56   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLF  115

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FIKKS P IPE+H+PEEP L  AS+L
Sbjct  116  LWSNAHTFIKKSPPQIPEIHVPEEPFLLIASSL  148



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 121/163 (74%), Gaps = 10/163 (6%)
 Frame = +1

Query  76   ESAMAEE---DRKEEESLVEKIADKIHR-------HdsssssdsekeeeekkkttssMDA  225
            ES +A E   +  E ESL++KI++KIH          SS   D +K++ +K  + SSM +
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKTKKPSSPSSMQS  68

Query  226  KVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCH  405
            KV RLFGR++PVHKVLGGGK AD+F+W+N K+S GVLGGATA W+LFE++EYHLLT +CH
Sbjct  69   KVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICH  128

Query  406  GLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
             +I+ LAVLFLWSNA  FI KS P IPE+HIPEEP+LQ AS L
Sbjct  129  VMIVVLAVLFLWSNATMFINKSPPKIPEIHIPEEPILQLASGL  171



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 2/149 (1%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            A E     ES++EKI +K+H H+SSSS   +++E+        + AK+ RLFGR++PVHK
Sbjct  5    AGEHEPVVESVMEKINEKLHDHNSSSSDSEDEKEKISSVDA--VKAKIYRLFGRERPVHK  62

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLGGGK AD+FLWR+ KI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSN
Sbjct  63   VLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSN  122

Query  448  AXSFIKKSAphipevhipeepvLQFASAL  534
            A +FI KS P IP+V +PE+ VL  A+AL
Sbjct  123  ASTFINKSPPQIPDVILPEDIVLGVAAAL  151



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 96/132 (73%), Gaps = 6/132 (5%)
 Frame = +1

Query  97   DRKEE---ESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  258
            D KEE   ES+++KI +K H      SSS SD EK+         +M AK+ RLFGR++P
Sbjct  3    DHKEEPVPESVMDKITEKFHGGDSSSSSSDSDDEKKGSSLASAAEAMKAKIYRLFGRERP  62

Query  259  VHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  438
            VH VLGGGK AD+ LWRN KIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LA+LFL
Sbjct  63   VHSVLGGGKPADLILWRNRKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAILFL  122

Query  439  WSNAXSFIKKSA  474
            WSNA +FI KS 
Sbjct  123  WSNASTFINKSP  134



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 120/164 (73%), Gaps = 11/164 (7%)
 Frame = +1

Query  76   ESAMAEE---DRKEEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMD  222
            ES +A E   +  E ESL++KI++KIH           S    D +K++ +K  + SSM 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKKTKKPSSPSSMQ  68

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
            +KV RLFGR++PVHKVLGGGK AD+F+W+N K+S GVLGGATA W+LFE++EYHLLT +C
Sbjct  69   SKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLIC  128

Query  403  HGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            H +I+ LAVLFLWSNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  129  HVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  172



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 121/164 (74%), Gaps = 11/164 (7%)
 Frame = +1

Query  76   ESAMAEE---DRKEEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMD  222
            ES +A E   +  E ESL++KI++KIH           S    D +K++++K  + SSM 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKKKKKPSSPSSMQ  68

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
            +KV RLFGR++PVHKVLGGGK AD+F+W+N K+S GVLGGATA W+LFE++EYHLLT +C
Sbjct  69   SKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLIC  128

Query  403  HGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            H +I+ LAVLFLWSNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  129  HVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  172



>ref|XP_010462752.1| PREDICTED: reticulon-like protein B5 isoform X2 [Camelina sativa]
Length=130

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 101/132 (77%), Gaps = 7/132 (5%)
 Frame = +1

Query  85   MAEEDRK----EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  252
            MAEE  K    EE SL+EKI++KIH HDSSSSS+SE E+ +       + AK+ R+FGR+
Sbjct  1    MAEEIEKSVPVEEPSLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGRE  57

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  L
Sbjct  58   KPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGL  117

Query  433  FLWSNAXSFIKK  468
            FLWSNA +FI K
Sbjct  118  FLWSNAHTFINK  129



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + AK+ RLFGR++PVH VLGGGK AD+FLWRN KIS GVLG ATAIW+LFE++EYHLLT 
Sbjct  44   VKAKIYRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGVATAIWVLFELMEYHLLTL  103

Query  397  VCHGLILALAVLFLWSNAXSFIKKSA  474
            VCH LIL+LA+LFLWSNA +FI KS+
Sbjct  104  VCHCLILSLAILFLWSNASTFINKSS  129



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 111/153 (73%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAE    EE   ESL+EKI+ KI       SS S   + +K   T S  + V RLFGR++
Sbjct  1    MAEHHEHEEVKGESLLEKISGKI---HDHDSSSSSDSDNDKTSATDSFKSNVFRLFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            P+H VLGGGK ADVFLWRN KIS   LG ATAIW+LFE+LEYHLLT VCH LILALA LF
Sbjct  58   PIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI KS P IP+VHIPEEPVL+FASAL
Sbjct  118  LWSNASTFINKSPPKIPQVHIPEEPVLKFASAL  150



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 119/154 (77%), Gaps = 4/154 (3%)
 Frame = +1

Query  85   MAEEDR---KEEESLVEKIADKIHR-HdsssssdsekeeeekkkttssMDAKVRRLFGRQ  252
            MAE++       +SLV++I++KIH   D+SSSSDS+ + +E     +S+ AK+ RLFGR+
Sbjct  1    MAEQEEISDPRTDSLVDRISEKIHGGDDTSSSSDSDSQVKEAASPPASVKAKIYRLFGRE  60

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKV GGGK AD+FLWRN KIS  VLGGATA+W+LFE+LEYHLLT VCH  ILAL++L
Sbjct  61   KPVHKVFGGGKPADIFLWRNKKISATVLGGATAVWVLFELLEYHLLTLVCHVSILALSLL  120

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSNA +FI K  PHIPEV +PE+P L+ AS L
Sbjct  121  FLWSNATTFINKRPPHIPEVRLPEDPFLEVASVL  154



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 112/153 (73%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAE    EE   ESL++KI+ KI       SS S   + EK   + S+ +KV RLFGR++
Sbjct  1    MAEHHEHEEAKGESLLDKISGKI---HDHDSSSSSDSDNEKTGPSDSLKSKVFRLFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            P+H VLGGGKQADVFLWRN KIS   LG AT IWILFE+LEYHLLT VCH +ILALA LF
Sbjct  58   PIHHVLGGGKQADVFLWRNKKISASTLGVATVIWILFELLEYHLLTLVCHFVILALAGLF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI K  P IP+VHIPE+P+LQFASAL
Sbjct  118  LWSNASTFINKRPPKIPQVHIPEDPILQFASAL  150



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 117/153 (76%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + AK+ RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI K+ P IPEVH+PE+  L  AS+L
Sbjct  118  LWSNAHTFINKTPPQIPEVHVPEDAFLVIASSL  150



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +1

Query  109  EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQ  288
            EE+L+E+I +KIH    SSSSDS+ E+ +      ++ +K+  LFGR++PVH++LGGGK 
Sbjct  6    EETLIEQINEKIHGDGDSSSSDSDDEKSKASVVAEAVKSKIYHLFGREKPVHQILGGGKP  65

Query  289  ADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKK  468
            ADVFLW+N K S  VLGGATAIWILFE++EYHLLT VCH LIL+LA+LFLWSNA + I K
Sbjct  66   ADVFLWKNKKASAVVLGGATAIWILFELMEYHLLTLVCHCLILSLAILFLWSNATTLINK  125

Query  469  SA  474
            S 
Sbjct  126  SP  127



>ref|XP_011073407.1| PREDICTED: reticulon-like protein B2 isoform X1 [Sesamum indicum]
Length=248

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 9/148 (6%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            +E+ K++ESL+EKIADK+H HDSSSSS S   +++K  +   + AKV RLFGR++PVH+V
Sbjct  6    KEEEKKDESLIEKIADKVHGHDSSSSSSSSDSDDDKTSS---LKAKVYRLFGREKPVHRV  62

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGGK AD+FLW          GGATAIW+LF+VLEYHLLT VCHGLI+ LA+LFLWS+ 
Sbjct  63   LGGGKPADIFLWXX------XXGGATAIWVLFDVLEYHLLTLVCHGLIVGLALLFLWSSI  116

Query  451  XSFIKKSAphipevhipeepvLQFASAL  534
             +FI KS P IPEV IPEEP L+FASAL
Sbjct  117  MTFINKSPPRIPEVSIPEEPALKFASAL  144



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 116/150 (77%), Gaps = 7/150 (5%)
 Frame = +1

Query  106  EEESLVEKIADKIHR-------HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            E ESL++KI++KIH          SS   + ++++ +K ++ SSM +KV RLFGR++PVH
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEEYKEKKTKKPESPSSMKSKVYRLFGREKPVH  81

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KVLGGGK AD+F+W++ KIS GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWS
Sbjct  82   KVLGGGKPADIFMWKDKKISGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWS  141

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  142  NATMFINKSPPKIPEVHIPEEPILQLASGL  171



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +1

Query  106  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  285
            +EESL++KI +K H   SSSSS  ++       ++SS+ AK+ RLFGR++PVH VLGGGK
Sbjct  11   KEESLMDKITEKFHGSSSSSSSSDDEAGRAAGSSSSSVKAKIYRLFGREKPVHSVLGGGK  70

Query  286  QADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIK  465
             AD+ LWRN KIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNA +F+ 
Sbjct  71   PADLLLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVN  130

Query  466  KSA  474
            K  
Sbjct  131  KCP  133



>ref|XP_007218267.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19466.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=280

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 121/165 (73%), Gaps = 8/165 (5%)
 Frame = +1

Query  58   FEFG*VESAMAEEDR------KEEESLVEKIADKIHRHdsssssdsekeeeekkkttssM  219
            F FG V   MA++        + E+SL+EKI++KIH H+SSSSS S+ + E+ +   S  
Sbjct  75   FVFG-VSEIMADQSESAGSTVEHEKSLMEKISEKIHDHNSSSSSSSDSDNEKPESPKSE-  132

Query  220  DAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAV  399
              KV R+FGR++PVH V GGGK ADVFLWRN K+S GVLGGATA+W+LFE+LEYHLLT V
Sbjct  133  KPKVFRIFGREKPVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLV  192

Query  400  CHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
             H LI  LAVLFLWSNA SFI K+ P IPEVH+PEEP LQ AS L
Sbjct  193  GHILIGTLAVLFLWSNAHSFIHKTPPRIPEVHLPEEPFLQVASEL  237



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 112/151 (74%), Gaps = 5/151 (3%)
 Frame = +1

Query  97   DRKEEESLVEKIADKIHRHdssss-----sdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            +  EEESL+EKI DKIH    SSS     ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYNEEESLIEKIEDKIHFDHFSSSSSDSDTEKKPASAPEAASPSSVKAAIWRLFGREKPV  68

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            H+V GGGK ADVFLWRN K+S  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKVSASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SNA +FI K  PHIPEVH+PEEP+L+ ASAL
Sbjct  129  SNATTFINKKRPHIPEVHLPEEPILEIASAL  159



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + AK+ R+FGR++
Sbjct  1    MAEEIEKSVPAEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI K+ P IPEVH+PE+  L  AS+L
Sbjct  118  LWSNAHTFINKTPPQIPEVHVPEDAFLVIASSL  150



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  76   ESAMAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            +S  A    + ++SL+EKI++KIH H+SSSSS S+ + E+ +   S    KV R+FGR++
Sbjct  4    QSESAGSTVEHDKSLMEKISEKIHDHESSSSSSSDSDNEKPESPKSE-KPKVFRIFGREK  62

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVH V GGGK ADVFLWRN K+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLF
Sbjct  63   PVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLF  122

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA SFI K+ P IPEVH+PEEP LQ AS L
Sbjct  123  LWSNAHSFIHKTPPRIPEVHLPEEPFLQVASEL  155



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score =   140 bits (352),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  106  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  285
            E ESL++KI++K+H    SSSSD ++++++  ++ SSM +KV RLFGR++PVHKVLGGGK
Sbjct  22   ERESLMDKISEKLHHGGDSSSSDEDEKKKKSSESPSSMKSKVYRLFGREKPVHKVLGGGK  81

Query  286  QADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIK  465
             AD+F+W+N K+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA  FI 
Sbjct  82   PADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFIN  141

Query  466  KSAphipevhipeepvLQFASAL  534
            KS P IPEVHIPEEP+LQ AS L
Sbjct  142  KSPPKIPEVHIPEEPILQLASGL  164



>ref|XP_002880222.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56481.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 117/153 (76%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + AK+ RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSN  +FI K++P IPE+H+PEE  L  AS+L
Sbjct  118  LWSNVHTFINKASPQIPEIHVPEEAFLVIASSL  150



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = +1

Query  94   EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  273
            E+ K EES++EKIA+KIH HD SSSS S+ ++E+K  + SSM  K+ RLFGR++PVHKV 
Sbjct  3    EEHKHEESIMEKIAEKIHGHDGSSSSSSDSDDEKKSASPSSMKKKIYRLFGREKPVHKVF  62

Query  274  GGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAX  453
            GGGK AD+FLWRN K+S GVLG AT  W+LFE+LEY+LLT   H  ILALA LFLWS+A 
Sbjct  63   GGGKPADIFLWRNKKVSGGVLGVATISWVLFELLEYNLLTLFGHITILALACLFLWSSAI  122

Query  454  SFIKKSAphipevhipeepvLQFASAL  534
            +FI K+ PHIPE+HIPEE VLQ AS L
Sbjct  123  TFIHKTPPHIPEIHIPEEVVLQLASGL  149



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 117/154 (76%), Gaps = 7/154 (5%)
 Frame = +1

Query  85   MAEEDRK----EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  252
            MAEE  K    EE SL+EKI++KIH HDSSSSS+SE E+ +       + AK+ R+FGR+
Sbjct  1    MAEEIEKSVPAEEPSLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGRE  57

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  L
Sbjct  58   KPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGL  117

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSNA +FI K+ P IPEVH+PE+  L  AS+L
Sbjct  118  FLWSNAHTFINKTPPQIPEVHVPEDAFLVIASSL  151



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + AK+ R+FGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWR+ K+S  VLG AT IW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATVIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI K++P IPE+H+PEE  L  AS+L
Sbjct  118  LWSNAHTFINKTSPQIPEIHVPEEAFLVIASSL  150



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeek---kkttssMDAKVRRLFGRQQ  255
            MAE     EESL+EKI DKIH HDSSSSS S   +++K    +++SS+ +K+ RLFGR++
Sbjct  1    MAETQHHHEESLLEKITDKIHGHDSSSSSSSSDSDDDKKSEAQSSSSLKSKIYRLFGREK  60

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK AD+FLWRN K+S GVLG AT IWILFE++EYHLLT VCH LILALA+LF
Sbjct  61   PVHKVLGGGKPADIFLWRNKKVSAGVLGVATVIWILFELVEYHLLTLVCHLLILALALLF  120

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FI KS P +P+V+IPE+PVLQ A+AL
Sbjct  121  LWSNASTFINKSPPRLPDVYIPEDPVLQVAAAL  153



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   139 bits (349),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 6/130 (5%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE   ++EES+++KI +K H     SSS S  ++E +  ++SS+ AK+ RLFGR++PVH
Sbjct  1    MAE---RKEESVMDKITEKFH---GGSSSSSSSDDEGRSGSSSSVKAKIYRLFGREKPVH  54

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             VLGGGK AD+FLWRN KIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWS
Sbjct  55   SVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWS  114

Query  445  NAXSFIKKSA  474
            NA +F+ K  
Sbjct  115  NASAFVNKCP  124



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 115/151 (76%), Gaps = 8/151 (5%)
 Frame = +1

Query  106  EEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            E ESL++KI++KIH           S    D ++++ +K ++ SSM +KV RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDDDDDKKEKKTKKPESPSSMKSKVYRLFGREKPV  81

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            HKVLGGGK AD+F+W++ K+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLW  141

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  142  SNATMFINKSPPKIPEVHIPEEPILQLASGL  172



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score =   139 bits (349),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 107/141 (76%), Gaps = 3/141 (2%)
 Frame = +1

Query  112  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  291
            ESL++KIA+KIH H  SSSS     E+++  +   +  KV RLFGR++PVH VLGGGK A
Sbjct  15   ESLLDKIAEKIHGHHDSSSSSDSDSEKKETSS---IKEKVFRLFGREKPVHSVLGGGKPA  71

Query  292  DVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKS  471
            DV LWRN KIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI K+
Sbjct  72   DVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKA  131

Query  472  AphipevhipeepvLQFASAL  534
             P IP VH+PEEP+ QFASAL
Sbjct  132  PPCIPTVHLPEEPIRQFASAL  152



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score =   138 bits (348),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 107/141 (76%), Gaps = 3/141 (2%)
 Frame = +1

Query  112  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  291
            ESL++KIA+KIH H  SSSS     E+++  +   +  KV RLFGR++PVH VLGGGK A
Sbjct  1    ESLLDKIAEKIHGHHDSSSSSDSDSEKKETSS---IKEKVFRLFGREKPVHSVLGGGKPA  57

Query  292  DVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKS  471
            DV LWRN KIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI K+
Sbjct  58   DVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKA  117

Query  472  AphipevhipeepvLQFASAL  534
             P IP VH+PEEP+ QFASAL
Sbjct  118  PPCIPTVHLPEEPIRQFASAL  138



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 111/159 (70%), Gaps = 9/159 (6%)
 Frame = +1

Query  85   MAEE----DRKEEESLVEKIADKIH-----RHdsssssdsekeeeekkkttssMDAKVRR  237
            MAE+       +EES +EKIADKIH        SS S    K     + + SS+ AK+ R
Sbjct  1    MAEQVEQHSEHKEESFMEKIADKIHFDRSSSSSSSDSDSEVKPAAAPEASPSSVKAKIWR  60

Query  238  LFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLIL  417
            LFGR++PVH V GGGK ADVFLWRN KIS  VLGGATAIW+LFE+LEY L+  VCH LI 
Sbjct  61   LFGREKPVHHVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIF  120

Query  418  ALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
             LAVLFLWSNA +FI K  PHIPEV +PEEP+L+ ASAL
Sbjct  121  TLAVLFLWSNATTFINKKRPHIPEVQLPEEPILEIASAL  159



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 121/162 (75%), Gaps = 9/162 (6%)
 Frame = +1

Query  76   ESAMAEE---DRKEEESLVEKIADKIH------RHdsssssdsekeeeekkkttssMDAK  228
            ES +A E   +  E ESL++KI++KIH         SS   D +K++++K  + SSM +K
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHGGDSSSSSSSSDDDDDKKKKKKKPSSPSSMQSK  68

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            V RLFGR++PVHKVLGGGK AD+F+W+N K+S GVLG ATA W+LFE++EYHLLT +CH 
Sbjct  69   VYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHV  128

Query  409  LILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            +I+ LAVLFLWSNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  129  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  170



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 121/165 (73%), Gaps = 8/165 (5%)
 Frame = +1

Query  58   FEFG*VESAMAEEDR------KEEESLVEKIADKIHRHdsssssdsekeeeekkkttssM  219
            F FG V   MA++        + E+SL+EKI++KIH H+SSSSS S+ + E+ +   S  
Sbjct  75   FVFG-VSEIMADQSESAGSTVEHEKSLMEKISEKIHDHNSSSSSSSDSDNEKPESPKSE-  132

Query  220  DAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAV  399
              KV R+FGR++PVH V GGGK ADVFLWRN K+S GVLGGATA+W+LFE+LEYHLLT V
Sbjct  133  KPKVFRIFGREKPVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLV  192

Query  400  CHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
             H LI  LAVLFLWSNA SFI K+ P IPEVH+PEEP LQ AS L
Sbjct  193  GHILIGTLAVLFLWSNAHSFIHKTPPRIPEVHLPEEPFLQVASEL  237



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 114/153 (75%), Gaps = 5/153 (3%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    EESL+EKIA+KIH      SS S   + EK ++ S++ AK+ RLFGR++
Sbjct  1    MAEESEKPVHAEESLMEKIAEKIHD--HHDSSSSSDSDHEKPESPSALKAKIYRLFGREK  58

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGG  ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ VCH LI +LA +F
Sbjct  59   PVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLVCHILIFSLAAMF  118

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +F+KKS P IPEVH+ EE  L  ASAL
Sbjct  119  LWSNAHAFMKKSPPKIPEVHVKEEHFLLIASAL  151



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = +1

Query  76   ESAMAEEDRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGR  249
            E   A    ++E SL+EKI DKIH   HDSSSSS S+ + E+ +K T S+ AKV R+FGR
Sbjct  4    EKEHAGSSVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRIFGR  63

Query  250  QQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  429
            ++PVH VLGGGK ADVFLWRN K+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+
Sbjct  64   ERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAI  123

Query  430  LFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LFLWSNA +FI K+ PHIP+VH+PEEP LQ AS L
Sbjct  124  LFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASEL  158



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +1

Query  112  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  291
            E+L+EKI +KIH    SSSSDS+ E+ +  +   ++ +K+ RLFGR++PVH++LGGGK A
Sbjct  8    ETLIEKIKEKIH-GGDSSSSDSDDEKSKASEVAEAVKSKIFRLFGREKPVHRILGGGKPA  66

Query  292  DVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKS  471
            DVFLW+N K S  VLGGATAIW+LFE++EYHLLT VCH LIL+LA+LFLWSNA +FI KS
Sbjct  67   DVFLWKNKKASAIVLGGATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNATTFINKS  126

Query  472  A  474
             
Sbjct  127  P  127



>ref|XP_006413534.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54987.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=222

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 122/171 (71%), Gaps = 21/171 (12%)
 Frame = +1

Query  85   MAEEDRKEE--------------ESLVEKIADKIHR-------Hdsssssdsekeeeekk  201
            MAEE + EE              ESL++KI++KIH          SSS  + +K++++K 
Sbjct  1    MAEEHKHEESVTALEPAVEVVERESLMDKISEKIHHGGGSSSSSSSSSDDEDDKKKKKKP  60

Query  202  kttssMDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEY  381
             + SSM +KV RLFGR++PVHKVLGGGK AD+F+W+N K+S GVLG ATA W+LFE++EY
Sbjct  61   SSPSSMQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEY  120

Query  382  HLLTAVCHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            HLLT +CH +I+ LAVLFLWSNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  121  HLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  171



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
            A+V RLFGR++P+HKVLGGGK ADVFLWRN  IS GVLGGATAIWILFE+L YHLLT VC
Sbjct  43   ARVFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVC  102

Query  403  HGLILALAVLFLWSNAXSFIKKSA  474
            HGLI +L +LFLWSNA SFI KS+
Sbjct  103  HGLIFSLGLLFLWSNASSFINKSS  126



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 91/155 (59%), Gaps = 25/155 (16%)
 Frame = +1

Query  85   MAEEDRKE------EESLVEKIADKIH-------------------RHdsssssdsekee  189
            MAE+   E       E+L+EK+ADK+H                   R  + ++       
Sbjct  1    MAEQPHAEGGASPKHETLMEKLADKLHAGGGKGDSSSSDSDNDERPRPSAPAAEVKPSFS  60

Query  190  eekkkttssMDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFE  369
                   +   AKV RLFGR+QP+HK LGGGK ADVFLWRN  IS GVLGG TAIWILFE
Sbjct  61   VSAAAAAAEARAKVFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGVTAIWILFE  120

Query  370  VLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKSA  474
             L YHLLT VCHGLI +L VLFLWSNA SFI KS 
Sbjct  121  CLGYHLLTFVCHGLIFSLGVLFLWSNASSFINKSP  155



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 115/151 (76%), Gaps = 8/151 (5%)
 Frame = +1

Query  106  EEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            E ESL++KI++KIH           S    D +K++ +K ++ SSM +KV RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEEDKKKKKTKKPESPSSMKSKVYRLFGREKPV  81

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            HKVLGGGK AD+F+W++ K+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLW  141

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  142  SNATMFINKSPPKIPEVHIPEEPILQLASGL  172



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = +1

Query  76   ESAMAEEDRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGR  249
            E   A    ++E SL+EKI DKIH   HDSSSSS S+ + E+ +K T S+ AKV R+FGR
Sbjct  4    EKEHAGSPVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRIFGR  63

Query  250  QQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  429
            ++PVH VLGGGK ADVFLWRN K+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+
Sbjct  64   ERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAI  123

Query  430  LFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LFLWSNA +FI K+ PHIP+VH+PEEP LQ AS L
Sbjct  124  LFLWSNAHAFIHKTPPHIPKVHLPEEPFLQVASEL  158



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            E D  + ESL++KI+ KIH     SSS S+ + E+K  + S++ +KV RLFGR++P+H V
Sbjct  6    EHDESKGESLLDKISGKIHD--HDSSSSSDSDNEKKNPSPSTLKSKVFRLFGREKPLHNV  63

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGGK ADVFLWRN KIS  VLG ATA WILFE+LEYHLLT VCH  ILALAVLFLWSNA
Sbjct  64   LGGGKPADVFLWRNKKISATVLGVATASWILFELLEYHLLTLVCHLAILALAVLFLWSNA  123

Query  451  XSFIKKSAphipevhipeepvLQFASAL  534
             +FI K+ P IP+VHIPEEPVLQ A+AL
Sbjct  124  STFINKAPPKIPQVHIPEEPVLQIAAAL  151



>ref|XP_006302727.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
 gb|EOA35625.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
Length=253

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 112/150 (75%), Gaps = 5/150 (3%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  K EES++EKIA+KIH HD SSSS    ++++       +  K+ RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDDSSSSSDSDDDKKSST----LKTKIYRLFGREQPVH  55

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            K+ GGGK AD+FLWRN K+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS
Sbjct  56   KIFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWS  115

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            +A +FI K+ PHIPEVHIPEE VLQ AS L
Sbjct  116  SATTFIHKTPPHIPEVHIPEEVVLQLASGL  145



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 9/130 (7%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE    +EES+++KI++K+H         S   ++E     +++ AK+ RLFGR++PVH
Sbjct  1    MAEH---KEESVMDKISEKLHG------GSSSGSDDESSSAAAAVKAKIYRLFGREKPVH  51

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             VLGGGK AD+FLWRN KIS GVL GATAIW+LFEV+EYHLLT +CH  IL L +LFLWS
Sbjct  52   SVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLLCHCFILTLGILFLWS  111

Query  445  NAXSFIKKSA  474
            NA +FI KS 
Sbjct  112  NASAFINKSP  121



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 115/150 (77%), Gaps = 3/150 (2%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  K EES++EKIA+KIH H  SSSS S   +++KK ++  +  KV RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSS--LKTKVYRLFGREQPVH  57

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KV GGGK AD+FLWRN K+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWS  117

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            +A +FI K+ PHIPEVHIPEE VLQ AS L
Sbjct  118  SASTFIHKTTPHIPEVHIPEEVVLQLASGL  147



>gb|AFW80460.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=154

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +1

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            V RLFGR+QP+HK LGGGK ADVFLWRN  IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  409  LILALAVLFLWSNAXSFIKK  468
            LI +L VLFLWSNA SFI K
Sbjct  135  LIFSLGVLFLWSNASSFIHK  154



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  K EES++EKIA+KIH H  SSSS S  + ++ KK++S +  KV RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHGDSSSSSSSSDSDDDKKSSS-LKTKVYRLFGREQPVH  58

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KV GGGK AD+FLWRN K+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS
Sbjct  59   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWS  118

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            +A +FI K+ PHIPEVHIPEE VLQ AS L
Sbjct  119  SASTFIHKTTPHIPEVHIPEEVVLQLASGL  148



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            M AK+ RLFGR++PVH VLGGGK AD+ LWRN KIS GVL GATAIW+LFEV+EYHLLT 
Sbjct  1    MKAKIYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTL  60

Query  397  VCHGLILALAVLFLWSNAXSFIKKSA  474
            VCH LI++LA+LFLWSNA SFI KS 
Sbjct  61   VCHCLIVSLAILFLWSNASSFINKSP  86



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 106/143 (74%), Gaps = 3/143 (2%)
 Frame = +1

Query  106  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  285
            E ESL+EKI++K+H       S S     + +    S+ +KV RLFGR++PVHKVLGGGK
Sbjct  22   ERESLMEKISEKVHH---KGDSSSSSSSSDDENEKKSLKSKVYRLFGRERPVHKVLGGGK  78

Query  286  QADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIK  465
             AD+F+W+N K+S GV GGAT  W+LFE++EYHLLT +CH +I+ LAVLFLWSNA  FI 
Sbjct  79   PADIFMWKNKKMSGGVFGGATVAWVLFELIEYHLLTLLCHVMIVLLAVLFLWSNATMFIH  138

Query  466  KSAphipevhipeepvLQFASAL  534
            KS P IPEVHIPEEP+LQ AS L
Sbjct  139  KSPPKIPEVHIPEEPLLQLASGL  161



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +1

Query  85   MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            MAE E  +E E +VE + DKI          S    +       ++ +K+ RLFGR++PV
Sbjct  1    MAEHEGEREREPVVESMVDKI-TEKIHDHHSSSSSSDSDDDKLDAVKSKIFRLFGREKPV  59

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            HKVLGGGK ADVFLWRN KIS GVLGGATA+W+ FE+LEYHL+T VC+  I +LAVLFLW
Sbjct  60   HKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCYLSIFSLAVLFLW  119

Query  442  SNAXSFIKKSA  474
            SNA +F+ KS 
Sbjct  120  SNASNFLNKSP  130



>ref|XP_010462746.1| PREDICTED: reticulon-like protein B5 isoform X1 [Camelina sativa]
Length=160

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 7/132 (5%)
 Frame = +1

Query  85   MAEEDRK----EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQ  252
            MAEE  K    EE SL+EKI++KIH HDSSSSS+SE E+ +       + AK+ R+FGR+
Sbjct  1    MAEEIEKSVPVEEPSLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGRE  57

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  L
Sbjct  58   KPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGL  117

Query  433  FLWSNAXSFIKK  468
            FLWSNA +FI  
Sbjct  118  FLWSNAHTFINN  129



>ref|NP_001118533.1| reticulon-like protein B5 [Arabidopsis thaliana]
 gb|AEC10652.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=187

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 117/153 (76%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + AK+ R+FGR++
Sbjct  1    MAEEIEKSVPTEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA + I K++P IPE+H+PEE  L  AS+L
Sbjct  118  LWSNAHTLINKTSPQIPEIHVPEEAFLVVASSL  150



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 110/141 (78%), Gaps = 3/141 (2%)
 Frame = +1

Query  112  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  291
            ESL++KI +KI  HDSSSSSDS+ ++  K      + +K+ RLFGR++PVHKVLGGGK A
Sbjct  7    ESLMDKITEKIRGHDSSSSSDSDDDKPSKVDA---VKSKIFRLFGREKPVHKVLGGGKPA  63

Query  292  DVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKS  471
            DV LWRN ++S  VLGGAT +W+LFE+LEYHL+T VCH  IL LA+LFLWSNA +F+ KS
Sbjct  64   DVLLWRNKQVSASVLGGATVVWVLFELLEYHLITLVCHISILTLAILFLWSNASTFVNKS  123

Query  472  AphipevhipeepvLQFASAL  534
             P IP++ +PE+ VL+ ASAL
Sbjct  124  PPEIPQIVLPEKYVLEIASAL  144



>gb|KJB24286.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=152

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 3/150 (2%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            M++ + K EESL+EKI++K+  HD SSSS    +++  + +   M AKV RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             V GGGKQAD+FLWRN KIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWS
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FI KS P IPEV IP++PVL+FA AL
Sbjct  118  NAATFIHKSPPRIPEVQIPKDPVLEFAQAL  147



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = +1

Query  97   DRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            + KEE+S++EK+++K+H     SSS SD EK+      + +++ AK+ RLFGR++PVH V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDEKKGSSSSSSAAAVKAKIYRLFGRERPVHSV  62

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGGK AD+ LWRN KIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  451  XSFIKKSA  474
             +FI KS 
Sbjct  123  STFINKSP  130



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 122/171 (71%), Gaps = 21/171 (12%)
 Frame = +1

Query  85   MAEEDRKEE--------------ESLVEKIADKIHR-------Hdsssssdsekeeeekk  201
            MAEE + EE              ESL++KI++KIH          SSS  + +K++++K 
Sbjct  1    MAEEHKHEESVTALEPAVEVVERESLMDKISEKIHHGGGSSSSSSSSSDDEDDKKKKKKP  60

Query  202  kttssMDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEY  381
             + SSM +KV RLFGR++PVHKVLGGGK AD+F+W+N K+S GVLG ATA W+LFE++EY
Sbjct  61   SSPSSMQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEY  120

Query  382  HLLTAVCHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            HLLT +CH +I+ LAVLFLWSNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  121  HLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  171



>ref|XP_009104316.1| PREDICTED: reticulon-like protein B6 [Brassica rapa]
 emb|CDY53913.1| BnaA07g38210D [Brassica napus]
Length=254

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    EESL+EKIA+KIH      SS S   + EK ++ S++ AK+ RLFGR++
Sbjct  1    MAEESEKPVHTEESLMEKIAEKIHD--HHDSSSSSDSDHEKPESQSALKAKIYRLFGREK  58

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGG  ADVFLWR+ K+S  VLG ATAIW+LFE++EYH L+ VCH LI +LA +F
Sbjct  59   PVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFSLAAMF  118

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +F+KKS P IPE+ + EE  L  ASAL
Sbjct  119  LWSNAHAFMKKSPPKIPEIQVKEEHFLLIASAL  151



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 98/129 (76%), Gaps = 6/129 (5%)
 Frame = +1

Query  97   DRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            + KEE   ES++EKI +K H      SS S+ + E+ K ++S + +++ RLFGR++PVH 
Sbjct  3    ENKEESVGESVMEKIMEKFHD---DDSSSSDSDNEKSKPSSSPVKSQIYRLFGREKPVHT  59

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLGGG  ADVFLWRN KIS GVLGGATAIW+LFE++EYHLL  VCH LIL+LA+LFLWSN
Sbjct  60   VLGGGTPADVFLWRNKKISAGVLGGATAIWVLFELMEYHLLALVCHCLILSLAILFLWSN  119

Query  448  AXSFIKKSA  474
            A +FI KS 
Sbjct  120  ASTFIHKSP  128



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + AK+ RLFGR++ VH VLGGGK ADVFLWRN KIS GV+GGATA+W+LFE+LEYHLL+ 
Sbjct  45   IKAKIYRLFGRERSVHNVLGGGKPADVFLWRNKKISAGVIGGATAVWVLFELLEYHLLSL  104

Query  397  VCHGLILALAVLFLWSNAXSFIKKSA  474
            VCH LIL+LA+LFLWSNA +FI K+ 
Sbjct  105  VCHCLILSLAILFLWSNASTFINKAP  130



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +1

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
            + V RLFGR++P+H VLGGGK ADVFLWRN KIS   LG ATAIW+LFE+LEYHLLT VC
Sbjct  46   SNVFRLFGREKPIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVC  105

Query  403  HGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            H LILALA LFLWSNA +FI KS P IP+VHIPEEPVL+FASAL
Sbjct  106  HFLILALAGLFLWSNASTFINKSPPKIPQVHIPEEPVLKFASAL  149



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 111/153 (73%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MA+E  K    EESL+EKIA+KI       SS S   + EK ++  ++  K+ RLFGR++
Sbjct  1    MADEMEKSAPAEESLLEKIAEKI---HDHDSSSSSDSDNEKMESPMAVKDKIYRLFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKV GGGK ADV LWR+ K+S  VLG ATAIW+LFE++EYHLL+ VCH LILAL+VLF
Sbjct  58   PVHKVFGGGKPADVLLWRDKKLSAAVLGTATAIWVLFELVEYHLLSLVCHILILALSVLF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA SFI KS P IPE+H+ EE  L  ASAL
Sbjct  118  LWSNAHSFINKSPPQIPEIHLHEEHFLLVASAL  150



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 97/132 (73%), Gaps = 2/132 (2%)
 Frame = +1

Query  85   MAEEDRKEE--ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  258
            MAE   +E   ES+++KI+DK H    SSSS S   +++KK + + + AK+ RLFGR+QP
Sbjct  1    MAEHKEEEPVAESMMDKISDKFHGGGGSSSSSSSDSDDDKKGSAAGVKAKIYRLFGREQP  60

Query  259  VHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  438
            VH VLGGGK AD+ LWRN KIS GVL GATAIW+LFEV+EYHLLT V H LIL+LA LFL
Sbjct  61   VHAVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFL  120

Query  439  WSNAXSFIKKSA  474
            WSN   FI KS 
Sbjct  121  WSNVCIFIHKSP  132



>gb|ABC01908.1| putative 24 kDa seed maturation protein-like protein [Solanum 
tuberosum]
Length=255

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
            AK+ RLFGR++PVHKVLGGGK AD+FLWR+ KI+ GVLG AT++W+LFE+L+YHLLT VC
Sbjct  48   AKIYRLFGRERPVHKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVC  107

Query  403  HGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            H LILALAVLFLWSNA +FI KS P IP+V +PE+ VL  A+AL
Sbjct  108  HILILALAVLFLWSNASTFINKSPPQIPDVILPEDIVLGVAAAL  151



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 115/144 (80%), Gaps = 1/144 (1%)
 Frame = +1

Query  106  EEESLVEKIADKIH-RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGG  282
            E ESL+EK+++KIH + DSSSS D  +++     +  S+ +KV RLFGR++PVHKVLGGG
Sbjct  18   ERESLMEKLSEKIHHKGDSSSSDDENEKKPSSSSSPRSLKSKVYRLFGRERPVHKVLGGG  77

Query  283  KQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFI  462
            K AD+F+W+N K+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA  FI
Sbjct  78   KPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFI  137

Query  463  KKSAphipevhipeepvLQFASAL  534
             KS P IPEVHIPEEP+LQ AS L
Sbjct  138  HKSPPKIPEVHIPEEPLLQLASGL  161



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  K EES++EKI++KIH HD SSSS S+ ++++   +   +  K+ RLFGR+QP+H
Sbjct  1    MAEE-HKHEESIMEKISEKIHGHDDSSSSSSDSDDDKNSAS---LKTKIYRLFGREQPLH  56

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            K+ GGGK AD+FLWRN K+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS
Sbjct  57   KLFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWS  116

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            +A +FI KS  HIPEVHIPE+ VLQ AS L
Sbjct  117  SASTFIHKSPLHIPEVHIPEDVVLQLASGL  146



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE +  + ES++EKIADKIH HDSSS SD +K           + +K+ RLFGR +PVH
Sbjct  1    MAEHEAPKAESIMEKIADKIHHHDSSSDSDDDKPAPSS------LKSKIYRLFGRDKPVH  54

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KVLGGGK AD+ LWR+ KIS  VLG  TA+W LFE+ EYHLL+ +CH L+L + VLFLWS
Sbjct  55   KVLGGGKPADILLWRDKKISATVLGTVTAVWALFEIFEYHLLSLICHLLMLTITVLFLWS  114

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FI K+ P IP+V IPE PVL+ ASAL
Sbjct  115  NASTFINKAPPKIPDVRIPEGPVLEIASAL  144



>gb|KCW72350.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=232

 Score =   135 bits (341),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 108/154 (70%), Gaps = 6/154 (4%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdse------keeeekkkttssMDAKVRRLFGRQ  252
            EE   + ESL+EK A+KIH H    SS S       K+             K+ RLFGR+
Sbjct  5    EEQPHKAESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRE  64

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWRN KIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+L
Sbjct  65   RPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAIL  124

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSNA +FI K  PHIPEV IPE+PVL+FAS L
Sbjct  125  FLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVL  158



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score =   136 bits (342),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 116/150 (77%), Gaps = 6/150 (4%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIYRLFGREKPVH  54

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KV GGGK AD+FLWRN K+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHISILALAVLFLWS  114

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            +A +FI K+ PHIPEVHIPE+ VLQ AS L
Sbjct  115  SATTFIHKTPPHIPEVHIPEDVVLQLASGL  144



>gb|KCW72351.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=224

 Score =   135 bits (340),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 108/154 (70%), Gaps = 6/154 (4%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdse------keeeekkkttssMDAKVRRLFGRQ  252
            EE   + ESL+EK A+KIH H    SS S       K+             K+ RLFGR+
Sbjct  5    EEQPHKAESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRE  64

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWRN KIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+L
Sbjct  65   RPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAIL  124

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSNA +FI K  PHIPEV IPE+PVL+FAS L
Sbjct  125  FLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVL  158



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   136 bits (342),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 122/152 (80%), Gaps = 4/152 (3%)
 Frame = +1

Query  85   MAEEDRKEE--ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  258
            MAE D+ +   ES+ EKI++K H HDSSS SDS+ E+ +    +  + +K+ RLFGR++P
Sbjct  1    MAEHDKDDSVVESVTEKISEKTHGHDSSSVSDSDHEKSKSNPDS--LKSKIYRLFGREKP  58

Query  259  VHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  438
            VHKVLGGGK ADVFLWRN KIS GVLGGATAIW+LFE+LEY+L+T VCH LILALA+LFL
Sbjct  59   VHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYNLVTLVCHCLILALALLFL  118

Query  439  WSNAXSFIKKSAphipevhipeepvLQFASAL  534
            WSNA +FI KS P IPEV IPEEPVLQ A+AL
Sbjct  119  WSNASTFINKSPPRIPEVCIPEEPVLQTAAAL  150



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 108/154 (70%), Gaps = 6/154 (4%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdse------keeeekkkttssMDAKVRRLFGRQ  252
            EE   + ESL+EK A+KIH H    SS S       K+             K+ RLFGR+
Sbjct  5    EEQPHKAESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRE  64

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWRN KIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+L
Sbjct  65   RPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAIL  124

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSNA +FI K  PHIPEV IPE+PVL+FAS L
Sbjct  125  FLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVL  158



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = +1

Query  94   EDRKEEESLVEKIADKIHRH-dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  +K+ RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGGK AD+FLWRN K+S GVLG  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNA  122

Query  451  XSFIKKSAphipevhipeepvLQFASAL  534
             +FI KS PHIPEVHIPE+P+LQ  S L
Sbjct  123  CTFIHKSTPHIPEVHIPEDPILQLVSGL  150



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            V RLFGR+QP+HK LGGGK ADVFLWRN  IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  409  LILALAVLFLWSNAXSFIKKSA  474
            LI +L VLFLWSNA SFI KS 
Sbjct  135  LIFSLGVLFLWSNASSFIHKSP  156



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 121/152 (80%), Gaps = 4/152 (3%)
 Frame = +1

Query  85   MAEEDRKEE--ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  258
            MAE D+ +   ES+ EKI++KIH     SSS S+ + E+ K    S+ +K+ RLFGR++P
Sbjct  1    MAEHDKDDSVVESVTEKISEKIHG--HDSSSGSDSDHEKSKSNPDSLKSKIYRLFGREKP  58

Query  259  VHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  438
            VHKVLGGGK ADVFLWRN KIS GVLGGATAIW+LFE+LEYHLLT VCH LILALA+LFL
Sbjct  59   VHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLILALALLFL  118

Query  439  WSNAXSFIKKSAphipevhipeepvLQFASAL  534
            WSNA +FI KS P IPEVHIPEEPVLQ A+AL
Sbjct  119  WSNASTFINKSPPRIPEVHIPEEPVLQIAAAL  150



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 99/128 (77%), Gaps = 2/128 (2%)
 Frame = +1

Query  97   DRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            + KEE+S++EK+++K+H     SSS SD +K+        ++M AK+ RLFGR++PVH V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSAAAAMKAKIYRLFGRERPVHSV  62

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGGK AD+ LWRN KIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  451  XSFIKKSA  474
             +FI KS 
Sbjct  123  STFIHKSP  130



>ref|NP_566065.1| reticulon-like protein B5 [Arabidopsis thaliana]
 sp|O82352.1|RTNLE_ARATH RecName: Full=Reticulon-like protein B5; Short=AtRTNLB5 [Arabidopsis 
thaliana]
 gb|AAC62889.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96651.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AAL69534.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AEC10651.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=255

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 117/153 (76%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + AK+ R+FGR++
Sbjct  1    MAEEIEKSVPTEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA + I K++P IPE+H+PEE  L  AS+L
Sbjct  118  LWSNAHTLINKTSPQIPEIHVPEEAFLVVASSL  150



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 116/150 (77%), Gaps = 6/150 (4%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIFRLFGREKPVH  54

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KV GGGK AD+FLWRN K+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWS  114

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            +A +FI K+ PHIPEVHIPEE VLQ AS L
Sbjct  115  SATTFIHKTPPHIPEVHIPEEVVLQLASGL  144



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 108/154 (70%), Gaps = 6/154 (4%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdse------keeeekkkttssMDAKVRRLFGRQ  252
            EE   + ESL+EK A+KIH H    SS S       K+             K+ RLFGR+
Sbjct  5    EEQPHKAESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRE  64

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWRN KIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+L
Sbjct  65   RPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAIL  124

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSNA +FI K  PHIPEV IPE+PVL+FAS L
Sbjct  125  FLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVL  158



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
            +K+ RLFGR++PVHKVLGGGK ADV LWRN KIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  58   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  117

Query  403  HGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            H LIL+LAV FLWSNA +FI KS P IP+V + E  VL  ASAL
Sbjct  118  HLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASAL  161



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 122/171 (71%), Gaps = 21/171 (12%)
 Frame = +1

Query  85   MAEEDRKEE--------------ESLVEKIADKIHR-------Hdsssssdsekeeeekk  201
            MAEE + EE              ESL++KI++KIH          SSS  + +K++++K 
Sbjct  1    MAEEHKHEESVTALEPAVEVVERESLMDKISEKIHHGGGSSSSSSSSSDDEDDKKKKKKP  60

Query  202  kttssMDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEY  381
             + SSM +KV RLFGR++PVHKVLGGGK A++F+W+N K+S GVLG ATA W+LFE++EY
Sbjct  61   SSPSSMQSKVYRLFGREKPVHKVLGGGKPAEIFMWKNKKMSGGVLGAATAAWVLFELMEY  120

Query  382  HLLTAVCHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            HLLT +CH +I+ LAVLFLWSNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  121  HLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  171



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
            +K+ RLFGR++PVHKVLGGGK ADV LWRN KIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  52   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  111

Query  403  HGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            H LIL+LAV FLWSNA +FI KS P IP+V + E  VL  ASAL
Sbjct  112  HLLILSLAVFFLWSNASTFINKSPPQIPKVQLSERTVLDLASAL  155



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 117/150 (78%), Gaps = 3/150 (2%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  K EESL+EKI++KIH H  SSSS S+ ++E+K  ++  +  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESLMEKISEKIHGHGDSSSSSSDSDDEKKSDSS--LKTKIYRLFGREKPVH  57

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KV GGGK AD+FLWRN K+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATISWILFELLEYNLLTLFGHVSILALAVLFLWS  117

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            +A +FI K+ PHIPE+HIPE+ VL+ AS L
Sbjct  118  SATTFIHKTPPHIPEIHIPEKIVLELASGL  147



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            V RLFGR+QP+HK LGGGK ADVFLWRN  IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGVLGGATAIWILFELLGYHLLTFVCHG  138

Query  409  LILALAVLFLWSNAXSFIKKSA  474
            LI AL VLFLWSNA SFI K+ 
Sbjct  139  LIFALGVLFLWSNASSFIHKAP  160



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            V RLFGR++P+HKVLGGGK ADVFLWRN  IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  409  LILALAVLFLWSNAXSFIKKSA  474
            LI +L +LFLWSNA SFI KS 
Sbjct  135  LIFSLGLLFLWSNASSFINKSP  156



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            V RLFGR++P+HKVLGGGK ADVFLWRN  IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  409  LILALAVLFLWSNAXSFIKKSA  474
            LI +L +LFLWSNA SFI KS 
Sbjct  135  LIFSLGLLFLWSNASSFINKSP  156



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +1

Query  235  RLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  414
            RLFGR++PVH VLGGGK AD+FLWRN KIS GVLGGATAIW+LF+++EYHLL  VCH LI
Sbjct  49   RLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLI  108

Query  415  LALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            L+LA+LFLWSNA +FI KS P IPEV IPE+  + FA +L
Sbjct  109  LSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSL  148



>ref|XP_006366650.1| PREDICTED: putative 24 kDa seed maturation protein-like protein 
[Solanum tuberosum]
Length=403

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 104/136 (76%), Gaps = 5/136 (4%)
 Frame = +1

Query  76   ESAMAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  246
            E  MA+   + E   ES++EKI DK+H  D  SSS   ++++EK  +  ++ AK+ RLFG
Sbjct  146  EYTMADHAGEHESVVESVMEKINDKLH--DHDSSSSDSEDDKEKISSVDAVKAKIYRLFG  203

Query  247  RQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  426
            R++PVHKVLGGGK AD+FLWR+ KI+ GVLG AT++W+LFE+L+YHLLT VCH LILALA
Sbjct  204  RERPVHKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALA  263

Query  427  VLFLWSNAXSFIKKSA  474
            VLFLWSNA +FI KS 
Sbjct  264  VLFLWSNASTFINKSP  279



>ref|XP_009112901.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=251

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 114/150 (76%), Gaps = 6/150 (4%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIFRLFGREKPVH  54

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KV GGGK AD+FLWRN K+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWS  114

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            +A +FI K  PHIPEVHIPEE  LQ AS L
Sbjct  115  SATTFIHKKPPHIPEVHIPEEVALQLASGL  144



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 108/154 (70%), Gaps = 6/154 (4%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdse------keeeekkkttssMDAKVRRLFGRQ  252
            EE   + ESL+EK A+KIH H    SS S       K+             K+ RLFGR+
Sbjct  5    EEQPHKAESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRE  64

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVHKVLGGGK ADVFLWRN KIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+L
Sbjct  65   RPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAIL  124

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSNA +FI K  PHIPEV IPE+PVL+FAS L
Sbjct  125  FLWSNATTFIHKMPPHIPEVSIPEKPVLEFASVL  158



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 120/163 (74%), Gaps = 10/163 (6%)
 Frame = +1

Query  76   ESAMAEE---DRKEEESLVEKIADKIHR-------HdsssssdsekeeeekkkttssMDA  225
            ES +A E   +  E ESL++KI++KIH          SS   D +K+ ++    +SSM +
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDEKKKTKKPSSPSSSMKS  68

Query  226  KVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCH  405
            KV RLFGR+QPVHKVLGGGK AD+F+W+N K+S GVLGGATA W++FE++EYHLLT +CH
Sbjct  69   KVYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCH  128

Query  406  GLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
             +I+ LAVLFLWSNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  129  VMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  171



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            V RLFGR+QP+HK LGGGK ADVFLWRN  IS G+LGGATAIWILFE+L YHLLT VCHG
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGILGGATAIWILFELLGYHLLTFVCHG  138

Query  409  LILALAVLFLWSNAXSFIKKSA  474
            LI AL VLFLWSNA SFI K+ 
Sbjct  139  LIFALGVLFLWSNASSFIHKAP  160



>ref|XP_010523772.1| PREDICTED: reticulon-like protein B5 [Tarenaya hassleriana]
Length=253

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 106/148 (72%), Gaps = 3/148 (2%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            E     EESL+EKIADKI       SS S   + EK ++ S++  K+ RLFGR++PVHKV
Sbjct  6    ENSTPAEESLLEKIADKI---HDHDSSSSSDSDNEKMESPSAVKEKIYRLFGREKPVHKV  62

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
             GGGK ADV LWR+ K+S  VLG  TA+W+LFE++EYHLL+ VCH  IL LAVLFLWSNA
Sbjct  63   FGGGKPADVLLWRDKKLSAAVLGTTTAVWVLFELVEYHLLSFVCHISILTLAVLFLWSNA  122

Query  451  XSFIKKSAphipevhipeepvLQFASAL  534
             SFI KS P IPE+H+ EEP L  ASA+
Sbjct  123  HSFINKSPPQIPEIHVAEEPFLLIASAI  150



>gb|KJB24287.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=208

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 3/150 (2%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            M++ + K EESL+EKI++K+  HD SSSS    +++  + +   M AKV RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             V GGGKQAD+FLWRN KIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWS
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FI KS P IPEV IP++PVL+FA AL
Sbjct  118  NAATFIHKSPPRIPEVQIPKDPVLEFAQAL  147



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 117/145 (81%), Gaps = 2/145 (1%)
 Frame = +1

Query  106  EEESLVEKIADKIHR--HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGG  279
            E ESL++KI++K+H     SSS  D +K++++  ++ SSM +KV RLFGR++PVHKVLGG
Sbjct  22   ERESLMDKISEKLHHGGDSSSSDEDDDKKKKKSSESPSSMKSKVYRLFGREKPVHKVLGG  81

Query  280  GKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSF  459
            GK AD+F+W+N K+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA  F
Sbjct  82   GKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  141

Query  460  IKKSAphipevhipeepvLQFASAL  534
            I KS P IPEVHIPEEP+LQ AS L
Sbjct  142  INKSPPKIPEVHIPEEPILQLASGL  166



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + AK+ RLFGR++PVHKVLGGGK ADVFLWRN KIS  VL  ATAIWILFE+LEYHLLT 
Sbjct  76   VQAKIYRLFGREKPVHKVLGGGKPADVFLWRNKKISGSVLASATAIWILFELLEYHLLTL  135

Query  397  VCHGLILALAVLFLWSNAXSFIKKSA  474
            +CH LI +LAVLFLW+NA +FI KS 
Sbjct  136  ICHSLIFSLAVLFLWANASTFINKSP  161



>gb|AFK39432.1| unknown [Lotus japonicus]
Length=150

 Score =   132 bits (331),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAK---VRRLFGRQQP  258
            +E D  + E L+EKIA+KIH HDSSSSSDS+ E+E++K ++S        V RLFGR++P
Sbjct  5    SEHDEPKAEPLMEKIAEKIHGHDSSSSSDSDNEKEKEKSSSSPSSDFKSKVSRLFGREKP  64

Query  259  VHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  438
            +H VLGGGKQADVFLWRN KIS  VLG AT +WILFE+L YHLLT +CH  ILAL +LFL
Sbjct  65   IHHVLGGGKQADVFLWRNKKISGTVLGVATVVWILFELLGYHLLTLICHLAILALTLLFL  124

Query  439  WSNAXSFIKKSA  474
            WSN  S I KS 
Sbjct  125  WSNGSSLINKSP  136



>ref|XP_009349323.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 116/158 (73%), Gaps = 9/158 (6%)
 Frame = +1

Query  85   MAEEDR-----KEEESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAKVRRL  240
            MA+E       + E SL+EKI +KIH   RH SSSSS    +E+ +KK  S + AKV R+
Sbjct  1    MADEKNAGSPVEHEPSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAES-VKAKVFRI  59

Query  241  FGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILA  420
            FGR++PVH VLGGGK ADVFLWRN K+S GVLGGAT +W+LFE+L+YHLLT V H LI  
Sbjct  60   FGREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIAT  119

Query  421  LAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS L
Sbjct  120  LAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASEL  157



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = +1

Query  106  EEESLVEKIADKIHRH---dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  276
            E ESL+EK+++KIH      SSSSS  ++ E++   +  S+ +KV RLFGR++PVHKVLG
Sbjct  22   ERESLMEKLSEKIHHKGGDSSSSSSSDDENEKKSSSSPRSLKSKVYRLFGRERPVHKVLG  81

Query  277  GGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXS  456
            GGK AD+F+W+N K+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA  
Sbjct  82   GGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  457  FIKKSAphipevhipeepvLQFASAL  534
            FI KS P IPEVHIPEEP+LQ AS L
Sbjct  142  FIHKSPPKIPEVHIPEEPLLQLASGL  167



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 116/158 (73%), Gaps = 9/158 (6%)
 Frame = +1

Query  85   MAEEDR-----KEEESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAKVRRL  240
            MA+E       + E SL+EKI +KIH   RH SSSSS    +E+ +KK  S + AKV R+
Sbjct  1    MADEKNAGSPVEHEPSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAES-VKAKVFRI  59

Query  241  FGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILA  420
            FGR++PVH VLGGGK ADVFLWRN K+S GVLGGAT +W+LFE+L+YHLLT V H LI  
Sbjct  60   FGREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIAT  119

Query  421  LAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS L
Sbjct  120  LAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASEL  157



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 99/132 (75%), Gaps = 4/132 (3%)
 Frame = +1

Query  88   AEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQP  258
            A E  K E   ESL++KI +K H  DSSSS   + ++  K   +S+  AK+ RLFGR+QP
Sbjct  5    ASEHEKHESAAESLIDKITEKFHGSDSSSSDSDDDDKGIKSAASSAK-AKIYRLFGREQP  63

Query  259  VHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  438
            VHKVLGGGK AD+FLWR+ K+S GVLG ATAIW+LFE++EYHLL+ VCH LIL LA++FL
Sbjct  64   VHKVLGGGKPADIFLWRDKKVSAGVLGFATAIWVLFELIEYHLLSLVCHILILGLAIIFL  123

Query  439  WSNAXSFIKKSA  474
            WSNA SFI KS 
Sbjct  124  WSNASSFINKSP  135



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = +1

Query  94   EDRKEEESLVEKIADKIHRH-dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  +K+ RLFGR++PVHKV
Sbjct  3    EDHKHEESIMEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGGK AD+FLWRN K+S GV G  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNA  122

Query  451  XSFIKKSAphipevhipeepvLQFASAL  534
             +FI K++PHIPEV+IPE+PVLQ  S L
Sbjct  123  CTFIHKASPHIPEVNIPEDPVLQLVSGL  150



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +1

Query  106  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  285
            E  SL++KI++KIH H   SSS S+ E E+K  + SSM +KV RLFGR++PVHKVLGGGK
Sbjct  68   ERGSLMDKISEKIH-HKGDSSSSSDDESEKKPSSPSSMKSKVYRLFGRERPVHKVLGGGK  126

Query  286  QADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIK  465
             AD+F+W+N K+S GVLGGAT  W+LFE++EYHLLT +CH +I+ LA LFLWSNA  FI+
Sbjct  127  PADIFMWKNKKVSGGVLGGATVAWVLFELMEYHLLTLLCHVMIVTLAALFLWSNATMFIR  186

Query  466  KSAphipevhipeepvLQFASAL  534
            KS P IPEVHIPE+P+LQ AS L
Sbjct  187  KSPPKIPEVHIPEDPLLQLASGL  209



>gb|KCW46474.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=218

 Score =   133 bits (334),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  109  EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQ  288
            E SL+EK  +KIH  D  S+S S   +++K     S  +KV RLFGR++PVHKVLGGGK 
Sbjct  10   EPSLMEKNTEKIHVPDPPSASSSSDSDDDKPSVVDSAKSKVYRLFGREKPVHKVLGGGKP  69

Query  289  ADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKK  468
            AD+FLWR+ K+S GVLG ATAIWILFE++EYHL+T VCH LI  LA++FLW++A + I K
Sbjct  70   ADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVCHILIATLAIIFLWASASTHITK  129

Query  469  SAphipevhipeepvLQFASAL  534
            S P+IPEV +PE+ VL+ AS L
Sbjct  130  SPPNIPEVQLPEKCVLEVASVL  151



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +1

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            + RLFGR++PVH VLGGGK AD+FLWRN KIS GVLGGATAIW+LF+++EYHLL  VCH 
Sbjct  47   ICRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHC  106

Query  409  LILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LIL+LA+LFLWSNA +FI KS P IPEV IPE+  + FA +L
Sbjct  107  LILSLAILFLWSNATTFINKSPPRIPEVSIPEDVAVSFALSL  148



>emb|CDY08353.1| BnaC09g12430D [Brassica napus]
Length=250

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 113/150 (75%), Gaps = 6/150 (4%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIYRLFGREKPVH  54

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KV GGGK AD+FLWRN K+S GVLG AT  WILFE+ +Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELFQYNLLTLFGHISILALAVLFLWS  114

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            +A +FI K  P IPEVHIPEE VLQ AS L
Sbjct  115  SASTFIHKKPPRIPEVHIPEEVVLQLASGL  144



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 3/150 (2%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            M++ + K EESL+EKI++K+  HD SSSS    +++  + +   M AKV RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             V GGGKQAD+FLWRN KIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWS
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FI KS P IPEV IP++PVL+FA AL
Sbjct  118  NAATFIHKSPPRIPEVQIPKDPVLEFAQAL  147



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 113/147 (77%), Gaps = 4/147 (3%)
 Frame = +1

Query  106  EEESLVEKIADKIHRH----dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  273
            E ESL+EK+++KIH       SSSS +  +++     +  S+ +KV RLFGR++PVHKVL
Sbjct  18   ERESLMEKLSEKIHHKGDSSSSSSSDEENEKKTSSSSSPRSLKSKVYRLFGRERPVHKVL  77

Query  274  GGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAX  453
            GGGK AD+F+W+N K+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA 
Sbjct  78   GGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNAT  137

Query  454  SFIKKSAphipevhipeepvLQFASAL  534
             FI KS P IPE+HIPE+P+LQ AS L
Sbjct  138  MFIHKSPPKIPEIHIPEDPLLQLASGL  164



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 116/162 (72%), Gaps = 14/162 (9%)
 Frame = +1

Query  85   MAEEDRKEE------------ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAK  228
            MAEE + EE            ES++EKIA+KIH H  SSSS S   +++KK ++  +  K
Sbjct  1    MAEEHKHEESIMEKIAEKIHEESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSS--LKTK  58

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            V RLFGR+QPVHKV GGGK AD+FLWRN K+S GVLG AT  WILFE+LEY+LLT   H 
Sbjct  59   VYRLFGREQPVHKVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHI  118

Query  409  LILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
             IL LAVLFLWS+A +FI K+ PHIPEVHIPEE VLQ AS L
Sbjct  119  SILTLAVLFLWSSASTFIHKTTPHIPEVHIPEEVVLQLASGL  160



>gb|AFK42129.1| unknown [Medicago truncatula]
Length=199

 Score =   132 bits (332),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 118/156 (76%), Gaps = 6/156 (4%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekee---eekkkttssMDAKVRRLFG  246
            MA+ +  EE   ESL++KI+ KIH H  SSSS S+ +    E+K  + +S+  KV RLFG
Sbjct  1    MADHNEHEEVKSESLLDKISGKIHDHHDSSSSSSDSDNDKKEKKVSSPTSLKNKVFRLFG  60

Query  247  RQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  426
            R++P+H VLGGGK ADVFLWRN KIS   LG ATA+W+LFE+LEYHLLT + H  ILALA
Sbjct  61   REKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALA  120

Query  427  VLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VLFLWSNA +FI KS P IP+VHIPEEPVLQ ASA+
Sbjct  121  VLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAI  156



>ref|XP_002317731.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
 gb|EEE95951.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
Length=240

 Score =   133 bits (335),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 9/133 (7%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAE + + E   ESLV+KI +KI  HDSSSSSDS+ E+ +       + +K+ RLFGR++
Sbjct  1    MAEHEGQRESAAESLVDKITEKISGHDSSSSSDSDNEKFDA------VKSKIFRLFGREK  54

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWRN KIS GVLGGAT +W+LFE+L YHL+T VC+  I +LAVLF
Sbjct  55   PVHKVLGGGKPADVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFSLAVLF  114

Query  436  LWSNAXSFIKKSA  474
            LWSN   F+ K  
Sbjct  115  LWSNTSDFLNKPP  127



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +1

Query  235  RLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  414
            RLFGR+QP+HKVLGGGK ADVF+WRN  IS GVLGGATAIWILFE+L YHLL  +CHGLI
Sbjct  84   RLFGREQPIHKVLGGGKPADVFMWRNKNISAGVLGGATAIWILFELLGYHLLAFLCHGLI  143

Query  415  LALAVLFLWSNAXSFIKKSA  474
             +L VLFLWSNA SFI KS 
Sbjct  144  FSLGVLFLWSNASSFINKSP  163



>ref|XP_006402470.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
 gb|ESQ43923.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
Length=253

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 109/148 (74%), Gaps = 3/148 (2%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            E+    EESL+EKIA+KI       SS S + E EK  + S++ AK+ RLFGR++PVHKV
Sbjct  6    EKSVPTEESLIEKIAEKI---HDHDSSSSSESEHEKPDSPSALKAKIYRLFGREKPVHKV  62

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGG  ADVFLWR+ K+S  VLG ATAIW+LFE++EYH L+ VCH LI ALAVLFL SNA
Sbjct  63   LGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAVLFLLSNA  122

Query  451  XSFIKKSAphipevhipeepvLQFASAL  534
             +F+KKS P IPE+HI EE  L  ASAL
Sbjct  123  HAFMKKSPPKIPEIHIKEEHFLLIASAL  150



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 112/153 (73%), Gaps = 9/153 (6%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAE + + E   ESLV+KI +KI  HDSSSSSDS+ E+ +       + +KV RLFGR++
Sbjct  1    MAEHEGQRESAAESLVDKITEKISGHDSSSSSDSDNEKFDA------VKSKVFRLFGRER  54

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWRN KIS GVLGGAT +W+LFE+L YHL+T VC+  I  LAVLF
Sbjct  55   PVHKVLGGGKPADVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFFLAVLF  114

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSN   F+ K  P IPEV +PE+ V + ASAL
Sbjct  115  LWSNTSDFLNKPPPKIPEVVLPEQCVREVASAL  147



>ref|XP_010105716.1| Reticulon-like protein [Morus notabilis]
 gb|EXC05936.1| Reticulon-like protein [Morus notabilis]
Length=264

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 117/147 (80%), Gaps = 3/147 (2%)
 Frame = +1

Query  94   EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  273
            E   E ESL+EKIADKIH HDSSSSSDS+ ++  K +    + AK+ RLFGR++P+HKVL
Sbjct  3    EHAGEPESLIEKIADKIHGHDSSSSSDSDDDKPSKVEE---VQAKIFRLFGREKPIHKVL  59

Query  274  GGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAX  453
            GGGK ADVFLWRN K+S GVLGGAT +W+LFE+LEYHL+T VCH LIL+LA+LFLWSNA 
Sbjct  60   GGGKPADVFLWRNKKLSAGVLGGATILWVLFELLEYHLITLVCHILILSLALLFLWSNAS  119

Query  454  SFIKKSAphipevhipeepvLQFASAL  534
            + I KS P IPEV IPE+ VL+ AS L
Sbjct  120  TLINKSPPQIPEVRIPEKIVLEVASVL  146



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 108/141 (77%), Gaps = 4/141 (3%)
 Frame = +1

Query  112  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  291
            ESL++KI +KIH HDSSSS   + + +        + +K+ RLFGR++PVHKV GGGK A
Sbjct  17   ESLLDKITEKIHAHDSSSSDSDDDKGDTSAS----IKSKIYRLFGRERPVHKVFGGGKPA  72

Query  292  DVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKS  471
            D+FLWR+ K+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNA  FI KS
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKS  132

Query  472  AphipevhipeepvLQFASAL  534
             PHIP+VHIPE+PV++ ASAL
Sbjct  133  LPHIPQVHIPEDPVIEIASAL  153



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            V RLFGR+QPVHKVLGGGK AD+F+W+N K+S GVLGGATA W++FE++EYHLLT +CH 
Sbjct  67   VYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHV  126

Query  409  LILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            +I+ LAVLFLWSNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  127  MIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGL  168



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = +1

Query  106  EEESLVEKIADKIHRH---dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  276
            E ESL+EKI++KIH      SSSSSD ++ E++   +  S+ +KV RLFGR++PVHKVLG
Sbjct  22   ERESLMEKISEKIHHKGDSSSSSSSDDDENEKKSSPSPKSLKSKVYRLFGRERPVHKVLG  81

Query  277  GGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXS  456
            GGK AD+F+W+N K+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA  
Sbjct  82   GGKPADIFMWKNKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  457  FIKKSAphipevhipeepvLQFASAL  534
            FI KS P IPEVHIPEEP+LQ  S L
Sbjct  142  FIHKSPPKIPEVHIPEEPLLQLVSGL  167



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 98/128 (77%), Gaps = 2/128 (2%)
 Frame = +1

Query  97   DRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            + KEE+S++EK+++K+H     SSS SD +K+        ++M AK+ RLFGR++PV  V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSAAAAMKAKIYRLFGRERPVQSV  62

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGGK AD+ LWRN KIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  451  XSFIKKSA  474
             +FI KS 
Sbjct  123  STFIHKSP  130



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
            +K+ RLFGR++PVHKVLGGGK ADV LWRN KIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  54   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  113

Query  403  HGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            H LIL+LAV FLWS A +FI KS P IP+V IPE+ VL+ ASAL
Sbjct  114  HLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASAL  157



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + +K+ RLFGR++PVHKVLGGGK ADV LWRN KIS  VLGGAT +W+ FE+LEYHL+T 
Sbjct  41   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITL  100

Query  397  VCHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VCH LIL+LAV FLWS A +FI KS P IP+V IPE+ VL+ ASAL
Sbjct  101  VCHLLILSLAVFFLWSYASTFINKSPPQIPKVQIPEKTVLELASAL  146



>gb|EYU25170.1| hypothetical protein MIMGU_mgv1a012274mg [Erythranthe guttata]
Length=255

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = +1

Query  97   DRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  276
            + ++ ES+ E + DKI      S S S   + + K + S++ AK+ RLFGR+ PVHKVLG
Sbjct  7    EHEKHESVAESVMDKITEKFHGSDSSSSDSDNDIKSSASAVKAKIYRLFGRETPVHKVLG  66

Query  277  GGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXS  456
            GGK AD+FLWR+ K +  VLG ATAIW+LFE+LEYHLL+ VCH LIL LA+LFLWSNA +
Sbjct  67   GGKPADIFLWRDKKTTGYVLGVATAIWVLFELLEYHLLSLVCHFLILGLAILFLWSNAST  126

Query  457  FIKKSAphipevhipeepvLQFASAL  534
            FI KS P  PEV I E  V+  ASAL
Sbjct  127  FISKSRPKFPEVIISENVVVSVASAL  152



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = +1

Query  91   EEDRKEEESLVEKIADKIHRHdsssssdsekeeeek-kkttssMDAKVRRLFGRQQPVHK  267
            EE     +S+++K++DK+H    SSSS S+ ++E+K   + ++M +K+ RLFGR++PVH 
Sbjct  6    EESESVVQSMMDKVSDKLHGSGDSSSSSSDSDDEKKGSSSAAAMKSKIYRLFGREKPVHS  65

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLGGGK AD+ LWRN K S  VL GAT+IW+LFEV+EYHLL  VCH LIL+LA LFLWSN
Sbjct  66   VLGGGKPADLVLWRNKKTSGVVLAGATSIWLLFEVMEYHLLNLVCHCLILSLATLFLWSN  125

Query  448  AXSFIKKSA  474
            A +FI KS 
Sbjct  126  ACTFINKSP  134



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +1

Query  109  EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQ  288
            E SL+EK  +KIH  D  S+S S   +++K     S  +KV RLFGR++PVHKVLGGGK 
Sbjct  10   EPSLMEKNTEKIHVPDPPSASSSSDSDDDKPSVVDSAKSKVYRLFGREKPVHKVLGGGKP  69

Query  289  ADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKK  468
            AD+FLWR+ K+S GVLG ATAIWILFE++EYHL+T VCH LI  LA++FLW++A + I K
Sbjct  70   ADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVCHILIATLAIIFLWASASTHITK  129

Query  469  SAphipevhipeepvLQFASAL  534
            S P+IPEV +PE+ VL+ AS L
Sbjct  130  SPPNIPEVQLPEKCVLEVASVL  151



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 107/141 (76%), Gaps = 4/141 (3%)
 Frame = +1

Query  112  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  291
            ESL++KI +KIH HDSSSS   + + +        + +K+ RLFGR++PVHKV GGGK A
Sbjct  17   ESLLDKITEKIHAHDSSSSDSDDDKGDASAS----IKSKIYRLFGRERPVHKVFGGGKPA  72

Query  292  DVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKS  471
            D+FLWR+ K+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNA  FI KS
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKS  132

Query  472  AphipevhipeepvLQFASAL  534
             PHIP+VHIPE PV++ ASAL
Sbjct  133  LPHIPQVHIPEGPVVEIASAL  153



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5 [Fragaria vesca subsp. vesca]
Length=257

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 113/154 (73%), Gaps = 4/154 (3%)
 Frame = +1

Query  85   MAE--EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAK--VRRLFGRQ  252
            MAE  ED K E  L+EK+ +KIH H  SSSS S   + EK K  +    K  V RLFGR+
Sbjct  1    MAEHGEDAKAEHGLMEKMTEKIHDHHDSSSSSSSDSDTEKPKPAAEESPKEKVFRLFGRE  60

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVH VLGGGK ADVFLWRN KIS GVLGGAT +++LFE++EYHLLT +CH LI ALAV+
Sbjct  61   RPVHHVLGGGKPADVFLWRNKKISAGVLGGATVVYVLFELVEYHLLTLICHILIGALAVM  120

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSNA +   K+APHIPEV +PEEP LQ AS L
Sbjct  121  FLWSNAHTIFHKTAPHIPEVSLPEEPFLQVASEL  154



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 118/156 (76%), Gaps = 6/156 (4%)
 Frame = +1

Query  85   MAEEDRKEE---ESLVEKIADKIHRHdsssssds---ekeeeekkkttssMDAKVRRLFG  246
            MA+ +  EE   ESL++KI+ KIH H  SSSS S     ++E+K  + +S+  KV RLFG
Sbjct  1    MADHNEHEEVKSESLLDKISGKIHDHHDSSSSSSDSDNDKKEKKVSSPTSLKNKVFRLFG  60

Query  247  RQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  426
            R++P+H VLGGGK ADVFLWRN KIS   LG ATA+W+LFE+LEYHLLT + H  ILALA
Sbjct  61   REKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALA  120

Query  427  VLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VLFLWSNA +FI KS P IP+VHIPEEPVLQ ASA+
Sbjct  121  VLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAI  156



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            V RLFGR++PVHKVLGGGK AD+F+W+N K+S GVLGGAT  W+LFE++EYHLLT +CH 
Sbjct  62   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVLGGATVAWVLFELMEYHLLTLLCHV  121

Query  409  LILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            +I+ALAVLFLWSNA  FI KS P IPEVHIPE+P+LQ AS L
Sbjct  122  MIVALAVLFLWSNATMFIHKSPPKIPEVHIPEDPLLQLASGL  163



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = +1

Query  106  EEESLVEKIADKIHRH---dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLG  276
            E ESL+EK+++KIH      SSSSSD E E++    +  S+ +KV RLFGR++PVHKVLG
Sbjct  22   ERESLMEKLSEKIHHKGDSSSSSSSDDENEKKSSSSSPKSLKSKVYRLFGRERPVHKVLG  81

Query  277  GGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXS  456
            GGK AD+F+W++ K+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA  
Sbjct  82   GGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  457  FIKKSAphipevhipeepvLQFASAL  534
            FI KS P IPEVHIPEEP+LQ AS L
Sbjct  142  FIHKSPPKIPEVHIPEEPLLQLASGL  167



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + +K+ RLFGR++PVHKVLGGGK ADV LWRN KIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  42   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITL  101

Query  397  VCHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VCH LIL+LAV +LWSNA +FI KS P IP+V IPE+ VL+ ASAL
Sbjct  102  VCHLLILSLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASAL  147



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = +1

Query  106  EEESLVEKIADKIHRH----dsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  273
            E ESL+EK+++KIH       SSSS D  +++     +  S+ +KV RLFGR++PVHKVL
Sbjct  23   ERESLMEKLSEKIHHKGDSSSSSSSDDENEKKPSSSSSPRSLKSKVYRLFGRERPVHKVL  82

Query  274  GGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAX  453
            GGGK AD+F+W+N K+S GV+GGAT  W+LFE++EYHLL  +CH +I+ALAVLFLWSNA 
Sbjct  83   GGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLAVLCHVMIVALAVLFLWSNAT  142

Query  454  SFIKKSAphipevhipeepvLQFASAL  534
             FI KS P IPEVHIPEEP+LQ AS L
Sbjct  143  MFIHKSPPKIPEVHIPEEPLLQLASGL  169



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 114/153 (75%), Gaps = 10/153 (7%)
 Frame = +1

Query  85   MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K    EESL+EKI    H HDSSSSS+SE E+ +       + AK+ RLFGR++
Sbjct  1    MAEEIEKSVEVEESLMEKI----HHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  53

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGGK ADVFLWR+ K+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  54   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  113

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LWSNA +FIKKS P IPE+H+PEE  L  AS+L
Sbjct  114  LWSNAHTFIKKSPPQIPEIHVPEEAFLVIASSL  146



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 116/150 (77%), Gaps = 3/150 (2%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            M++ + K EESL+EKI++K   HD SSSS    +++  + +   M AKV RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKNKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             V GGGKQAD+FLWRN KIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWS
Sbjct  58   DVFGGGKQADIFLWRNKKISAGTLGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FI KS P IPEV IP++PVL+FA AL
Sbjct  118  NAATFIHKSPPRIPEVQIPKDPVLEFAQAL  147



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +1

Query  106  EEESLVEKIADKIHR-----HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKV  270
            E ESL++KI++KIH        SSSSSD EKE++EK  + SSM +KV RLFGR++PVHKV
Sbjct  23   ERESLMDKISEKIHHGGGDSSSSSSSSDDEKEKKEKPSSPSSMKSKVYRLFGREKPVHKV  82

Query  271  LGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  450
            LGGGK AD+F+W++ K+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  83   LGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  142

Query  451  XSFIKKSAphipevhipeepvLQFASAL  534
              FI KS P IPEVHIPEEPVLQ AS L
Sbjct  143  TMFIHKSPPKIPEVHIPEEPVLQLASGL  170



>ref|XP_004240710.1| PREDICTED: reticulon-like protein B6 [Solanum lycopersicum]
Length=253

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = +1

Query  106  EEESLVEKIADKIH-RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGG  282
            E +S V+ + DK++ +  S   S    +++ KK   +++  K+ RLFGR++PVHKVLGGG
Sbjct  7    ENDSFVDSVTDKVNDKFHSHDYSSDSDDDKGKKSPVNAVKTKIYRLFGREKPVHKVLGGG  66

Query  283  KQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFI  462
            K ADVFLWR+ K++ GVLG AT IW LFE+LEYHLLT VCH LI+A+AVLFLWSNA +FI
Sbjct  67   KPADVFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHILIVAVAVLFLWSNASAFI  126

Query  463  KKSAphipevhipeepvLQFASAL  534
              + PHIPEV +P++ VL  ASAL
Sbjct  127  NTAPPHIPEVVLPKDIVLSVASAL  150



>gb|EPS71452.1| hypothetical protein M569_03311 [Genlisea aurea]
Length=242

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 103/139 (74%), Gaps = 5/139 (4%)
 Frame = +1

Query  112  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVLGGGKQA  291
            ESLV+KI +KIH HDSSSSS    ++         + AK+ RLFGR++ VH +LGGGK A
Sbjct  3    ESLVDKIVEKIHAHDSSSSSSDSDDDRRSS-----LKAKINRLFGRERSVHGLLGGGKAA  57

Query  292  DVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIKKS  471
            DV LWRN  +S+GV+GGATAIWILF+VLEYH LT V H LIL L + F+WSN  +F+KKS
Sbjct  58   DVLLWRNKNVSLGVIGGATAIWILFDVLEYHFLTLVSHALILGLVIFFVWSNGSTFLKKS  117

Query  472  AphipevhipeepvLQFAS  528
             P IP+V IPE+PVL+F S
Sbjct  118  PPRIPQVIIPEKPVLEFVS  136



>gb|KJB19086.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=214

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = +1

Query  85   MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +  KV RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            H V GGGK AD+ LWRN KIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  117

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SNA  FI KS PHIPEV IP+EPVL+F  AL
Sbjct  118  SNATQFINKSTPHIPEVQIPKEPVLEFVMAL  148



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + +K+ RLFGR++PVHKVLGGGK ADV LWRN KIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  42   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITL  101

Query  397  VCHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VCH LIL+LAV +LWSNA +FI KS P IP V IPE+ VL+ ASAL
Sbjct  102  VCHLLILSLAVFYLWSNASNFINKSQPQIPXVQIPEKTVLELASAL  147



>gb|AFK34557.1| unknown [Medicago truncatula]
 gb|KEH18780.1| seed maturation protein [Medicago truncatula]
Length=267

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 107/155 (69%), Gaps = 2/155 (1%)
 Frame = +1

Query  76   ESAMAEEDRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAKVRRLFGR  249
            E +    DR   +SL+EKI +K+H     SS S      E +KK    S+  KV RLFGR
Sbjct  6    EKSTVTVDRDGGDSLLEKITEKLHFEDDSSSDSDSHSHSELDKKPVIESVKEKVFRLFGR  65

Query  250  QQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  429
            ++PVH VLGGGK ADVFLW+N K+S G L  ATAIW+ FE+LEYH LT +CH  IL LA+
Sbjct  66   EKPVHSVLGGGKPADVFLWKNKKLSAGTLATATAIWVFFELLEYHFLTLICHISILVLAL  125

Query  430  LFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LFLWSNA +F+ K+ PHIP VH+PEEP LQ ASAL
Sbjct  126  LFLWSNAHTFVHKTPPHIPIVHLPEEPFLQIASAL  160



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 121/150 (81%), Gaps = 4/150 (3%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE D+  E+S++E + +K+H H++SS SDS+  + + +  +  + +K+ RLFGR++PVH
Sbjct  1    MAEHDK--EDSVIESVMEKVHDHETSSDSDSDHGKPKSESDS--LKSKIYRLFGREKPVH  56

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KVLGGGK AD+FLWRN KIS G+LGGATAIW+LFE+LE HLLT VC+ LILAL +LFLWS
Sbjct  57   KVLGGGKPADIFLWRNKKISAGLLGGATAIWVLFELLECHLLTLVCYFLILALVLLFLWS  116

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FI KS PHIPEV IPEEPVLQ A+AL
Sbjct  117  NASTFINKSPPHIPEVRIPEEPVLQIAAAL  146



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + +K+ RLFGR++PVHKVLGGGK ADVFLWRN KIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  55   VKSKIFRLFGREKPVHKVLGGGKPADVFLWRNKKISASVLAGATVLWVFFELLEYHLITL  114

Query  397  VCHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VCH LI  LAV +LWSNA +FI KS P IP+V IPE+ VL+ ASAL
Sbjct  115  VCHLLITFLAVFYLWSNASNFINKSQPQIPKVQIPEKTVLELASAL  160



>ref|NP_191715.2| reticulon-like protein B6 [Arabidopsis thaliana]
 sp|Q6DBN4.1|RTNLF_ARATH RecName: Full=Reticulon-like protein B6; Short=AtRTNLB6 [Arabidopsis 
thaliana]
 gb|AAT70439.1| At3g61560 [Arabidopsis thaliana]
 gb|AAV85700.1| At3g61560 [Arabidopsis thaliana]
 gb|AEE80222.1| reticulon-like protein B6 [Arabidopsis thaliana]
Length=253

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 110/153 (72%), Gaps = 6/153 (4%)
 Frame = +1

Query  85   MAEEDRK---EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K   +EESL+EKIADKI       SS S   E EK ++ S++ AK+ RLFGR++
Sbjct  1    MAEELEKSMHKEESLMEKIADKI---HDHDSSSSSDSEHEKPESPSALKAKIYRLFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGG  ADVFLWR+ K+S  VLG ATAIW+LFE++EYH L+ VCH LI ALA LF
Sbjct  58   PVHKVLGGGLPADVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALF  117

Query  436  LWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            L SNA +F+ K+ P IPE+HI EE  L   SAL
Sbjct  118  LLSNAHAFMNKTPPKIPEIHIKEEHFLMIVSAL  150



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  K EES++EKIA+KIH       S S   + +  K ++S+  K+ RLFGR+QP+H
Sbjct  1    MAEE-HKHEESIMEKIAEKIHG--HDDGSSSSSSDSDDDKKSASLKTKIYRLFGREQPLH  57

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KV GGGK AD+FLWRN K+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWS  117

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            +A +FI KS PHIPEVHIPEE VL+ AS L
Sbjct  118  SATTFIHKSPPHIPEVHIPEEVVLELASGL  147



>ref|XP_008367699.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 112/155 (72%), Gaps = 5/155 (3%)
 Frame = +1

Query  85   MAE--EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkk---ttssMDAKVRRLFGR  249
            MAE  ++ K  ESL++K+ DKIH HDSSS+    +   +K      ++S+ +KV RLFGR
Sbjct  1    MAEHADEVKAAESLLDKVPDKIHGHDSSSALPPSEAVRDKGIGGGYSASLKSKVNRLFGR  60

Query  250  QQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  429
            ++PVH V GGGK AD+FLWR  K+S GVL   T IW+ FE+LEYHLLT V H LI+ + +
Sbjct  61   EKPVHHVFGGGKAADIFLWRGKKVSAGVLIALTIIWVFFELLEYHLLTLVSHLLIIGIVM  120

Query  430  LFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LFLWSNA +FI KS PHIP+V IPE+PVLQ ASA+
Sbjct  121  LFLWSNASTFINKSPPHIPQVQIPEKPVLQIASAI  155



>gb|KJB19089.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=212

 Score =   130 bits (327),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = +1

Query  85   MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +  KV RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            H V GGGK AD+ LWRN KIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  117

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SNA  FI KS PHIPEV IP+EPVL+F  AL
Sbjct  118  SNATQFINKSTPHIPEVQIPKEPVLEFVMAL  148



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            +  KV RLFGR++P+H VLGGGK ADVFLWRN KIS   LG ATA+W+LFE+LEYHLLT 
Sbjct  28   LKNKVFRLFGREKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTL  87

Query  397  VCHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            + H  ILALAVLFLWSNA +FI KS P IP+VHIPEEPVLQ ASA+
Sbjct  88   ISHLAILALAVLFLWSNASTFINKSPPKIPQVHIPEEPVLQIASAI  133



>gb|KJB19088.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=254

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = +1

Query  85   MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +  KV RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            H V GGGK AD+ LWRN KIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  117

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SNA  FI KS PHIPEV IP+EPVL+F  AL
Sbjct  118  SNATQFINKSTPHIPEVQIPKEPVLEFVMAL  148



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = +1

Query  109  EESLVEKIADKIHRHdsssssdsek-eeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  285
            EE+L+E++ +KI     SSSS     E+ +    T ++ +K+ RLFGR++PVH++LGGGK
Sbjct  6    EETLIEQVTEKIRDGVDSSSSSDSDDEKSKASVVTEAVKSKINRLFGREKPVHQILGGGK  65

Query  286  QADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIK  465
             ADVFLW+N K S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA   I 
Sbjct  66   PADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFLIN  125

Query  466  KSA  474
            KS 
Sbjct  126  KSP  128



>gb|KJB19087.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
 gb|KJB19090.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=252

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = +1

Query  85   MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +  KV RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            H V GGGK AD+ LWRN KIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  117

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SNA  FI KS PHIPEV IP+EPVL+F  AL
Sbjct  118  SNATQFINKSTPHIPEVQIPKEPVLEFVMAL  148



>gb|KJB19091.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=241

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = +1

Query  85   MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +  KV RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            H V GGGK AD+ LWRN KIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  117

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SNA  FI KS PHIPEV IP+EPVL+F  AL
Sbjct  118  SNATQFINKSTPHIPEVQIPKEPVLEFVMAL  148



>gb|AFK48295.1| unknown [Lotus japonicus]
Length=193

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 110/157 (70%), Gaps = 13/157 (8%)
 Frame = +1

Query  85   MAEEDRKEE-------ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLF  243
            MAEE  +         ESL++KI+DK+H HDSSS SDSEK           +  K+ RLF
Sbjct  1    MAEESAESTVTTAATGESLLDKISDKLHGHDSSSDSDSEKPSLSS------VKQKIFRLF  54

Query  244  GRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  423
            GR++P+H VLGGGK ADV LW+N K+S G LG ATA+W+ FE+LEYHLLT VCH LIL++
Sbjct  55   GREKPLHSVLGGGKPADVLLWKNKKVSAGALGVATAVWLFFELLEYHLLTLVCHILILSI  114

Query  424  AVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
             +LFLWSNA + + K+ P IP  H+PEEP L+ ASAL
Sbjct  115  TLLFLWSNAHTLLHKAPPRIPVFHLPEEPFLEIASAL  151



>gb|KHN40449.1| Reticulon-like protein B5 [Glycine soja]
Length=259

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 119/156 (76%), Gaps = 6/156 (4%)
 Frame = +1

Query  85   MAEEDRKE------EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  246
            MAEE  +       +ESL++KI +K+H HDSSSSS S+ + + +K  TSS+  KV RLFG
Sbjct  1    MAEEPERTVTTGAADESLLDKITEKLHGHDSSSSSSSDSDSDSEKTVTSSVKDKVFRLFG  60

Query  247  RQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  426
            R++PVH V G GK ADV LWRN KIS G+LGGATA+W+LFE+LEYHLLT VCH LIL LA
Sbjct  61   RERPVHSVFGAGKPADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLA  120

Query  427  VLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VLFLWSNA +FI KS P IPE H+PEEP LQ ASAL
Sbjct  121  VLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASAL  156



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 111/146 (76%), Gaps = 2/146 (1%)
 Frame = +1

Query  103  KEEESLVEKIADKIHRHdsssssdseke--eeekkkttssMDAKVRRLFGRQQPVHKVLG  276
            ++E SL+EK+ DKIH  D  SSS S  +   E+ +K T S+ AKV R+FGR++PVH VLG
Sbjct  13   EDEPSLLEKMGDKIHGGDHHSSSSSSSDSDNEKSEKKTESVKAKVFRIFGRERPVHHVLG  72

Query  277  GGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXS  456
            GGK ADVFLWRN K+S GVL GAT IW+LFE+L+YHLLT V H LI ALA+LFLWSNA +
Sbjct  73   GGKXADVFLWRNKKVSAGVLSGATVIWVLFELLQYHLLTLVGHILIGALAILFLWSNAHA  132

Query  457  FIKKSAphipevhipeepvLQFASAL  534
            FI K+ P IPEV +PEEP LQ AS L
Sbjct  133  FIHKTPPRIPEVRLPEEPFLQVASEL  158



>gb|KJB52681.1| hypothetical protein B456_008G272900 [Gossypium raimondii]
Length=129

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + AKV RLFGR++P+H+VLG GK AD+ LWRN K+S GVLGG T++W LFE+L+YHL+T 
Sbjct  42   LKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHLITL  101

Query  397  VCHGLILALAVLFLWSNAXSFIKKSA  474
            +CH +ILAL+VLFLWSNA +FI KS 
Sbjct  102  ICHLMILALSVLFLWSNASNFINKSC  127



>ref|NP_001030913.1| reticulon-like protein B6 [Arabidopsis thaliana]
 emb|CAB71086.1| putative protein [Arabidopsis thaliana]
 gb|AEE80223.1| reticulon-like protein B6 [Arabidopsis thaliana]
Length=264

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 6/131 (5%)
 Frame = +1

Query  85   MAEEDRK---EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQ  255
            MAEE  K   +EESL+EKIADKI       SS S   E EK ++ S++ AK+ RLFGR++
Sbjct  1    MAEELEKSMHKEESLMEKIADKI---HDHDSSSSSDSEHEKPESPSALKAKIYRLFGREK  57

Query  256  PVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  435
            PVHKVLGGG  ADVFLWR+ K+S  VLG ATAIW+LFE++EYH L+ VCH LI ALA LF
Sbjct  58   PVHKVLGGGLPADVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALF  117

Query  436  LWSNAXSFIKK  468
            L SNA +F+ K
Sbjct  118  LLSNAHAFMNK  128



>ref|NP_001240231.1| uncharacterized protein LOC100778096 [Glycine max]
 gb|ACU20901.1| unknown [Glycine max]
Length=259

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 118/156 (76%), Gaps = 6/156 (4%)
 Frame = +1

Query  85   MAEEDRKE------EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  246
            MAEE          +ESL++KI +K+H HDSSSSS S+ + + +K  TSS+  KV RLFG
Sbjct  1    MAEEPESTVTNGAADESLLDKITEKLHGHDSSSSSSSDSDSDSEKTVTSSVKDKVFRLFG  60

Query  247  RQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  426
            R++PVH V G GK ADV LWRN KIS G+LGGATA+W+LFE+LEYHLLT VCH LIL LA
Sbjct  61   RERPVHSVFGAGKPADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLA  120

Query  427  VLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VLFLWSNA +FI KS P IPE H+PEEP LQ ASAL
Sbjct  121  VLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASAL  156



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 112/151 (74%), Gaps = 8/151 (5%)
 Frame = +1

Query  106  EEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMDAKVRRLFGRQQPV  261
            E ESL++KI++KIH           S    D   +++EK  + SSM +KV RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEDDKNDKKKEKPSSPSSMKSKVYRLFGREKPV  81

Query  262  HKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  441
            HKVLGGGK AD+F+W++ K+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLW  141

Query  442  SNAXSFIKKSAphipevhipeepvLQFASAL  534
            SN   FI KS P IP+VHIPEEPVLQ AS L
Sbjct  142  SNVTRFIHKSPPKIPQVHIPEEPVLQLASGL  172



>ref|XP_006360189.1| PREDICTED: reticulon-like protein B2-like [Solanum tuberosum]
Length=253

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
             K+ RLFGR++P+HKVLGGGK AD+FLWR+ K++ GVLG AT IW LFE+LEYHLLT VC
Sbjct  47   TKIYRLFGREKPLHKVLGGGKPADIFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVC  106

Query  403  HGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            H LI+A+AVLFLWSNA +FI  + P IPEV +P++ VL  ASAL
Sbjct  107  HILIVAVAVLFLWSNASAFINTAPPQIPEVVLPKDIVLGVASAL  150



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 115/155 (74%), Gaps = 6/155 (4%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIH------RHdsssssdsekeeeekkkttssMDAKVRRLFGR  249
            AE+  K+EE+L+EK A+K+H         SS S   +K + +   + +S+  K+ RLFGR
Sbjct  5    AEDLDKKEETLIEKPAEKVHGDHDSSSSASSESDSEKKVKSKPASSPTSVKDKIFRLFGR  64

Query  250  QQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  429
            ++PVH+V GGGK ADVFLWRN +IS  VLGGATA+W+LFE+LEYHLLT VCH LILALA+
Sbjct  65   EKPVHQVFGGGKPADVFLWRNKRISAAVLGGATAVWVLFELLEYHLLTLVCHILILALAI  124

Query  430  LFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            LFLWSNA +FI KS P IPEV + EEP LQ A+A+
Sbjct  125  LFLWSNATTFINKSPPRIPEVRLSEEPFLQVAAAV  159



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +1

Query  223  AKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVC  402
            AKV RLFGR++PVH+VLGGGK ADV LWR+ KIS G L  ATAIW++FE++ YHLLT VC
Sbjct  46   AKVYRLFGREKPVHQVLGGGKSADVMLWRDKKISAGALSAATAIWVMFELVGYHLLTFVC  105

Query  403  HGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            HGLIL+L +LFLWS A +FI KS P IPEV IPE+  +Q A  L
Sbjct  106  HGLILSLVILFLWSKACTFINKSPPRIPEVSIPEDQAVQVARTL  149



>ref|XP_007209494.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
 gb|EMJ10693.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
Length=257

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 107/154 (69%), Gaps = 4/154 (3%)
 Frame = +1

Query  85   MAE--EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkt--tssMDAKVRRLFGRQ  252
            MAE  E+ K  ESL++KIADKIH HDS  S   E   E+   +   +S+ AK   LFGR+
Sbjct  1    MAEHTEEVKAAESLMDKIADKIHGHDSPVSPAVESLHEKAVSSGHAASLKAKAYSLFGRE  60

Query  253  QPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  432
            +PVH V GGGK ADVFLWR+ K S  VL   T IW+ FE+L YHLLT + H LIL LA+L
Sbjct  61   KPVHNVFGGGKAADVFLWRDKKGSASVLIAITIIWVFFELLGYHLLTLMAHCLILVLAML  120

Query  433  FLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            FLWSNA +FI KS P IP+V IPE+PVLQ ASA+
Sbjct  121  FLWSNASTFINKSPPRIPQVKIPEKPVLQIASAI  154



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 108/150 (72%), Gaps = 6/150 (4%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE  K EES++EKIA+KI          S   + + +K  SS+  K+ RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKI-----HGHDGSSSSDSDDEKKASSIKTKIFRLFGREKPVH  54

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KV GGGK AD+FLWRN K+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWS  114

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            +A +FI K  PHIPEVHIPEE VLQ AS L
Sbjct  115  SATTFIHKKPPHIPEVHIPEEVVLQLASGL  144



>gb|KDO86332.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=213

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE +    E  +EK+++KIH    SSSS S   + E+    SS+ A + RLFGR++PVH
Sbjct  1    MAEREENPAEPPMEKVSEKIHD-HDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVH  59

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            +V GGGK ADVFLWRN KIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+
Sbjct  60   QVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWA  119

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FIKK+ P IPEVH+PEEP LQ ASA 
Sbjct  120  NAHTFIKKAPPCIPEVHLPEEPFLQVASAF  149



>ref|XP_006444935.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
 ref|XP_006491199.1| PREDICTED: reticulon-like protein B5-like [Citrus sinensis]
 gb|ESR58175.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
Length=249

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE +    E  +EK+++KIH    SSSS S   + E+    SS+ A + RLFGR++PVH
Sbjct  1    MAEREENPAEPPMEKVSEKIHD-HDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVH  59

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            +V GGGK ADVFLWRN KIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+
Sbjct  60   QVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWA  119

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FIKK+ P IPEVH+PEEP LQ ASA 
Sbjct  120  NAHTFIKKAPPCIPEVHLPEEPFLQVASAF  149



>gb|KDO86331.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=249

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE +    E  +EK+++KIH    SSSS S   + E+    SS+ A + RLFGR++PVH
Sbjct  1    MAEREENPAEPPMEKVSEKIHD-HDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVH  59

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            +V GGGK ADVFLWRN KIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+
Sbjct  60   QVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWA  119

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FIKK+ P IPEVH+PEEP LQ ASA 
Sbjct  120  NAHTFIKKAPPCIPEVHLPEEPFLQVASAF  149



>ref|XP_011037168.1| PREDICTED: reticulon-like protein B5 [Populus euphratica]
Length=252

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAE+     ES++ KI++KIH H+SSSSSDSE + E+K   + S+  K+ RLFGR++PVH
Sbjct  1    MAEQSENPIESIMGKISEKIH-HESSSSSDSESDSEKKSYPSESVKDKIWRLFGREKPVH  59

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            +VLGGGK ADVFLWRN K+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+LFLWS
Sbjct  60   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALLFLWS  119

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FI KS P IP+VH+PEEPVLQ ASAL
Sbjct  120  NAHAFIYKSPPRIPQVHLPEEPVLQVASAL  149



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + AK+ RLFGR++PVH+VLGGGK ADV LWRN KIS   LGG T  W+ FE+LEYHLLT 
Sbjct  46   VKAKIFRLFGREKPVHQVLGGGKPADVLLWRNKKISASFLGGVTGAWVFFELLEYHLLTL  105

Query  397  VCHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VC+ LI++LA+LFLWSNA +FI KS P IPEVHIPE+P LQ  SAL
Sbjct  106  VCYTLIVSLAILFLWSNAHTFIHKSPPRIPEVHIPEDPFLQVVSAL  151



>ref|XP_009772131.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=260

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 109/150 (73%), Gaps = 7/150 (5%)
 Frame = +1

Query  106  EEESLVEKIADKIH-------RHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            E +S VE + DK++        HDSSSSSDSE E ++ K    +  AK+ RLFGR++PVH
Sbjct  7    EHDSFVETVMDKVNVDKLHVAHHDSSSSSDSEDENKDTKSPVDADKAKIYRLFGRERPVH  66

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
            KVLGGGK A++FLWR+ K+S GVLG AT IW LFE+L+YHLLT VCH LI+A+ VLFLWS
Sbjct  67   KVLGGGKPAEIFLWRDKKVSAGVLGFATVIWALFELLQYHLLTLVCHILIVAITVLFLWS  126

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            NA +FI  + P IPEV +P + VL  ASAL
Sbjct  127  NASAFINTAPPQIPEVVLPRDIVLGVASAL  156



>ref|XP_010053196.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW77460.1| hypothetical protein EUGRSUZ_D01798 [Eucalyptus grandis]
Length=256

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 104/147 (71%), Gaps = 0/147 (0%)
 Frame = +1

Query  94   EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHKVL  273
            E+ K  ESL+EKI+          SS S+ +++   +   +  AKV RLFGR++PVH+VL
Sbjct  5    EEAKGGESLLEKISGNFGGGGGGGSSSSDSDDDRVAEAAEAAKAKVYRLFGRERPVHQVL  64

Query  274  GGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAX  453
            GGGK ADVFLWRN K+S G LG  T IW LFE+ EYHLLT   H LIL LAVLFLWSNA 
Sbjct  65   GGGKPADVFLWRNKKVSAGALGVVTVIWALFELAEYHLLTLAAHCLILTLAVLFLWSNAH  124

Query  454  SFIKKSAphipevhipeepvLQFASAL  534
            +FI KS P IPEV IPEEPVLQFASAL
Sbjct  125  AFIHKSPPRIPEVSIPEEPVLQFASAL  151



>ref|XP_004298843.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=246

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 102/150 (68%), Gaps = 7/150 (5%)
 Frame = +1

Query  85   MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVH  264
            MAEE +   ESL+EKI DKI  H  S + +    +  +      M  KV R+FGR++PVH
Sbjct  1    MAEEVK--AESLMEKIEDKILGHHDSPAPEVVHHDSPRS-----MQDKVFRIFGRERPVH  53

Query  265  KVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  444
             V GGGK AD+FLWR+ K+S G+LGGAT +W+LFE+LEYHLLT V H LI A+ + FLWS
Sbjct  54   HVFGGGKLADIFLWRDKKLSGGILGGATVMWLLFELLEYHLLTLVAHVLIAAITLFFLWS  113

Query  445  NAXSFIKKSAphipevhipeepvLQFASAL  534
            N   FI KS P IPE+ IPE+ +LQ  S++
Sbjct  114  NGLGFINKSPPKIPEIQIPEKTLLQIVSSI  143



>ref|XP_008375931.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=255

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            +  KV R+FGR++PVH VLGGGK ADVFLWRN K+S GVLGGAT +WILFE+LEY+LLT 
Sbjct  48   VKTKVFRIFGREKPVHHVLGGGKTADVFLWRNKKVSGGVLGGATVVWILFELLEYNLLTL  107

Query  397  VCHGLILALAVLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            V H LI  LA+LFLWSNA +FI K+ P IPEV +PEEP LQ AS L
Sbjct  108  VAHILIATLAILFLWSNAHTFIHKTPPRIPEVRLPEEPFLQVASEL  153



>ref|XP_009406784.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406785.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = +1

Query  109  EESLVEKIADKIHRHdsssssdsek-eeeekkkttssMDAKVRRLFGRQQPVHKVLGGGK  285
            EE+L+E++ +KI     SSSS     E+ +    T ++ +K+ RLFGR++PVH++LGGGK
Sbjct  6    EETLIEQVTEKIRDGVDSSSSSDSDDEKSKASVVTEAVKSKINRLFGREKPVHQILGGGK  65

Query  286  QADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAXSFIK  465
             ADVFLW+N K S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA   I 
Sbjct  66   PADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFLIN  125

Query  466  KSA  474
              +
Sbjct  126  NRS  128



>gb|KJB52680.1| hypothetical protein B456_008G272900 [Gossypium raimondii]
Length=142

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + AKV RLFGR++P+H+VLG GK AD+ LWRN K+S GVLGG T++W LFE+L+YHL+T 
Sbjct  42   LKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHLITL  101

Query  397  VCHGLILALAVLFLWSNAXSFIKK  468
            +CH +ILAL+VLFLWSNA +FI K
Sbjct  102  ICHLMILALSVLFLWSNASNFINK  125



>gb|KJB52682.1| hypothetical protein B456_008G272900 [Gossypium raimondii]
Length=183

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  217  MDAKVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTA  396
            + AKV RLFGR++P+H+VLG GK AD+ LWRN K+S GVLGG T++W LFE+L+YHL+T 
Sbjct  42   LKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHLITL  101

Query  397  VCHGLILALAVLFLWSNAXSFIKKSA  474
            +CH +ILAL+VLFLWSNA +FI  S 
Sbjct  102  ICHLMILALSVLFLWSNASNFINNSP  127



>ref|XP_010538815.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 119/156 (76%), Gaps = 4/156 (3%)
 Frame = +1

Query  76   ESAMAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFG  246
            ESA A E   E    ESL++KI++KIH H   SSS S  E+E++  + SS+ AKV RLFG
Sbjct  9    ESAAAPEPAVEILERESLLDKISEKIH-HGDDSSSSSSDEDEKEASSPSSLKAKVYRLFG  67

Query  247  RQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  426
            R++PVHKVLGGGK AD+F+WR+ K+S  VLGG TA+W+LFE++EYHLL+ + H LI+ LA
Sbjct  68   REKPVHKVLGGGKPADIFMWRDKKMSASVLGGITAVWVLFELMEYHLLSLLSHVLIVVLA  127

Query  427  VLFLWSNAXSFIKKSAphipevhipeepvLQFASAL  534
            VLF+WSNA  FI KS P IPEVHIPEEP+LQ AS L
Sbjct  128  VLFIWSNASMFINKSPPKIPEVHIPEEPILQLASGL  163



>ref|XP_002275520.1| PREDICTED: reticulon-like protein B5 [Vitis vinifera]
 emb|CBI22609.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 108/149 (72%), Gaps = 3/149 (2%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            A E     ES++E I  K+H +DS SSSDSE  ++   +    + +K  RLFGR++P+HK
Sbjct  5    AGESESAMESVMETITAKLHGYDSPSSSDSEDGKKSLVEA---VKSKSYRLFGREKPLHK  61

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLGGGK ADVFLWRN KIS  VLG ATAIW+LFE+LEY LL  +CH L+L+LA LFLWSN
Sbjct  62   VLGGGKPADVFLWRNKKISASVLGCATAIWVLFEMLEYQLLPLLCHILMLSLASLFLWSN  121

Query  448  AXSFIKKSAphipevhipeepvLQFASAL  534
            A   IKKS P+IPEV +PE+ V++  SAL
Sbjct  122  ASIVIKKSPPNIPEVGVPEKAVMEITSAL  150



>gb|EMT19773.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=286

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  226  KVRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCH  405
            K+ RLFGR+QP+HKVLGGGK ADVF+WRN  IS GVLGGATAIWILFE+L YHLL  + H
Sbjct  81   KMFRLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGH  140

Query  406  GLILALAVLFLWSNAXSFIKKSA  474
             LI +L VLFLWSNA SFI KS 
Sbjct  141  ALIFSLGVLFLWSNASSFINKSP  163



>emb|CAN77759.1| hypothetical protein VITISV_034907 [Vitis vinifera]
Length=245

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 107/149 (72%), Gaps = 3/149 (2%)
 Frame = +1

Query  88   AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAKVRRLFGRQQPVHK  267
            A E     ES++E I  K+H + S SSSDSE  ++   +    + +K  RLFGR++P+HK
Sbjct  5    AGESESAMESVMEXITAKLHGYXSPSSSDSEDGKKSLVEA---VKSKSYRLFGREKPLHK  61

Query  268  VLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  447
            VLGGGK ADVFLWRN KIS  VLG ATAIW+LFE+LEY LL  +CH L+L+LA LFLWSN
Sbjct  62   VLGGGKPADVFLWRNKKISASVLGCATAIWVLFEMLEYQLLPLLCHILMLSLASLFLWSN  121

Query  448  AXSFIKKSAphipevhipeepvLQFASAL  534
            A   IKKS P+IPEV +PE+ V++  SAL
Sbjct  122  ASIVIKKSPPNIPEVGVPEKAVMEITSAL  150



>ref|XP_004980276.1| PREDICTED: uncharacterized protein LOC101782657, partial [Setaria 
italica]
Length=348

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +1

Query  229  VRRLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHG  408
            V RLFGR+QP+HK LGGGK ADV LWRN  IS GVL G TAIWILFE L YHLLT  CHG
Sbjct  47   VFRLFGREQPIHKALGGGKPADVLLWRNRNISAGVLDGVTAIWILFECLGYHLLTFNCHG  106

Query  409  LILALAVLFLWSNAXSFIKKSA  474
            LI +L VLFLWSNA SFI KS 
Sbjct  107  LIFSLGVLFLWSNASSFINKSP  128



>gb|EMS62854.1| Reticulon-like protein B1 [Triticum urartu]
Length=237

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +1

Query  235  RLFGRQQPVHKVLGGGKQADVFLWRNXKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  414
            RLFGR+QP+HKVLGGGK ADVF+WRN  IS GVLGGATAIWILFE+L YHLL  + H LI
Sbjct  3    RLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALI  62

Query  415  LALAVLFLWSNAXSFIKKSA  474
             +L VLFLWSNA SFI KS 
Sbjct  63   FSLGVLFLWSNASSFINKSP  82



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800