BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H02

Length=264
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1         65.9    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_008387370.1|  PREDICTED: putative polyol transporter 1         65.5    4e-10   Malus domestica [apple tree]
ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like             65.5    4e-10   Sesamum indicum [beniseed]
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1         64.7    7e-10   Pyrus x bretschneideri [bai li]
ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like             63.9    1e-09   Nicotiana sylvestris
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1         63.5    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like             62.0    6e-09   Nicotiana tomentosiformis
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg           60.5    2e-08   Eutrema salsugineum [saltwater cress]
gb|KHN39768.1|  Polyol transporter 5                                  60.5    2e-08   Glycine soja [wild soybean]
ref|NP_001236592.1|  sorbitol-like transporter                        60.5    2e-08   
gb|AAT06053.2|  sorbitol transporter                                  60.1    3e-08   Malus domestica [apple tree]
gb|AFI61955.1|  polyol transporter                                    59.7    3e-08   Camellia sinensis [black tea]
ref|XP_008350306.1|  PREDICTED: putative polyol transporter 1         58.2    4e-08   
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                  59.3    5e-08   Arabis alpina [alpine rockcress]
gb|KHN25361.1|  Polyol transporter 5                                  59.3    5e-08   Glycine soja [wild soybean]
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like             59.3    5e-08   
emb|CDO97075.1|  unnamed protein product                              59.3    5e-08   Coffea canephora [robusta coffee]
gb|ABK29439.1|  sugar transport protein                               59.3    5e-08   Coffea canephora [robusta coffee]
emb|CAJ29291.1|  putative polyol transporter protein 4                59.3    5e-08   Lotus japonicus
ref|XP_007200585.1|  hypothetical protein PRUPE_ppa007633mg           58.5    5e-08   
ref|XP_008393068.1|  PREDICTED: putative polyol transporter 1         59.3    6e-08   Malus domestica [apple tree]
ref|NP_001281033.1|  polyol transporter 5-like                        58.9    6e-08   Malus domestica [apple tree]
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like             58.9    6e-08   Prunus mume [ume]
ref|XP_009375627.1|  PREDICTED: putative polyol transporter 1         58.9    7e-08   Pyrus x bretschneideri [bai li]
gb|AGG19155.1|  sorbitol transporter                                  58.9    8e-08   Pyrus pyrifolia [sha li]
ref|XP_011088358.1|  PREDICTED: polyol transporter 5-like             58.5    8e-08   Sesamum indicum [beniseed]
ref|XP_009344431.1|  PREDICTED: putative polyol transporter 1         58.5    8e-08   Pyrus x bretschneideri [bai li]
emb|CAP58706.1|  putative polyol transporter protein 1                58.5    9e-08   Hevea brasiliensis [jebe]
gb|EYU42630.1|  hypothetical protein MIMGU_mgv1a0059091mg             56.2    9e-08   Erythranthe guttata [common monkey flower]
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like             57.8    2e-07   Nicotiana sylvestris
gb|AAM44082.1|  putative sorbitol transporter                         57.8    2e-07   Prunus cerasus [pie cherry]
gb|KEH30426.1|  polyol/monosaccharide transporter 1                   56.6    4e-07   Medicago truncatula
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like             56.6    4e-07   Eucalyptus grandis [rose gum]
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like             56.6    5e-07   Nicotiana tomentosiformis
gb|AGY96955.1|  polyol transporter 1                                  56.2    5e-07   Vitis vinifera
gb|KDP46230.1|  hypothetical protein JCGZ_10070                       56.2    6e-07   Jatropha curcas
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                  56.2    6e-07   Vitis vinifera
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like             56.2    6e-07   Cicer arietinum [garbanzo]
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                  56.2    6e-07   Brassica rapa
emb|CDX95491.1|  BnaC01g33830D                                        55.8    7e-07   
ref|XP_006365518.1|  PREDICTED: polyol transporter 5-like             55.8    8e-07   Solanum tuberosum [potatoes]
ref|XP_008387369.1|  PREDICTED: putative polyol transporter 1 iso...  55.8    9e-07   
ref|XP_004170410.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...  55.8    9e-07   
ref|XP_004148857.1|  PREDICTED: polyol transporter 5-like             55.8    9e-07   Cucumis sativus [cucumbers]
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g           55.5    1e-06   Phaseolus vulgaris [French bean]
ref|XP_003539021.2|  PREDICTED: polyol transporter 5-like             54.7    1e-06   
gb|EPS69995.1|  sugar transport protein                               55.1    1e-06   Genlisea aurea
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like             55.1    2e-06   Eucalyptus grandis [rose gum]
emb|CAP58707.1|  putative polyol transported protein 2                55.1    2e-06   Hevea brasiliensis [jebe]
emb|CDY61985.1|  BnaC03g73840D                                        54.7    2e-06   Brassica napus [oilseed rape]
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                  54.7    2e-06   Brassica rapa
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like             54.7    2e-06   Populus euphratica
ref|XP_006349565.1|  PREDICTED: polyol transporter 5-like             54.3    3e-06   Solanum tuberosum [potatoes]
ref|XP_004299107.1|  PREDICTED: polyol transporter 5-like             53.9    3e-06   Fragaria vesca subsp. vesca
ref|NP_001287655.1|  polyol transporter 5-like                        53.9    3e-06   Solanum lycopersicum
ref|XP_002313809.1|  putative sorbitol transporter family protein     53.5    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_002519083.1|  sugar transporter, putative                      53.5    4e-06   Ricinus communis
gb|ACB56939.1|  mannitol transporter                                  53.1    5e-06   Artemisia annua [sweet Annie]
ref|XP_003607077.1|  Sorbitol-like transporter                        53.1    6e-06   Medicago truncatula
ref|XP_007199207.1|  hypothetical protein PRUPE_ppa021762mg           53.1    7e-06   Prunus persica
ref|XP_007201628.1|  hypothetical protein PRUPE_ppa021469mg           53.1    7e-06   
ref|XP_008236860.1|  PREDICTED: putative polyol transporter 1         53.1    7e-06   Prunus mume [ume]
gb|ACB86853.1|  mannitol transporter                                  52.0    1e-05   Citrus sinensis [apfelsine]
gb|KHN25431.1|  Polyol transporter 5                                  52.0    2e-05   Glycine soja [wild soybean]
ref|XP_004300990.1|  PREDICTED: polyol transporter 5-like             52.0    2e-05   Fragaria vesca subsp. vesca
gb|KHG12832.1|  Polyol transporter 5 -like protein                    49.3    2e-05   Gossypium arboreum [tree cotton]
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like             51.6    2e-05   Glycine max [soybeans]
ref|XP_007131748.1|  hypothetical protein PHAVU_011G038700g           51.6    2e-05   Phaseolus vulgaris [French bean]
ref|XP_008236773.1|  PREDICTED: putative polyol transporter 1         51.6    2e-05   Prunus mume [ume]
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                  51.6    2e-05   Populus euphratica
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g           51.2    3e-05   Phaseolus vulgaris [French bean]
emb|CDP10064.1|  unnamed protein product                              51.2    3e-05   Coffea canephora [robusta coffee]
ref|XP_007200117.1|  hypothetical protein PRUPE_ppa018884mg           51.2    3e-05   Prunus persica
ref|XP_007200254.1|  hypothetical protein PRUPE_ppa015090mg           51.2    3e-05   Prunus persica
ref|XP_007200033.1|  hypothetical protein PRUPE_ppa024323mg           51.2    3e-05   
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5              51.2    3e-05   
gb|AAY86779.1|  putative sugar transporter protein                    50.1    3e-05   Noccaea caerulescens
emb|CDP17996.1|  unnamed protein product                              50.8    4e-05   Coffea canephora [robusta coffee]
emb|CDP18000.1|  unnamed protein product                              50.8    4e-05   Coffea canephora [robusta coffee]
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g           50.8    4e-05   Phaseolus vulgaris [French bean]
ref|XP_009780685.1|  PREDICTED: polyol transporter 5-like             48.5    4e-05   Nicotiana sylvestris
ref|XP_006487181.1|  PREDICTED: polyol transporter 5-like             50.8    4e-05   Citrus sinensis [apfelsine]
ref|XP_006423216.1|  hypothetical protein CICLE_v10028174mg           50.4    5e-05   Citrus clementina [clementine]
ref|NP_001280902.1|  putative polyol transporter 1                    50.4    5e-05   Malus domestica [apple tree]
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like             50.4    5e-05   Glycine max [soybeans]
ref|XP_006423215.1|  hypothetical protein CICLE_v10028170mg           50.4    5e-05   Citrus clementina [clementine]
gb|KGN44323.1|  Sugar transporter                                     50.4    5e-05   Cucumis sativus [cucumbers]
ref|XP_006487182.1|  PREDICTED: polyol transporter 5-like             50.4    6e-05   Citrus sinensis [apfelsine]
gb|ABX71752.1|  mannitol transporter                                  50.1    6e-05   Apium graveolens
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g           50.1    6e-05   Populus trichocarpa [western balsam poplar]
emb|CDP17999.1|  unnamed protein product                              50.1    7e-05   Coffea canephora [robusta coffee]
ref|XP_010527594.1|  PREDICTED: polyol transporter 5-like isoform X4  50.1    7e-05   Tarenaya hassleriana [spider flower]
ref|XP_010527593.1|  PREDICTED: polyol transporter 5-like isoform X3  50.1    7e-05   Tarenaya hassleriana [spider flower]
ref|XP_010527592.1|  PREDICTED: polyol transporter 5-like isoform X2  50.1    7e-05   Tarenaya hassleriana [spider flower]
ref|XP_010527591.1|  PREDICTED: polyol transporter 5-like isoform X1  50.1    7e-05   Tarenaya hassleriana [spider flower]
ref|XP_010096202.1|  Polyol transporter 5                             50.1    7e-05   Morus notabilis
ref|XP_008447045.1|  PREDICTED: polyol transporter 5-like             50.1    8e-05   Cucumis melo [Oriental melon]
ref|XP_010527590.1|  PREDICTED: polyol transporter 5-like             49.7    9e-05   Tarenaya hassleriana [spider flower]
gb|KJB12315.1|  hypothetical protein B456_002G011400                  49.7    1e-04   Gossypium raimondii
ref|XP_002885281.1|  ATPLT5                                           49.3    1e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1         49.3    1e-04   Pyrus x bretschneideri [bai li]
ref|NP_001289249.1|  polyol transporter 5-like                        49.3    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1         49.3    1e-04   
ref|XP_004149937.1|  PREDICTED: polyol transporter 5-like             49.3    1e-04   
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1         48.9    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1         48.9    2e-04   
ref|XP_009344435.1|  PREDICTED: putative polyol transporter 1         48.5    3e-04   Pyrus x bretschneideri [bai li]
gb|KJB32189.1|  hypothetical protein B456_005G228500                  48.5    3e-04   Gossypium raimondii
gb|KHG20989.1|  Polyol transporter 5 -like protein                    48.5    3e-04   Gossypium arboreum [tree cotton]
gb|AAO39267.1|AF482011_1  sorbitol transporter                        48.1    3e-04   Prunus cerasus [pie cherry]
ref|XP_008236797.1|  PREDICTED: putative polyol transporter 2         48.1    3e-04   Prunus mume [ume]
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1         48.1    3e-04   
ref|XP_004171995.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...  48.1    3e-04   
ref|XP_008775333.1|  PREDICTED: polyol transporter 5-like             48.1    3e-04   Phoenix dactylifera
ref|XP_008447047.1|  PREDICTED: polyol transporter 5-like             48.1    3e-04   Cucumis melo [Oriental melon]
ref|XP_011088360.1|  PREDICTED: polyol transporter 5-like             47.8    4e-04   Sesamum indicum [beniseed]
ref|XP_008245305.1|  PREDICTED: polyol transporter 5-like             47.8    4e-04   Prunus mume [ume]
ref|XP_007208924.1|  hypothetical protein PRUPE_ppb008257mg           46.6    6e-04   
gb|ABR16466.1|  unknown                                               47.4    6e-04   Picea sitchensis
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1  47.4    6e-04   Sesamum indicum [beniseed]
ref|NP_188513.1|  polyol transporter 5                                47.4    6e-04   Arabidopsis thaliana [mouse-ear cress]
gb|ACC61047.1|  mannitol transporter                                  47.0    7e-04   Gossypium hirsutum [American cotton]
emb|CAR82416.1|  polyol transporter                                   45.1    8e-04   Plantago major [cart-track plant]
ref|XP_008667512.1|  PREDICTED: hypothetical protein isoform X1       46.6    0.001   Zea mays [maize]
gb|AIU41385.1|  sorbitol transporter 1                                46.6    0.001   Prunus salicina [Japanese plum]
ref|XP_008236796.1|  PREDICTED: polyol transporter 5-like             46.6    0.001   Prunus mume [ume]
ref|XP_007199793.1|  hypothetical protein PRUPE_ppa004456mg           46.6    0.001   Prunus persica



>ref|XP_009345075.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=538

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  94   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +  GSG +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLKI
Sbjct  13   QQPGSGGLSEFDPPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKEDLKI  69



>ref|XP_008387370.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  94   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +  GS  +  FDPPKK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI
Sbjct  14   QQTGSRGLSDFDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKI  70



>ref|XP_011092774.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=519

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            IPAFDPP+K KRNKYA+A +FLAS+ SILLGYDIGVMSGA IYIQKDL+I
Sbjct  9    IPAFDPPQKPKRNKYAMACSFLASMTSILLGYDIGVMSGAIIYIQKDLQI  58



>ref|XP_009344433.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPPKK+KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI
Sbjct  23   FDPPKKLKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKI  69



>ref|XP_009766648.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=526

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 46/60 (77%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +1

Query  88   HVRNAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            H RNA  G +  AFDPPKK KRNKYA A +FLASLASILLGYDIGVMSGA IYI+KDL I
Sbjct  6    HGRNAVCGQLQIAFDPPKKPKRNKYATACSFLASLASILLGYDIGVMSGAIIYIKKDLNI  65



>ref|XP_009375628.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPPKK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI
Sbjct  23   FDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKI  69



>ref|XP_009596634.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=526

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +1

Query  94   RNAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            RNA  G +  AFDPPKK KRNKYA+A +FLASLASILLGYDIGVMSGA IYI+KDL I
Sbjct  8    RNAVCGQLQIAFDPPKKPKRNKYAVACSFLASLASILLGYDIGVMSGAIIYIKKDLNI  65



>ref|XP_006406559.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
 gb|ESQ48012.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
Length=529

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  103  GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            G+ H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI
Sbjct  17   GTKHVPELGPPAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKI  70



>gb|KHN39768.1| Polyol transporter 5 [Glycine soja]
Length=523

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK+
Sbjct  19   FDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKV  65



>ref|NP_001236592.1| sorbitol-like transporter [Glycine max]
 emb|CAD91337.1| sorbitol-like transporter [Glycine max]
Length=523

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK+
Sbjct  19   FDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKV  65



>gb|AAT06053.2| sorbitol transporter [Malus domestica]
Length=533

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K KRNKYA A A LAS+ SIL+GYDIGVMSGA+IYI+KDLK+
Sbjct  19   IADFDPPQKPKRNKYAFACAILASMTSILMGYDIGVMSGASIYIEKDLKV  68



>gb|AFI61955.1| polyol transporter [Camellia sinensis]
Length=532

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  112  HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            HIPA DPP+K KRNKYA A A LAS+ SILLGYD GVMSGAA++I+ DLKI
Sbjct  18   HIPALDPPQKPKRNKYAFACAILASMTSILLGYDGGVMSGAALFIKDDLKI  68



>ref|XP_008350306.1| PREDICTED: putative polyol transporter 1, partial [Malus domestica]
Length=282

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKI  68



>gb|KFK30307.1| hypothetical protein AALP_AA7G244900 [Arabis alpina]
Length=526

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  103  GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
             + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYIQ+DLKI
Sbjct  17   ATKHVPELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIQRDLKI  70



>gb|KHN25361.1| Polyol transporter 5 [Glycine soja]
Length=521

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAA+YI++DLK+
Sbjct  19   FDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIKRDLKV  65



>ref|XP_003541068.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=523

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAA+YI++DLK+
Sbjct  19   FDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIKRDLKV  65



>emb|CDO97075.1| unnamed protein product [Coffea canephora]
Length=529

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 4/57 (7%)
 Frame = +1

Query  106  SGHIPA----FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            SG  P     FDPPKK KRNKYA+A +FLAS+ S+LLGYDIGVMSGAAIYI++D K+
Sbjct  13   SGQTPKVIADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAAIYIKRDFKL  69



>gb|ABK29439.1| sugar transport protein [Coffea canephora]
Length=529

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 4/57 (7%)
 Frame = +1

Query  106  SGHIPA----FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            SG  P     FDPPKK KRNKYA+A +FLAS+ S+LLGYDIGVMSGAAIYI++D K+
Sbjct  13   SGQTPKVIADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAAIYIKRDFKL  69



>emb|CAJ29291.1| putative polyol transporter protein 4 [Lotus japonicus]
Length=519

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  76   ETLDHVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  255
            + +    NA   ++  FDP KK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++D
Sbjct  5    KVVTEAENANQKNLQDFDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRD  64

Query  256  LKI  264
            LK+
Sbjct  65   LKV  67



>ref|XP_007200585.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
 gb|EMJ01784.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
Length=361

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+KDLK+
Sbjct  20   IADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKKDLKV  69



>ref|XP_008393068.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  94   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +  GS  +  FD PKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLKI
Sbjct  13   QQPGSRGLSEFDSPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKEDLKI  69



>ref|NP_001281033.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42345.1| sorbitol transporter [Malus domestica]
Length=535

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI
Sbjct  19   IADFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKI  68



>ref|XP_008236795.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=538

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+KDLK+
Sbjct  20   IADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKKDLKV  69



>ref|XP_009375627.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKI  68



>gb|AGG19155.1| sorbitol transporter [Pyrus pyrifolia]
Length=535

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKI  68



>ref|XP_011088358.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=532

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            IPAFDPP+K KRNKYA+A +FLAS+ SILLGYDIGVMSGA IYI+K++ +
Sbjct  20   IPAFDPPRKPKRNKYALACSFLASMTSILLGYDIGVMSGAIIYIRKNIHM  69



>ref|XP_009344431.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
 ref|XP_009344432.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKI  68



>emb|CAP58706.1| putative polyol transporter protein 1 [Hevea brasiliensis]
 emb|CAN88842.1| polyols transporter 1 [Hevea brasiliensis]
Length=525

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPPKK KRNK+A+A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI
Sbjct  24   FDPPKKPKRNKFALACAALASMTSILLGYDIGVMSGAAIYIKDDLKI  70



>gb|EYU42630.1| hypothetical protein MIMGU_mgv1a0059091mg, partial [Erythranthe 
guttata]
Length=189

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            IP FDPPKK KRN YA+A +FLAS+ SILLGYDIGVMSGA IYIQ++  I
Sbjct  18   IPGFDPPKKPKRNMYALACSFLASMTSILLGYDIGVMSGAIIYIQEEFGI  67



>ref|XP_009800568.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=534

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPPKK KRNKYAIA +FLASLASILLGYDIGVMSGA IYI+KDL I
Sbjct  19   IQDFDPPKKPKRNKYAIACSFLASLASILLGYDIGVMSGAIIYIKKDLHI  68



>gb|AAM44082.1| putative sorbitol transporter [Prunus cerasus]
Length=538

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  112  HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI+KDLK+
Sbjct  19   NIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAVIYIKKDLKV  69



>gb|KEH30426.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=522

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK+
Sbjct  18   FDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKV  64



>ref|XP_010065409.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62859.1| hypothetical protein EUGRSUZ_G00453 [Eucalyptus grandis]
Length=535

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP + +RNKYA+A A LAS  SILLGYDIGVMSGA IYI+KDLKI
Sbjct  24   IEDFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKKDLKI  73



>ref|XP_009611551.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=539

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPPKK K NKYAIA +FLASLASILLGYDIGVMSGA IYIQKDL I
Sbjct  21   IRDFDPPKKPKTNKYAIACSFLASLASILLGYDIGVMSGAIIYIQKDLHI  70



>gb|AGY96955.1| polyol transporter 1 [Vitis vinifera]
Length=528

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +  FD PKK  RNKYAIA   LAS+ SILLGYDIGVMSGAAIYI+KDLKI
Sbjct  19   VTEFDAPKKKGRNKYAIACTILASMTSILLGYDIGVMSGAAIYIKKDLKI  68



>gb|KDP46230.1| hypothetical protein JCGZ_10070 [Jatropha curcas]
Length=542

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  94   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +N     +  FDPPKK K NK+A+A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI
Sbjct  18   QNQTEKRLADFDPPKKPKSNKFALACAVLASMTSILLGYDIGVMSGAAIYIKDDLKI  74



>ref|XP_003631630.1| PREDICTED: polyol transporter 5 [Vitis vinifera]
 gb|ADP37154.1| putative polyol/monosaccharide transporter [Vitis vinifera]
Length=528

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +  FD PKK  RNKYAIA   LAS+ SILLGYDIGVMSGAAIYI+KDLKI
Sbjct  19   VTEFDAPKKNGRNKYAIACTILASMTSILLGYDIGVMSGAAIYIKKDLKI  68



>ref|XP_004507415.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=526

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRN YA A A LAS+ SILLGYDIGVMSGAAIYIQ+DLK+
Sbjct  18   FDPQKKPKRNMYAFACAMLASMTSILLGYDIGVMSGAAIYIQRDLKV  64



>ref|XP_009112300.1| PREDICTED: polyol transporter 5 [Brassica rapa]
 emb|CDY18552.1| BnaA01g26430D [Brassica napus]
Length=529

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  103  GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
             + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++D KI
Sbjct  17   ATKHVPELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGALIYIKRDFKI  70



>emb|CDX95491.1| BnaC01g33830D [Brassica napus]
Length=531

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  103  GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
             + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++D KI
Sbjct  17   ATKHVPELGPPLKPKRNKYAFACAILASMTSILLGYDIGVMSGALIYIKRDFKI  70



>ref|XP_006365518.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=566

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  79   TLDHVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  258
            T++  +      I  FDPPKK K NKYAIA  FLASL+SILLGYDIGVMSGA IYI+KDL
Sbjct  26   TMEEDKQNQVARIQDFDPPKKPKTNKYAIACTFLASLSSILLGYDIGVMSGAIIYIKKDL  85

Query  259  KI  264
             I
Sbjct  86   HI  87



>ref|XP_008387369.1| PREDICTED: putative polyol transporter 1 isoform X2 [Malus domestica]
Length=535

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K KRNKYA A A LAS+ SILLG DIGVMSGAAIYI+ DLKI
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGLDIGVMSGAAIYIKDDLKI  68



>ref|XP_004170410.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=533

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +P FDPPKK KRNK+++A A LAS+ S+LLGYDIGVMSGAA++I++D ++
Sbjct  20   LPDFDPPKKNKRNKFSLACATLASMTSVLLGYDIGVMSGAAMFIKEDFRL  69



>ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN61777.1| hypothetical protein Csa_2G245410 [Cucumis sativus]
Length=533

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +P FDPPKK KRNK+++A A LAS+ S+LLGYDIGVMSGAA++I++D ++
Sbjct  20   LPDFDPPKKNKRNKFSLACATLASMTSVLLGYDIGVMSGAAMFIKEDFRL  69



>ref|XP_007131850.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
 gb|ESW03844.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
Length=510

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPPKK K NKYA   A LAS   ILLGYDIGVM+GAAIYI++DLK+
Sbjct  16   FDPPKKHKTNKYAFGCAILASTTCILLGYDIGVMTGAAIYIKRDLKV  62



>ref|XP_003539021.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=312

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  124  FDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPP KK KRN YA A A LA+  SILLGYDIGVMSGAAIYI+KDLK+
Sbjct  21   FDPPIKKPKRNTYAFACAMLATTTSILLGYDIGVMSGAAIYIKKDLKV  68



>gb|EPS69995.1| sugar transport protein [Genlisea aurea]
Length=530

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPPKK KRNKYA+A AFLAS+ SILLGYDIGVMSGA IYI++D+++
Sbjct  19   FDPPKKPKRNKYALACAFLASMTSILLGYDIGVMSGAIIYIRRDIRM  65



>ref|XP_010065405.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62856.1| hypothetical protein EUGRSUZ_G00450 [Eucalyptus grandis]
Length=535

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP + +RNKYA+A A LAS  SILLGYDIGVMSGA IYI++DLKI
Sbjct  24   IEDFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKEDLKI  73



>emb|CAP58707.1| putative polyol transported protein 2 [Hevea brasiliensis]
Length=547

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRNK+A A A LAS+ SILLGYDIGVMSGAAIYI+K+LKI
Sbjct  25   FDPQKKPKRNKFAFACAILASMTSILLGYDIGVMSGAAIYIKKNLKI  71



>emb|CDY61985.1| BnaC03g73840D [Brassica napus]
Length=530

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  112  HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            H+P   P  K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI
Sbjct  26   HVPELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKI  76



>ref|XP_009135601.1| PREDICTED: polyol transporter 5 [Brassica rapa]
Length=532

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  112  HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            H+P   P  K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI
Sbjct  26   HVPELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKI  76



>ref|XP_011048787.1| PREDICTED: polyol transporter 5-like [Populus euphratica]
Length=532

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRNK+A A A +AS+ S+LLGYDIGVMSGA IYIQ DLKI
Sbjct  25   FDPAKKPKRNKFAFACASIASMTSVLLGYDIGVMSGANIYIQDDLKI  71



>ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=518

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  106  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            S  IP F P KK KRNKYA A + LAS+ S+LLGYD GVMSGA IYI++DLKI
Sbjct  13   SNKIPEFVPLKKPKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKI  65



>ref|XP_004299107.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=535

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +1

Query  97   NAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLK  261
            NA SG      I  FDP  K KRNKYA A A LAS+ SILLGYDIGVMSGAAI+I+ DLK
Sbjct  9    NAVSGQPTQKAIADFDPAPKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIFIKDDLK  68

Query  262  I  264
            I
Sbjct  69   I  69



>ref|NP_001287655.1| polyol transporter 5-like [Solanum lycopersicum]
 dbj|BAO96229.1| polyol/monosaccharide transporter 4 [Solanum lycopersicum]
Length=541

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPPKK K NKYAIA  FLASL+SILLGYDIGVMSGA +YI+KDL I
Sbjct  12   IQDFDPPKKPKTNKYAIACTFLASLSSILLGYDIGVMSGAILYIKKDLHI  61



>ref|XP_002313809.1| putative sorbitol transporter family protein [Populus trichocarpa]
 gb|EEE87764.1| putative sorbitol transporter family protein [Populus trichocarpa]
Length=533

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRNK+A A A LAS+ S+LLGYDIGVMSGA IYIQ DLKI
Sbjct  25   FDPVKKPKRNKFAFACAILASMTSVLLGYDIGVMSGANIYIQDDLKI  71



>ref|XP_002519083.1| sugar transporter, putative [Ricinus communis]
 gb|EEF43294.1| sugar transporter, putative [Ricinus communis]
Length=539

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPPKK KRNK+A+A A LAS+ SILLGYDIGVMSGAAIYI+ + ++
Sbjct  20   IADFDPPKKPKRNKFALACAILASMTSILLGYDIGVMSGAAIYIKDEFRL  69



>gb|ACB56939.1| mannitol transporter [Artemisia annua]
Length=522

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  258
            FDPPK  KRNKYA A A LAS+ S+LLGYDIGVMSGA IYI++DL
Sbjct  21   FDPPKAPKRNKYAFACAMLASMTSVLLGYDIGVMSGAQIYIKRDL  65



>ref|XP_003607077.1| Sorbitol-like transporter [Medicago truncatula]
 gb|AES89274.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=520

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            F P KK+KRNK+A A A LAS+ SILLGYDIGVMSGAAIYI++DLK+
Sbjct  15   FGPQKKLKRNKFACACAILASMTSILLGYDIGVMSGAAIYIKRDLKV  61



>ref|XP_007199207.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
 gb|EMJ00406.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
Length=528

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K KRNK+AIA + LA + SILLGYDIGVMSGA ++IQ DLKI
Sbjct  20   IADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGANLFIQDDLKI  69



>ref|XP_007201628.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
 gb|EMJ02827.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
Length=490

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPP+K KRNK+AIA + +A   SILLGYDIGVMSGA ++IQ DLKI
Sbjct  9    FDPPQKPKRNKFAIACSLMACTTSILLGYDIGVMSGANLFIQDDLKI  55



>ref|XP_008236860.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=525

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K KRNK+AIA + LA + SILLGYDIGVMSGA ++IQ DLKI
Sbjct  20   IADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGANLFIQDDLKI  69



>gb|ACB86853.1| mannitol transporter [Citrus sinensis]
Length=535

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ DLK+
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKV  70



>gb|KHN25431.1| Polyol transporter 5 [Glycine soja]
Length=518

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  127  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +P KK +RNKYA A A LAS+ SILLGYDIGVMSGAA+YIQ+DLK+
Sbjct  14   NPEKKPRRNKYAFACAILASMTSILLGYDIGVMSGAALYIQRDLKV  59



>ref|XP_004300990.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=530

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDP  K KRN+YA A A LAS+ SILLGYDIGVMSGAAI+I+ DLKI
Sbjct  20   IEDFDPAPKPKRNRYAFACAMLASMTSILLGYDIGVMSGAAIFIKDDLKI  69



>gb|KHG12832.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=169

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 45/67 (67%), Gaps = 12/67 (18%)
 Frame = +1

Query  100  AGSGH------------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIY  243
            AGSGH            +  F+  KK K+NK+A+  A LASL S+LLGYDIGVMSGA I+
Sbjct  2    AGSGHENGAISIRPADNLAVFEVSKKPKKNKFALGCAMLASLTSMLLGYDIGVMSGAIIF  61

Query  244  IQKDLKI  264
            I+KDLKI
Sbjct  62   IKKDLKI  68



>ref|XP_003540961.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=531

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  127  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +P KK +RNKYA A A LAS+ SILLGYDIGVMSGAA+YIQ+DLK+
Sbjct  27   NPEKKPRRNKYAFACAILASMTSILLGYDIGVMSGAALYIQRDLKV  72



>ref|XP_007131748.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
 gb|ESW03742.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
Length=495

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  127  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            DP  K KRNK+A+A A LAS+ SILLGYDIGVMSGAA+YIQ+DLK+
Sbjct  11   DPKNKPKRNKFALACAILASMTSILLGYDIGVMSGAALYIQRDLKV  56



>ref|XP_008236773.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
 ref|XP_008236774.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=528

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = +1

Query  97   NAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  258
            NA SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA I+IQ DL
Sbjct  9    NAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGANIFIQNDL  68

Query  259  KI  264
            K+
Sbjct  69   KL  70



>ref|XP_011037561.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037562.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037564.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037565.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037566.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037567.1| PREDICTED: polyol transporter 5 [Populus euphratica]
Length=531

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRNKYA A A LAS+ASILLGYDIGVMSGA  YIQ DLK+
Sbjct  25   FDPVKKPKRNKYAFACAILASVASILLGYDIGVMSGAKDYIQTDLKL  71



>ref|XP_007131851.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
 gb|ESW03845.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
Length=518

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            F+  KK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYI++DLK+
Sbjct  16   FNSSKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIKRDLKV  62



>emb|CDP10064.1| unnamed protein product [Coffea canephora]
Length=521

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  76   ETLDHVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  255
            ++L          IP F PP + KRNKY++A A LAS+ SILLGYD GVMSGA +YI++D
Sbjct  4    QSLSKALTRAESSIPDFGPPPRPKRNKYSLACALLASMTSILLGYDTGVMSGATLYIKQD  63

Query  256  LKI  264
            L +
Sbjct  64   LHV  66



>ref|XP_007200117.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
 gb|EMJ01316.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
Length=527

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA I+IQ DLK+
Sbjct  21   IADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGANIFIQNDLKL  70



>ref|XP_007200254.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 ref|XP_007200263.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
 gb|EMJ01453.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 gb|EMJ01462.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
Length=527

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA I+IQ DLK+
Sbjct  21   IADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGANIFIQNDLKL  70



>ref|XP_007200033.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
 gb|EMJ01232.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
Length=534

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA I+IQ DLK+
Sbjct  21   IADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGANIFIQNDLKL  70



>ref|XP_007042744.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
 gb|EOX98575.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
Length=538

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            F+P KK KRNK+A A A LASL SILLGYDIGVMSGA IYI+ DLKI
Sbjct  25   FEPAKKPKRNKFAFACAILASLTSILLGYDIGVMSGAVIYIKDDLKI  71



>gb|AAY86779.1| putative sugar transporter protein [Noccaea caerulescens]
Length=253

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +1

Query  112  HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLK  261
            H+P +  PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLK
Sbjct  20   HLPESGPPPAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLK  70



>emb|CDP17996.1| unnamed protein product [Coffea canephora]
Length=525

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +1

Query  118  PAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            P F PP K  +NKYA+A A LA ++S+LLGYD GVMSG  IYIQ+DLKI
Sbjct  18   PDFGPPPKATKNKYALACALLACMSSVLLGYDTGVMSGGMIYIQRDLKI  66



>emb|CDP18000.1| unnamed protein product [Coffea canephora]
Length=507

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  118  PAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            P   PP K KRNKYA+A A LA ++S+LLGYD GVMSGA IYIQ+DLKI
Sbjct  18   PDSVPPPKPKRNKYALACALLACMSSVLLGYDTGVMSGAMIYIQRDLKI  66



>ref|XP_007135989.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
 gb|ESW07983.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
Length=514

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  82   LDHVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLK  261
            ++  + A    +  FDP K  KRNK+A A A LAS+ SILLGYD+GVMSGA IYI++DLK
Sbjct  1    MEEGKAAAQKSLEDFDPKKAPKRNKFAFACAILASMTSILLGYDVGVMSGAVIYIKRDLK  60

Query  262  I  264
            +
Sbjct  61   L  61



>ref|XP_009780685.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=174

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  130  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            P KK KRNKYA A + LAS+ S+LLGYD GVMSGA IYI++DLKI
Sbjct  25   PCKKSKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKI  69



>ref|XP_006487181.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=539

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K+
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKV  70



>ref|XP_006423216.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
 gb|ESR36456.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
Length=535

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K+
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKV  70



>ref|NP_001280902.1| putative polyol transporter 1 [Malus domestica]
 dbj|BAD42343.1| sorbitol transporter [Malus domestica]
Length=526

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPP K K +K+AIA A LA   S+LLGYDIGVMSGA++YIQK+LKI
Sbjct  20   IEDFDPPMKPKTSKFAIACALLACTTSVLLGYDIGVMSGASLYIQKNLKI  69



>ref|XP_006577924.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=509

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  94   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            + A    +  FDP K  +RNKYA A A LAS+ SILLGYD+GVMSGA IYI++DLK+
Sbjct  5    KTATQKSLQDFDPQKTPRRNKYAFACAILASMTSILLGYDVGVMSGAIIYIKRDLKL  61



>ref|XP_006423215.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
 gb|ESR36455.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
Length=535

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K+
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKV  70



>gb|KGN44323.1| Sugar transporter [Cucumis sativus]
Length=516

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  133  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            PKK KRNKYA   A LAS+ASILLGYD+GVMSGAAIYI+KD +I
Sbjct  14   PKKPKRNKYAFMCAILASMASILLGYDVGVMSGAAIYIKKDFQI  57



>ref|XP_006487182.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=535

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K+
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKV  70



>gb|ABX71752.1| mannitol transporter [Apium graveolens]
Length=524

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  118  PAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLK  261
            P FD  KK K NKYA A + LAS+ SILLGYD GVMSGAAIYI+KDL+
Sbjct  21   PLFDAEKKPKNNKYAFACSILASMTSILLGYDTGVMSGAAIYIKKDLR  68



>ref|XP_002305419.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
 gb|EEE85930.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
Length=531

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP KK KRNK+A A A  AS+ASILLGYDIGVMSGA  YIQ DLK+
Sbjct  25   FDPVKKPKRNKFAFACAITASVASILLGYDIGVMSGAKDYIQTDLKL  71



>emb|CDP17999.1| unnamed protein product [Coffea canephora]
Length=503

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  118  PAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            P F PP K  +NKYA+  AFLA ++S+LLGY+ GVMSGA IYIQ+DLKI
Sbjct  18   PDFGPPPKATKNKYALGCAFLACMSSVLLGYNAGVMSGAMIYIQRDLKI  66



>ref|XP_010527594.1| PREDICTED: polyol transporter 5-like isoform X4 [Tarenaya hassleriana]
Length=526

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  130  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKI  61



>ref|XP_010527593.1| PREDICTED: polyol transporter 5-like isoform X3 [Tarenaya hassleriana]
Length=528

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  130  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKI  61



>ref|XP_010527592.1| PREDICTED: polyol transporter 5-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  130  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKI  61



>ref|XP_010527591.1| PREDICTED: polyol transporter 5-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  130  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKI  61



>ref|XP_010096202.1| Polyol transporter 5 [Morus notabilis]
 gb|EXB63597.1| Polyol transporter 5 [Morus notabilis]
Length=541

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPPK+ ++N +AIA A LAS+ SILLGYDIGVMSGA I+I++DLKI
Sbjct  19   IADFDPPKRPRKNIFAIACAVLASMTSILLGYDIGVMSGAVIFIKEDLKI  68



>ref|XP_008447045.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=517

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I   DPPKK  RN +A   + +ASL+SIL+GYDIGVMSGAAIYIQ+D  I
Sbjct  19   IKFLDPPKKPIRNHFAFLCSIVASLSSILVGYDIGVMSGAAIYIQQDFNI  68



>ref|XP_010527590.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=519

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +P    P K KRNK+A A A LAS+ SILLGYDIGVMSGA IYI++DLKI
Sbjct  19   VPEMSMPAKPKRNKFAFACAILASMTSILLGYDIGVMSGAIIYIKRDLKI  68



>gb|KJB12315.1| hypothetical protein B456_002G011400 [Gossypium raimondii]
Length=536

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  100  AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            AG+  +  F+  KK KRNK+A A + LASLASILLGYDIGVMSGA IYI+ DLKI
Sbjct  17   AGNKTVADFEVSKKPKRNKFAFACSILASLASILLGYDIGVMSGAIIYIKDDLKI  71



>ref|XP_002885281.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61540.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +1

Query  112  HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            H+P +  P K  KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI
Sbjct  19   HVPESVLPAKPPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKI  70



>ref|XP_009345071.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+++I+++LKI
Sbjct  22   IADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGASLFIKENLKI  71



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  100  AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            A +  I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+++I+++LKI
Sbjct  17   AQNTSIADFDPPKKAKTKKFAIACGVLASMTSILLGYDIGVMSGASLFIKENLKI  71



>ref|XP_008361285.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=527

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+++I+++LKI
Sbjct  22   IADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGASLFIKENLKI  71



>ref|XP_004149937.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 ref|XP_004168184.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
Length=519

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  121  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            + DP +K K NK++   A +AS++S+LLGYDIGVMSGAAIYIQ+D KI
Sbjct  27   SIDPQEKPKTNKFSFVCATIASMSSVLLGYDIGVMSGAAIYIQEDFKI  74



>ref|XP_009375822.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=520

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  100  AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +G   I  FDPPK  K  K+A+A A LAS+ SILLGYDIGVMSGA+++I+++LKI
Sbjct  14   SGQKTIADFDPPKAAKTKKFAVACAILASMTSILLGYDIGVMSGASLFIKENLKI  68



>ref|XP_008387376.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  100  AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +G   I  FDPPK  K  K+AIA A LAS+ SILLGYDIGVMSGA+++I+++LKI
Sbjct  14   SGQKTIADFDPPKAXKTKKFAIACATLASMTSILLGYDIGVMSGASLFIKENLKI  68



>ref|XP_009344435.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  115  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            I  FDPPKK K +K+AIA A LA   S+LLGYDIGVMSGA+++I+++LKI
Sbjct  20   IEDFDPPKKPKTSKFAIACALLACTTSVLLGYDIGVMSGASLFIKENLKI  69



>gb|KJB32189.1| hypothetical protein B456_005G228500 [Gossypium raimondii]
Length=539

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  124  FDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            F+P  KK KRNK+A A A LASL SILLGYDIGVMSGA IYIQ+DLKI
Sbjct  26   FEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAIIYIQEDLKI  73



>gb|KHG20989.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=539

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  124  FDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            F+P  KK KRNK+A A A LASL SILLGYDIGVMSGA IYIQ+DLKI
Sbjct  26   FEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAIIYIQEDLKI  73



>gb|AAO39267.1|AF482011_1 sorbitol transporter [Prunus cerasus]
Length=509

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  136  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQKDLKI
Sbjct  19   KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQKDLKI  61



>ref|XP_008236797.1| PREDICTED: putative polyol transporter 2 [Prunus mume]
Length=531

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 5/61 (8%)
 Frame = +1

Query  97   NAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLK  261
            NA SG      I  FDPP+K   NK+AIA A LA + SILLGYDIGVMSGA I+I+ DLK
Sbjct  12   NAVSGEPQNKRIADFDPPEKPNANKFAIACATLACMTSILLGYDIGVMSGANIFIKDDLK  71

Query  262  I  264
            I
Sbjct  72   I  72



>ref|XP_008387377.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  100  AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +G   I  FDPPK  K  K+AIA A LAS+ SILLGYDIGVMSGA+++I+++LKI
Sbjct  14   SGQKTIADFDPPKAPKTKKFAIACATLASMTSILLGYDIGVMSGASLFIKENLKI  68



>ref|XP_004171995.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=516

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  133  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            PKK KRNKYA   A LAS+ASILLGYD+GVMSGAAIYI+ D +I
Sbjct  14   PKKPKRNKYAFMCAILASMASILLGYDVGVMSGAAIYIKXDFQI  57



>ref|XP_008775333.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +1

Query  121  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            A + PKK  RNKYA+A A LAS+ SIL GYD+ VMSGA+++IQKDL+I
Sbjct  21   ALEKPKKPPRNKYALACATLASMTSILSGYDVAVMSGASVFIQKDLEI  68



>ref|XP_008447047.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=519

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  106  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            +  I    PP   KRN YA   + +AS+AS+LLGYDIGVMSGAAI+IQ+D +I
Sbjct  20   TSSISDHSPPPAAKRNNYAFVCSTMASMASVLLGYDIGVMSGAAIFIQEDFRI  72



>ref|XP_011088360.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=522

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = +1

Query  124  FDP--PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDP  P K  RNK+A A +FLAS+ S+LLGYD+GVMSGA IYIQ+DL+I
Sbjct  13   FDPAAPPKPTRNKFATACSFLASMTSVLLGYDVGVMSGAIIYIQRDLQI  61



>ref|XP_008245305.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +1

Query  124  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            FDPP+K K NK+AIA + +A   SIL GYDIGVMSGA ++I+ DLKI
Sbjct  9    FDPPQKPKINKFAIACSLMACTTSILHGYDIGVMSGAYLFIKDDLKI  55



>ref|XP_007208924.1| hypothetical protein PRUPE_ppb008257mg [Prunus persica]
 gb|EMJ10123.1| hypothetical protein PRUPE_ppb008257mg [Prunus persica]
Length=270

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  136  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+DLKI
Sbjct  19   KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQEDLKI  61



>gb|ABR16466.1| unknown [Picea sitchensis]
Length=538

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  130  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            P KK+ RNK+ IA A LAS  SIL GYD+GVMSGA I+I+KDLKI
Sbjct  26   PRKKIPRNKFVIACAVLASTNSILFGYDVGVMSGAVIFIKKDLKI  70



>ref|XP_011078883.1| PREDICTED: polyol transporter 5-like isoform X1 [Sesamum indicum]
Length=526

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  133  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            P K KRNKYA+A + LAS+ S+LLGYD GVMSGA IYI++DLKI
Sbjct  31   PTKHKRNKYALAISVLASMTSVLLGYDTGVMSGATIYIKRDLKI  74



>ref|NP_188513.1| polyol transporter 5 [Arabidopsis thaliana]
 sp|Q8VZ80.2|PLT5_ARATH RecName: Full=Polyol transporter 5; AltName: Full=Protein POLYOL 
TRANSPORTER 5; Short=AtPLT5; AltName: Full=Sugar-proton 
symporter PLT5 [Arabidopsis thaliana]
 dbj|BAB01812.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AEE76153.1| polyol transporter 5 [Arabidopsis thaliana]
Length=539

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +1

Query  112  HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            H+P +  P K  KRN YA A A LAS+ SILLGYDIGVMSGA IYI++DLKI
Sbjct  19   HVPESVLPAKPPKRNNYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKI  70



>gb|ACC61047.1| mannitol transporter [Gossypium hirsutum]
Length=392

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +1

Query  124  FDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            F+P  KK KRNK+A A A LASL SILLGYDIGV+SGA IYIQ+DLKI
Sbjct  26   FEPAVKKPKRNKFASACAILASLTSILLGYDIGVISGAIIYIQEDLKI  73



>emb|CAR82416.1| polyol transporter [Plantago major]
Length=181

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  130  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            P K V RNKYA+A + LAS+ S+LLGYD GVMSGA +YI+ DLKI
Sbjct  34   PKKPVTRNKYALAISILASMTSVLLGYDTGVMSGATLYIKDDLKI  78



>ref|XP_008667512.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA41234.1| TPA: hypothetical protein ZEAMMB73_633247 [Zea mays]
Length=516

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +1

Query  121  AFDPPKKVKRN-KYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            A +P +K K N KYA   A LAS+AS++LGYDIGVMSGAA+YI+KDLKI
Sbjct  9    AIEPSRKKKSNVKYASICAILASMASVILGYDIGVMSGAAMYIKKDLKI  57



>gb|AIU41385.1| sorbitol transporter 1 [Prunus salicina]
Length=509

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  136  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+DLKI
Sbjct  19   KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQEDLKI  61



>ref|XP_008236796.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=509

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  136  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+DLKI
Sbjct  19   KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQEDLKI  61



>ref|XP_007199793.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
 gb|EMJ00992.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
Length=509

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  136  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  264
            KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+DLKI
Sbjct  19   KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQEDLKI  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567410881500