BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002H01

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    139   6e-63   Nicotiana sylvestris
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    138   1e-59   Nicotiana tomentosiformis
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    127   1e-54   Fragaria vesca subsp. vesca
emb|CAN61955.1|  hypothetical protein VITISV_020020                     135   2e-54   Vitis vinifera
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    135   2e-54   Vitis vinifera
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    129   8e-54   Solanum tuberosum [potatoes]
emb|CDP20220.1|  unnamed protein product                                123   9e-54   Coffea canephora [robusta coffee]
ref|XP_006364110.1|  PREDICTED: trans-resveratrol di-O-methyltran...    129   2e-53   Solanum tuberosum [potatoes]
ref|XP_002277927.2|  PREDICTED: trans-resveratrol di-O-methyltran...    131   5e-53   Vitis vinifera
ref|XP_002517827.1|  o-methyltransferase, putative                      125   5e-53   Ricinus communis
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    132   2e-52   Vitis vinifera
emb|CAN69333.1|  hypothetical protein VITISV_003273                     130   2e-52   Vitis vinifera
ref|XP_002274019.2|  PREDICTED: trans-resveratrol di-O-methyltran...    129   6e-52   Vitis vinifera
emb|CDP15888.1|  unnamed protein product                                119   8e-52   Coffea canephora [robusta coffee]
emb|CAH05083.1|  putative orcinol O-methyltransferase                   121   9e-52   Rosa hybrid cultivar
emb|CAN83014.1|  hypothetical protein VITISV_029725                     127   1e-51   Vitis vinifera
ref|XP_002278057.1|  PREDICTED: trans-resveratrol di-O-methyltran...    127   2e-51   Vitis vinifera
emb|CAJ65612.1|  putative orcinol O-methyltransferase                   124   3e-51   Rosa canina [dog briar]
emb|CAJ65638.1|  putative orcinol O-methyltransferase                   120   3e-51   Rosa hugonis
emb|CAJ65608.1|  putative orcinol O-methyltransferase                   123   3e-51   Rosa bracteata [Macartny rose]
emb|CAJ65609.1|  putative orcinol O-methyltransferase                   123   3e-51   Rosa bracteata [Macartny rose]
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             122   3e-51   
emb|CAJ65641.1|  putative orcinol O-methyltransferase                   122   4e-51   Rosa marretii
emb|CAJ65602.1|  putative orcinol O-methyltransferase                   121   4e-51   Rosa banksiae
emb|CAJ65625.1|  putative orcinol O-methyltransferase                   123   5e-51   Rosa gallica [apothecary rose]
emb|CAJ65623.1|  putative orcinol O-methyltransferase                   123   5e-51   Rosa gallica [apothecary rose]
emb|CAJ65642.1|  putative orcinol O-methyltransferase                   123   5e-51   Rosa marretii
emb|CAJ65647.1|  putative orcinol O-methyltransferase                   123   5e-51   Rosa rugosa [Japanese rose]
emb|CAJ65624.1|  putative orcinol O-methyltransferase                   123   5e-51   Rosa gallica [apothecary rose]
emb|CAJ65645.1|  putative orcinol O-methyltransferase                   123   5e-51   Rosa roxburghii [chestnut rose]
emb|CAJ65648.1|  putative orcinol O-methyltransferase                   123   5e-51   Rosa woodsii var. ultramontana
emb|CAJ65635.1|  putative orcinol O-methyltransferase                   123   5e-51   Rosa odorata var. gigantea
emb|CAJ65646.1|  putative orcinol O-methyltransferase                   122   5e-51   Rosa rugosa [Japanese rose]
emb|CAJ65640.1|  putative orcinol O-methyltransferase                   123   5e-51   Rosa majalis [cinnamon rose]
emb|CAH05087.1|  orcinol O-methyltransferase 4                          123   5e-51   Rosa hybrid cultivar
emb|CAJ65604.1|  putative orcinol O-methyltransferase                   123   5e-51   Rosa beggeriana
emb|CAJ65607.1|  putative orcinol O-methyltransferase                   123   5e-51   Rosa beggeriana
gb|AEC13057.1|  orcinol O-methyltransferase-like protein                122   5e-51   Rosa chinensis [China rose]
emb|CDP19840.1|  unnamed protein product                                119   6e-51   Coffea canephora [robusta coffee]
emb|CAJ65632.1|  putative orcinol O-methyltransferase                   123   6e-51   Rosa odorata var. gigantea
emb|CAJ65628.1|  putative orcinol O-methyltransferase                   123   6e-51   Rosa odorata var. gigantea
emb|CAJ65663.1|  putative orcinol O-methyltransferase                   123   6e-51   Rosa odorata [tea rose]
emb|CAH05089.1|  putative orcinol O-methyltransferase                   122   6e-51   Rosa odorata var. gigantea
emb|CAJ65630.1|  putative orcinol O-methyltransferase                   123   6e-51   Rosa odorata var. gigantea
emb|CAJ65643.1|  putative orcinol O-methyltransferase                   120   9e-51   Rosa marretii
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    129   1e-50   
emb|CAJ65655.1|  putative orcinol O-methyltransferase                   123   1e-50   Rosa lucieae [memorial rose]
emb|CAH05086.1|  orcinol O-methyltransferase 4                          122   1e-50   Rosa hybrid cultivar
emb|CAH05079.1|  putative orcinol O-methyltransferase                   122   1e-50   Rosa gallica [apothecary rose]
emb|CDP19839.1|  unnamed protein product                                118   1e-50   Coffea canephora [robusta coffee]
emb|CAH05081.1|  putative orcinol O-methyltransferase                   121   1e-50   Rosa hybrid cultivar
emb|CAJ65621.1|  putative orcinol O-methyltransferase                   121   1e-50   Rosa gallica [apothecary rose]
emb|CAJ65622.1|  putative orcinol O-methyltransferase                   121   1e-50   Rosa gallica [apothecary rose]
emb|CAJ65633.1|  putative orcinol O-methyltransferase                   123   1e-50   Rosa odorata var. gigantea
emb|CAH05082.1|  putative orcinol O-methyltransferase                   121   1e-50   Rosa hybrid cultivar
emb|CAJ65665.1|  putative orcinol O-methyltransferase                   122   1e-50   Rosa odorata [tea rose]
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             129   1e-50   Citrus clementina [clementine]
emb|CAJ65601.1|  putative orcinol O-methyltransferase                   121   2e-50   Rosa chinensis [China rose]
emb|CAJ65598.1|  putative orcinol O-methyltransferase                   121   2e-50   Rosa chinensis [China rose]
ref|XP_007043718.1|  Flavonoid o-methyltransferase related              123   2e-50   
emb|CAJ65597.1|  putative orcinol O-methyltransferase                   121   2e-50   Rosa chinensis [China rose]
emb|CAJ65664.1|  putative orcinol O-methyltransferase                   123   2e-50   Rosa odorata [tea rose]
emb|CAJ65639.1|  putative orcinol O-methyltransferase                   120   2e-50   Rosa hugonis
emb|CAJ65626.1|  putative orcinol O-methyltransferase                   120   2e-50   Rosa gallica [apothecary rose]
emb|CAJ65618.1|  putative orcinol O-methyltransferase                   120   2e-50   Rosa chinensis var. spontanea
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    125   3e-50   Vitis vinifera
emb|CAJ65613.1|  putative orcinol O-methyltransferase                   120   3e-50   Rosa chinensis var. spontanea
emb|CAJ65620.1|  putative orcinol O-methyltransferase                   120   3e-50   Rosa chinensis var. spontanea
emb|CAD29556.1|  orcinol O-methyltransferase                            122   3e-50   Rosa hybrid cultivar
emb|CAJ65617.1|  putative orcinol O-methyltransferase                   123   3e-50   Rosa chinensis var. spontanea
emb|CAJ65599.1|  putative orcinol O-methyltransferase                   123   3e-50   Rosa chinensis [China rose]
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                   123   3e-50   Rosa hybrid cultivar
emb|CAJ65614.1|  putative orcinol O-methyltransferase                   123   3e-50   Rosa chinensis var. spontanea
emb|CAH05084.1|  orcinol O-methyltransferase 3                          123   4e-50   Rosa hybrid cultivar
emb|CAJ65615.1|  putative orcinol O-methyltransferase                   123   4e-50   Rosa chinensis var. spontanea
emb|CAH05085.1|  orcinol O-methyltransferase 3                          123   4e-50   Rosa hybrid cultivar
emb|CAH05091.1|  putative orcinol O-methyltransferase                   121   5e-50   Rosa odorata var. gigantea
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    125   5e-50   Vitis vinifera
emb|CAJ65606.1|  putative orcinol O-methyltransferase                   123   5e-50   Rosa beggeriana
emb|CAJ65610.1|  putative orcinol O-methyltransferase                   123   5e-50   Rosa canina [dog briar]
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    124   6e-50   Vitis vinifera
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    131   6e-50   Solanum lycopersicum
emb|CAH05090.1|  putative orcinol O-methyltransferase                   123   6e-50   Rosa odorata var. gigantea
emb|CAJ65600.1|  putative orcinol O-methyltransferase                   123   6e-50   Rosa chinensis [China rose]
emb|CAJ65656.1|  putative orcinol O-methyltransferase                   123   7e-50   Rosa odorata [tea rose]
emb|CAJ65603.1|  putative orcinol O-methyltransferase                   119   7e-50   Rosa banksiae
ref|XP_002525159.1|  o-methyltransferase, putative                      121   7e-50   Ricinus communis
emb|CAJ65649.1|  putative orcinol O-methyltransferase                   122   7e-50   Rosa woodsii var. ultramontana
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    121   7e-50   Vitis vinifera
emb|CAH05080.1|  putative orcinol O-methyltransferase                   122   8e-50   Rosa gallica [apothecary rose]
gb|AEF97347.1|  O-methyltransferase                                     124   9e-50   Vitis pseudoreticulata
emb|CAJ65629.1|  putative orcinol O-methyltransferase                   123   9e-50   Rosa odorata var. gigantea
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...    121   1e-49   Vitis vinifera
emb|CAQ76879.1|  resveratrol O-methyltransferase                        124   1e-49   Vitis vinifera
gb|KDO39394.1|  hypothetical protein CISIN_1g021867mg                   126   1e-49   Citrus sinensis [apfelsine]
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    120   1e-49   Prunus mume [ume]
emb|CDP21787.1|  unnamed protein product                                115   1e-49   Coffea canephora [robusta coffee]
emb|CAH05088.1|  putative orcinol O-methyltransferase                   123   1e-49   Rosa odorata var. gigantea
emb|CAJ65661.1|  putative orcinol O-methyltransferase                   118   1e-49   Rosa odorata [tea rose]
emb|CAJ65631.1|  putative orcinol O-methyltransferase                   123   1e-49   Rosa odorata var. gigantea
emb|CAJ65627.1|  putative orcinol O-methyltransferase                   123   1e-49   Rosa odorata var. gigantea
emb|CAJ65605.1|  putative orcinol O-methyltransferase                   122   1e-49   Rosa beggeriana
emb|CAJ65659.1|  putative orcinol O-methyltransferase                   123   1e-49   Rosa odorata [tea rose]
emb|CAD29555.1|  orcinol O-methyltransferase                            123   1e-49   Rosa hybrid cultivar
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...    123   2e-49   Prunus mume [ume]
ref|XP_002525160.1|  o-methyltransferase, putative                      114   2e-49   Ricinus communis
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    122   2e-49   Populus euphratica
emb|CAJ65634.1|  putative orcinol O-methyltransferase                   122   2e-49   Rosa odorata var. gigantea
emb|CDP21661.1|  unnamed protein product                                115   3e-49   Coffea canephora [robusta coffee]
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...    122   3e-49   Populus euphratica
emb|CAJ65636.1|  putative orcinol O-methyltransferase                   122   3e-49   Rosa odorata var. gigantea
emb|CAN70493.1|  hypothetical protein VITISV_002330                     121   3e-49   Vitis vinifera
emb|CDP21836.1|  unnamed protein product                                115   4e-49   Coffea canephora [robusta coffee]
emb|CAN78992.1|  hypothetical protein VITISV_005827                     121   4e-49   Vitis vinifera
gb|AFX68805.1|  O-metyltransferase                                      122   4e-49   Vitis riparia [frost grape]
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           122   5e-49   Vitis vinifera
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    121   6e-49   Vitis vinifera
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    120   7e-49   Prunus mume [ume]
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    122   7e-49   Populus euphratica
gb|AAB71213.1|  methyltransferase                                       118   7e-49   Prunus armeniaca
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                   121   8e-49   Rosa hybrid cultivar
emb|CAJ65662.1|  putative orcinol O-methyltransferase                   122   8e-49   Rosa odorata [tea rose]
emb|CAJ65666.1|  putative orcinol O-methyltransferase                   123   9e-49   Rosa odorata [tea rose]
emb|CAJ65657.1|  putative orcinol O-methyltransferase                   121   1e-48   Rosa odorata [tea rose]
ref|XP_006387382.1|  hypothetical protein POPTR_1124s00200g             114   1e-48   
emb|CAJ65616.1|  putative orcinol O-methyltransferase                   120   2e-48   Rosa chinensis var. spontanea
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase           113   2e-48   Morus notabilis
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg             124   2e-48   Citrus clementina [clementine]
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...    119   3e-48   Vitis vinifera
gb|ABQ02270.2|  O-methyltransferase                                     119   3e-48   Vitis vinifera
ref|NP_001267963.1|  O-methyltransferase                                119   3e-48   Vitis vinifera
emb|CAJ65660.1|  putative orcinol O-methyltransferase                   119   3e-48   Rosa odorata [tea rose]
emb|CAJ65596.1|  putative orcinol O-methyltransferase                   120   4e-48   Rosa chinensis [China rose]
gb|ABZ89567.1|  O-methyltransferase 3                                   121   6e-48   Humulus lupulus [common hop]
emb|CAN79968.1|  hypothetical protein VITISV_043678                     117   1e-47   Vitis vinifera
gb|KDP24059.1|  hypothetical protein JCGZ_25716                         118   1e-47   Jatropha curcas
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase           116   2e-47   Morus notabilis
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    124   3e-47   Citrus sinensis [apfelsine]
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase           119   3e-47   Morus notabilis
gb|KDO40717.1|  hypothetical protein CISIN_1g037127mg                   124   3e-47   Citrus sinensis [apfelsine]
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...    110   7e-47   Sesamum indicum [beniseed]
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    108   1e-46   Sesamum indicum [beniseed]
ref|XP_010657144.1|  PREDICTED: uncharacterized protein LOC100854832    107   2e-46   
emb|CAA11131.1|  O-methyltransferase                                    107   3e-46   Prunus dulcis [sweet almond]
gb|KJB73404.1|  hypothetical protein B456_011G231800                    113   4e-46   Gossypium raimondii
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...    122   2e-45   Glycine max [soybeans]
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                      122   2e-45   Glycine soja [wild soybean]
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase                125   3e-45   Glycine soja [wild soybean]
emb|CDP17644.1|  unnamed protein product                                119   5e-45   Coffea canephora [robusta coffee]
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...    115   5e-45   Vitis vinifera
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase           112   7e-45   Morus notabilis
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...    122   1e-44   Glycine max [soybeans]
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    121   5e-44   
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...    119   1e-43   Cicer arietinum [garbanzo]
gb|KJB72587.1|  hypothetical protein B456_011G186600                    114   2e-43   Gossypium raimondii
gb|KDP24062.1|  hypothetical protein JCGZ_25719                         103   2e-43   Jatropha curcas
ref|XP_006371493.1|  hypothetical protein POPTR_0019s12280g             125   4e-43   
gb|KDP24061.1|  hypothetical protein JCGZ_25718                         115   4e-43   Jatropha curcas
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...    106   5e-43   Citrus sinensis [apfelsine]
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...    106   9e-43   Populus trichocarpa [western balsam poplar]
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...    115   1e-42   Glycine max [soybeans]
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...    120   1e-42   Cicer arietinum [garbanzo]
gb|KJB84066.1|  hypothetical protein B456_N001900                       111   1e-42   Gossypium raimondii
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...    105   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...    106   2e-42   Populus euphratica
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...  99.8    4e-42   Sesamum indicum [beniseed]
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                     112   6e-42   Eucalyptus grandis [rose gum]
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...    107   6e-42   Sesamum indicum [beniseed]
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g             108   6e-42   Phaseolus vulgaris [French bean]
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g             103   6e-42   
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...    112   6e-42   Eucalyptus grandis [rose gum]
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g             102   6e-42   
emb|CDP15886.1|  unnamed protein product                                107   7e-42   Coffea canephora [robusta coffee]
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...    107   7e-42   
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg             101   8e-42   Citrus clementina [clementine]
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g             100   8e-42   
ref|XP_002517834.1|  o-methyltransferase, putative                      103   8e-42   Ricinus communis
gb|ABK96707.1|  unknown                                                 100   1e-41   Populus trichocarpa x Populus deltoides
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                   101   1e-41   Citrus sinensis [apfelsine]
emb|CDP19709.1|  unnamed protein product                                106   2e-41   Coffea canephora [robusta coffee]
ref|XP_011092041.1|  PREDICTED: trans-resveratrol di-O-methyltran...    107   3e-41   Sesamum indicum [beniseed]
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...    108   6e-41   Eucalyptus grandis [rose gum]
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    110   7e-41   Eucalyptus grandis [rose gum]
gb|AFK40900.1|  unknown                                                 108   7e-41   Lotus japonicus
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    112   7e-41   Vitis vinifera
ref|XP_007132750.1|  hypothetical protein PHAVU_011G122000g             115   7e-41   Phaseolus vulgaris [French bean]
gb|KJB84021.1|  hypothetical protein B456_N002000                       110   8e-41   Gossypium raimondii
emb|CAN76576.1|  hypothetical protein VITISV_035390                     119   1e-40   Vitis vinifera
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...    112   1e-40   Eucalyptus grandis [rose gum]
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    117   2e-40   Vitis vinifera
gb|ACV65500.1|  deoxyhemigossypol-6-O-methyltransferase                 108   3e-40   Gossypium hirsutum [American cotton]
emb|CDP21212.1|  unnamed protein product                              97.8    3e-40   Coffea canephora [robusta coffee]
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...    120   3e-40   Glycine max [soybeans]
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    119   4e-40   Vitis vinifera
gb|KJB73399.1|  hypothetical protein B456_011G231300                    104   4e-40   Gossypium raimondii
gb|AEN94899.1|  desoxyhemigossypol-6-O-methyltransferase                104   4e-40   Gossypium barbadense [Egyptian cotton]
ref|XP_003615966.1|  O-methyltransferase                                104   5e-40   Medicago truncatula
emb|CBI22005.3|  unnamed protein product                                119   9e-40   Vitis vinifera
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g             102   1e-39   Phaseolus vulgaris [French bean]
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...    109   1e-39   
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g             112   1e-39   Phaseolus vulgaris [French bean]
gb|KDP24057.1|  hypothetical protein JCGZ_25714                         106   1e-39   Jatropha curcas
gb|KJB73403.1|  hypothetical protein B456_011G231700                    103   1e-39   Gossypium raimondii
gb|KJB73396.1|  hypothetical protein B456_011G231000                    105   2e-39   Gossypium raimondii
emb|CAN73269.1|  hypothetical protein VITISV_021917                     117   2e-39   Vitis vinifera
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                     108   2e-39   Eucalyptus grandis [rose gum]
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...    108   2e-39   Eucalyptus grandis [rose gum]
gb|KJB73401.1|  hypothetical protein B456_011G231500                    101   2e-39   Gossypium raimondii
emb|CBI21932.3|  unnamed protein product                                122   2e-39   Vitis vinifera
ref|XP_003615973.1|  O-methyltransferase                                103   2e-39   Medicago truncatula
emb|CDP19713.1|  unnamed protein product                                102   5e-39   Coffea canephora [robusta coffee]
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.9    7e-39   Sesamum indicum [beniseed]
emb|CBI21931.3|  unnamed protein product                                125   2e-38   Vitis vinifera
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    101   2e-38   Solanum tuberosum [potatoes]
ref|XP_002517835.1|  o-methyltransferase, putative                      100   2e-38   Ricinus communis
ref|XP_011016237.1|  PREDICTED: trans-resveratrol di-O-methyltran...    104   2e-38   Populus euphratica
ref|XP_011037437.1|  PREDICTED: trans-resveratrol di-O-methyltran...    104   2e-38   Populus euphratica
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg              97.8    2e-38   Erythranthe guttata [common monkey flower]
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...    114   4e-38   Cicer arietinum [garbanzo]
emb|CAN69556.1|  hypothetical protein VITISV_027590                     125   4e-38   Vitis vinifera
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.4    4e-38   Sesamum indicum [beniseed]
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...    102   4e-38   Sesamum indicum [beniseed]
emb|CDO96819.1|  unnamed protein product                                101   4e-38   Coffea canephora [robusta coffee]
emb|CBI21927.3|  unnamed protein product                                121   5e-38   Vitis vinifera
gb|KJB84245.1|  hypothetical protein B456_N013000                     97.8    6e-38   Gossypium raimondii
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...  97.4    8e-38   
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g             104   1e-37   
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.4    1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g             112   1e-37   
emb|CDP21582.1|  unnamed protein product                                103   1e-37   Coffea canephora [robusta coffee]
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase                 105   1e-37   Morus notabilis
emb|CDO96828.1|  unnamed protein product                                102   3e-37   Coffea canephora [robusta coffee]
ref|XP_002517832.1|  o-methyltransferase, putative                    99.8    4e-37   
ref|XP_006388414.1|  6a-hydroxymaackiain methyltransferase family...    110   4e-37   Populus trichocarpa [western balsam poplar]
gb|KJB73395.1|  hypothetical protein B456_011G230900                  96.3    5e-37   Gossypium raimondii
emb|CAN73270.1|  hypothetical protein VITISV_021918                     100   7e-37   Vitis vinifera
ref|XP_011037440.1|  PREDICTED: trans-resveratrol di-O-methyltran...    110   8e-37   Populus euphratica
gb|KHN07781.1|  Tabersonine 16-O-methyltransferase                    99.0    1e-36   Glycine soja [wild soybean]
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.8    1e-36   Populus euphratica
ref|XP_002522501.1|  o-methyltransferase, putative                    95.5    1e-36   Ricinus communis
gb|ACU19152.1|  unknown                                                 123   2e-36   Glycine max [soybeans]
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...  89.7    2e-36   Mentha x piperita
emb|CBI21925.3|  unnamed protein product                                121   2e-36   Vitis vinifera
ref|XP_003607523.1|  O-methyltransferase                                106   3e-36   
ref|XP_006582298.1|  PREDICTED: trans-resveratrol di-O-methyltran...  99.0    3e-36   Glycine max [soybeans]
gb|AES89720.2|  orcinol O-methyltransferase                             106   3e-36   Medicago truncatula
dbj|BAJ05384.1|  O-methyltransferase                                    104   4e-36   Carapichea ipecacuanha [ipecac]
ref|XP_002517833.1|  o-methyltransferase, putative                    95.5    5e-36   
dbj|BAI79244.1|  O-methyltransferase                                    104   6e-36   Carapichea ipecacuanha [ipecac]
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...    100   6e-36   Sesamum indicum [beniseed]
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg              90.5    7e-36   Erythranthe guttata [common monkey flower]
ref|XP_010052318.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.5    8e-36   Eucalyptus grandis [rose gum]
dbj|BAJ05387.1|  O-methyltransferase                                    103   8e-36   Carapichea ipecacuanha [ipecac]
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...    100   1e-35   
ref|NP_001241397.1|  uncharacterized protein LOC100808660             96.3    1e-35   Glycine max [soybeans]
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...    100   1e-35   Vitis vinifera
ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683  95.9    1e-35   
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...  98.6    2e-35   
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...  98.6    2e-35   
ref|XP_010040590.1|  PREDICTED: trans-resveratrol di-O-methyltran...    108   2e-35   Eucalyptus grandis [rose gum]
emb|CDP19711.1|  unnamed protein product                              98.6    2e-35   Coffea canephora [robusta coffee]
gb|KCW45078.1|  hypothetical protein EUGRSUZ_L01321                     108   2e-35   Eucalyptus grandis [rose gum]
ref|XP_003615967.1|  O-methyltransferase                                101   2e-35   Medicago truncatula
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...  98.2    2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...  99.0    2e-35   Populus euphratica
ref|XP_002525163.1|  o-methyltransferase, putative                    91.3    2e-35   
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.6    3e-35   Solanum lycopersicum
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.8    3e-35   
gb|AAR09603.1|  O-methyltransferase                                   99.8    3e-35   Mentha x piperita
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...    101   4e-35   Citrus sinensis [apfelsine]
ref|XP_010111159.1|  6a-hydroxymaackiain methyltransferase 1          96.7    4e-35   
ref|XP_007025514.1|  Flavonoid o-methyltransferase related            90.5    5e-35   
ref|XP_004293905.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.8    1e-34   Fragaria vesca subsp. vesca
ref|XP_009597680.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.8    1e-34   Nicotiana tomentosiformis
ref|XP_009345025.1|  PREDICTED: trans-resveratrol di-O-methyltran...  93.6    2e-34   Pyrus x bretschneideri [bai li]
ref|XP_009779391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    102   3e-34   Nicotiana sylvestris
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...  98.6    3e-34   Nicotiana tomentosiformis
gb|KGN43480.1|  hypothetical protein Csa_7G039280                     94.4    3e-34   Cucumis sativus [cucumbers]
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                 95.1    3e-34   Malus zumi
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.7    4e-34   
ref|XP_010093977.1|  Tabersonine 16-O-methyltransferase               93.2    4e-34   
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.4    4e-34   
ref|XP_011085377.1|  PREDICTED: chavicol O-methyltransferase-like     88.6    4e-34   
ref|XP_009791021.1|  PREDICTED: trans-resveratrol di-O-methyltran...  96.3    5e-34   
ref|XP_006377431.1|  6a-hydroxymaackiain methyltransferase family...  87.4    5e-34   
ref|XP_009791022.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.5    7e-34   
ref|XP_004170024.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.5    7e-34   
ref|XP_004139733.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...  90.1    1e-33   
emb|CAN75970.1|  hypothetical protein VITISV_009881                   85.9    1e-33   
ref|XP_002305104.2|  6a-hydroxymaackiain methyltransferase family...  87.4    1e-33   
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.9    1e-33   
sp|Q93WU2.1|EOMT1_OCIBA  RecName: Full=Eugenol O-methyltransferas...  94.0    1e-33   
gb|KDP21022.1|  hypothetical protein JCGZ_21493                       86.3    2e-33   
gb|AGQ21572.1|  flavone 8-O-methyltransferase                         91.3    2e-33   
dbj|BAJ72588.1|  7'-O-demethylcephaeline/cephaeline O-methyltrans...    104   2e-33   
ref|XP_011001215.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.4    2e-33   
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    103   2e-33   
ref|XP_006421002.1|  hypothetical protein CICLE_v10006550mg           91.7    2e-33   
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.9    3e-33   
ref|XP_006421003.1|  hypothetical protein CICLE_v10006646mg           93.2    3e-33   
ref|XP_008455485.1|  PREDICTED: trans-resveratrol di-O-methyltran...    101   3e-33   
ref|XP_011027758.1|  PREDICTED: trans-resveratrol di-O-methyltran...  92.0    3e-33   
ref|XP_010095219.1|  Tabersonine 16-O-methyltransferase               93.6    3e-33   
ref|NP_001267964.1|  O-methyltransferase                              87.0    4e-33   
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.1    5e-33   
gb|KDP21023.1|  hypothetical protein JCGZ_21494                       98.2    5e-33   
ref|XP_009778350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    103   5e-33   
emb|CBI21921.3|  unnamed protein product                                115   6e-33   
gb|KGN43481.1|  O-methyltransferase                                   94.7    6e-33   
ref|XP_009597678.1|  PREDICTED: trans-resveratrol di-O-methyltran...  93.6    7e-33   
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.4    8e-33   
ref|XP_004169299.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.4    9e-33   
ref|XP_004151088.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.4    1e-32   
ref|XP_007025515.1|  Flavonoid o-methyltransferase related, putative  84.7    1e-32   
ref|XP_009628719.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.7    3e-32   
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                 86.3    3e-32   
ref|XP_006489813.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...  92.4    3e-32   
sp|Q93WU3.1|CVMT1_OCIBA  RecName: Full=Chavicol O-methyltransfera...  87.8    4e-32   
gb|KHN08846.1|  8-hydroxyquercetin 8-O-methyltransferase                120   4e-32   
ref|XP_010111158.1|  Tabersonine 16-O-methyltransferase               94.7    4e-32   
ref|XP_006492044.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  92.8    5e-32   
ref|XP_011037460.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.7    6e-32   
ref|XP_006489814.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.4    6e-32   
ref|XP_009625456.1|  PREDICTED: trans-resveratrol di-O-methyltran...  98.2    9e-32   
ref|XP_007141103.1|  hypothetical protein PHAVU_008G1678001g          94.4    1e-31   
ref|XP_007141104.1|  hypothetical protein PHAVU_008G1678001g          94.4    1e-31   
gb|AAR02421.1|  putative O-methyltransferase                          88.6    1e-31   
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.9    1e-31   
gb|ADO16249.1|  chavicol O-methyltransferase                          86.3    1e-31   
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                   88.6    2e-31   
dbj|BAI79245.1|  O-methyltransferase                                  97.4    2e-31   
dbj|BAI77794.1|  chavicol O-methyltransferase                         86.3    2e-31   
gb|KDO41475.1|  hypothetical protein CISIN_1g0225151mg                  124   2e-31   
ref|XP_007132755.1|  hypothetical protein PHAVU_011G1223001g            124   2e-31   
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.7    2e-31   
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...  88.2    2e-31   
ref|XP_011091734.1|  PREDICTED: trans-resveratrol di-O-methyltran...  83.6    2e-31   
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.0    3e-31   
gb|KGN44538.1|  hypothetical protein Csa_7G328260                     87.8    3e-31   
dbj|BAA86059.1|  O-methyltransferase                                  87.4    3e-31   
ref|XP_010093976.1|  Myricetin O-methyltransferase                    99.4    4e-31   
sp|Q8GSN1.1|MOMT_CATRO  RecName: Full=Myricetin O-methyltransfera...  99.0    4e-31   
ref|XP_002522586.1|  o-methyltransferase, putative                    88.2    5e-31   
ref|XP_008362624.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.8    5e-31   
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g             125   5e-31   
ref|XP_008362623.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.8    6e-31   
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...    125   7e-31   
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...  86.7    7e-31   
dbj|BAJ05388.1|  O-methyltransferase                                  95.5    7e-31   
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg             125   7e-31   
ref|XP_010109381.1|  Tabersonine 16-O-methyltransferase               95.1    1e-30   
ref|XP_002522500.1|  o-methyltransferase, putative                    85.9    1e-30   
ref|XP_008343875.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.0    2e-30   
gb|KDP35391.1|  hypothetical protein JCGZ_10375                       92.0    2e-30   
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...  92.8    2e-30   
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like     81.6    2e-30   
ref|XP_010057351.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.7    2e-30   
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.4    2e-30   
gb|AAX82431.1|  3,5-dimethoxyphenol O-methyltransferase               87.0    2e-30   
gb|KCW74500.1|  hypothetical protein EUGRSUZ_E03212                   79.7    2e-30   
sp|B0EXJ8.1|HTOMT_CATRO  RecName: Full=Tabersonine 16-O-methyltra...  92.0    2e-30   
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    124   3e-30   
gb|KHN19130.1|  8-hydroxyquercetin 8-O-methyltransferase                122   3e-30   
emb|CAJ65611.1|  putative orcinol O-methyltransferase                   123   4e-30   
ref|XP_008356011.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.4    4e-30   
ref|XP_002517831.1|  Chavicol O-methyltransferase, putative           91.3    4e-30   
ref|XP_008345969.1|  PREDICTED: LOW QUALITY PROTEIN: isoflavone 4...  94.4    5e-30   
ref|XP_006357086.1|  PREDICTED: tabersonine 16-O-methyltransferas...    101   5e-30   
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.9    5e-30   
ref|XP_004163430.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...  94.0    5e-30   
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg           84.7    6e-30   
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.1    7e-30   
ref|XP_009780812.1|  PREDICTED: myricetin O-methyltransferase-like      110   7e-30   
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    122   9e-30   
gb|KCW59786.1|  hypothetical protein EUGRSUZ_H02535                   86.3    1e-29   
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    122   1e-29   
gb|KJB73402.1|  hypothetical protein B456_011G231600                  97.1    1e-29   
ref|XP_009605623.1|  PREDICTED: myricetin O-methyltransferase-like      110   1e-29   
ref|XP_008392935.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.1    1e-29   
ref|XP_006365443.1|  PREDICTED: trans-resveratrol di-O-methyltran...    101   1e-29   
dbj|BAJ05383.1|  O-methyltransferase                                  89.0    1e-29   
ref|XP_010320673.1|  PREDICTED: trans-resveratrol di-O-methyltran...    105   1e-29   
dbj|BAI79243.1|  O-methyltransferase                                  89.0    1e-29   
emb|CBI21926.3|  unnamed protein product                                121   1e-29   
ref|XP_010320677.1|  PREDICTED: trans-resveratrol di-O-methyltran...    105   2e-29   
ref|XP_004229155.1|  PREDICTED: myricetin O-methyltransferase-lik...    105   2e-29   
ref|XP_008343876.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.7    2e-29   
ref|XP_008354304.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.7    2e-29   
ref|XP_003615962.1|  O-methyltransferase                              99.0    2e-29   
ref|XP_008454865.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.0    2e-29   
ref|XP_006376394.1|  hypothetical protein POPTR_0013s12650g           95.9    2e-29   
ref|XP_006471149.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.7    3e-29   
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...    104   3e-29   
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    120   4e-29   
emb|CAJ65637.1|  putative orcinol O-methyltransferase                   120   4e-29   
ref|XP_008778275.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.2    5e-29   
ref|XP_008778001.1|  PREDICTED: trans-resveratrol di-O-methyltran...  77.8    5e-29   
ref|XP_003615968.1|  O-methyltransferase                              82.0    6e-29   
ref|XP_007148101.1|  hypothetical protein PHAVU_006G180900g           80.9    1e-28   
gb|KDO37374.1|  hypothetical protein CISIN_1g023625mg                 99.8    1e-28   
emb|CBI38115.3|  unnamed protein product                                112   1e-28   
ref|XP_009398848.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.0    1e-28   
gb|AAR02419.1|  flavonoid 4'-O-methyltransferase                      92.8    2e-28   
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                   84.7    2e-28   
ref|XP_003536186.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  91.7    2e-28   
ref|XP_007132751.1|  hypothetical protein PHAVU_011G1221001g            116   2e-28   
ref|XP_008807987.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.9    4e-28   
ref|XP_003536188.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  89.0    4e-28   
gb|KHN30531.1|  Isoflavone 7-O-methyltransferase                      89.0    5e-28   
ref|XP_004490694.1|  PREDICTED: trans-resveratrol di-O-methyltran...    114   6e-28   
ref|XP_011091735.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.7    6e-28   
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.1    6e-28   
ref|XP_008359463.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.3    7e-28   
gb|AAM97498.1|  O-methyltransferase                                   87.8    8e-28   
ref|XP_010689977.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.8    1e-27   
ref|XP_010243530.1|  PREDICTED: trans-resveratrol di-O-methyltran...  97.1    1e-27   
ref|XP_009396879.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.8    1e-27   
ref|XP_003533873.1|  PREDICTED: isoflavone-7-O-methyltransferase ...  90.9    1e-27   
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...    117   1e-27   
ref|XP_003556407.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  92.0    2e-27   
gb|ACU20151.1|  unknown                                               92.0    2e-27   
ref|XP_009618299.1|  PREDICTED: trans-resveratrol di-O-methyltran...  89.7    2e-27   
gb|AFK42082.1|  unknown                                               77.4    3e-27   
gb|AIE16681.1|  isoflavone O-methyltransferase                        82.4    3e-27   
ref|XP_009770464.1|  PREDICTED: trans-resveratrol di-O-methyltran...    101   3e-27   
ref|XP_006467716.1|  PREDICTED: isoflavone 4'-O-methyltransferase...  84.7    4e-27   
ref|XP_009376908.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.5    4e-27   
gb|AIE16688.1|  isoflavone O-methyltransferase                        81.6    4e-27   
gb|KDO39657.1|  hypothetical protein CISIN_1g046346mg                   112   6e-27   
gb|AIE16678.1|  isoflavone O-methyltransferase                        81.6    7e-27   
emb|CDP21583.1|  unnamed protein product                                114   8e-27   
ref|XP_008392936.1|  PREDICTED: trans-resveratrol di-O-methyltran...  84.0    9e-27   
gb|KDO38698.1|  hypothetical protein CISIN_1g046950mg                 92.8    9e-27   
ref|NP_001241010.1|  uncharacterized protein LOC100812688             86.7    1e-26   
ref|XP_006376382.1|  6a-hydroxymaackiain methyltransferase family...  94.7    1e-26   
ref|XP_008455549.1|  PREDICTED: trans-resveratrol di-O-methyltran...    102   1e-26   
ref|XP_006364317.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.5    1e-26   
ref|XP_010694747.1|  PREDICTED: trans-resveratrol di-O-methyltran...  95.1    1e-26   
gb|KJB66766.1|  hypothetical protein B456_010G157300                  77.8    1e-26   
ref|NP_001241162.1|  uncharacterized protein LOC100813225             79.0    2e-26   
gb|KDO37308.1|  hypothetical protein CISIN_1g041250mg                 93.2    2e-26   
gb|AIE16682.1|  isoflavone O-methyltransferase                        78.6    2e-26   
gb|KHN30530.1|  Isoflavone 7-O-methyltransferase                      90.9    2e-26   
ref|XP_010070153.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.6    3e-26   
ref|XP_006467714.1|  PREDICTED: isoflavone 4'-O-methyltransferase...  80.9    3e-26   
ref|XP_003536187.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  90.5    3e-26   
ref|XP_006467715.1|  PREDICTED: isoflavone 4'-O-methyltransferase...  80.9    3e-26   
ref|XP_006428633.1|  hypothetical protein CICLE_v10013393mg           92.8    3e-26   
ref|XP_003531866.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  83.2    3e-26   
gb|KHN14021.1|  Isoflavone 7-O-methyltransferase                      82.8    4e-26   
ref|XP_006356529.1|  PREDICTED: trans-resveratrol di-O-methyltran...  99.4    5e-26   
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...  80.5    5e-26   
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                   80.5    5e-26   
ref|XP_004151089.1|  PREDICTED: trans-resveratrol di-O-methyltran...  94.4    5e-26   
ref|XP_006449423.1|  hypothetical protein CICLE_v10015724mg           78.2    6e-26   
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...  87.0    7e-26   
ref|XP_010032853.1|  PREDICTED: trans-resveratrol di-O-methyltran...  75.5    9e-26   
gb|KJB73390.1|  hypothetical protein B456_011G230800                  84.0    9e-26   
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.5    9e-26   
ref|XP_004303135.2|  PREDICTED: trans-resveratrol di-O-methyltran...  97.4    1e-25   
gb|KEH29280.1|  isoflavone-7-O-methyltransferase                      72.0    1e-25   
gb|KEH29290.1|  isoflavone-7-O-methyltransferase                      72.0    1e-25   
gb|ABD83946.1|  IOMT 7                                                72.0    1e-25   
gb|KDO37870.1|  hypothetical protein CISIN_1g023384mg                 94.0    2e-25   
gb|ACD13278.1|  eugenol O-methyltransferase                           92.4    2e-25   
gb|ACD13282.1|  eugenol O-methyltransferase                           92.4    2e-25   
ref|XP_008359464.1|  PREDICTED: trans-resveratrol di-O-methyltran...  81.3    2e-25   
ref|XP_010920170.1|  PREDICTED: trans-resveratrol di-O-methyltran...  86.7    3e-25   
ref|XP_003622357.1|  Isoflavone-7-O-methyltransferase                 80.5    3e-25   
gb|ABD83944.1|  IOMT 4                                                80.5    3e-25   
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                     110   3e-25   
ref|XP_006421001.1|  hypothetical protein CICLE_v10006423mg           92.4    3e-25   
gb|KHN05026.1|  Isoflavone 7-O-methyltransferase                      88.6    4e-25   
ref|XP_010683510.1|  PREDICTED: trans-resveratrol di-O-methyltran...  82.4    5e-25   
ref|XP_003556405.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  87.0    5e-25   
ref|XP_010052330.1|  PREDICTED: trans-resveratrol di-O-methyltran...  78.2    7e-25   
ref|XP_010052398.1|  PREDICTED: trans-resveratrol di-O-methyltran...  79.0    7e-25   
ref|XP_011037436.1|  PREDICTED: trans-resveratrol di-O-methyltran...    106   1e-24   
gb|KHG15351.1|  8-hydroxyquercetin 8-O-methyltransferase                108   1e-24   
gb|KDO50515.1|  hypothetical protein CISIN_1g0382082mg                94.4    1e-24   
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...  88.6    1e-24   
ref|XP_008792251.1|  PREDICTED: trans-resveratrol di-O-methyltran...  85.9    1e-24   
ref|XP_010244054.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...  78.2    1e-24   
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570        84.7    2e-24   
ref|XP_003555535.1|  PREDICTED: isoflavone 7-O-methyltransferase-...  85.9    2e-24   
gb|KHN14033.1|  Isoflavone 7-O-methyltransferase                      77.4    2e-24   
ref|XP_009777944.1|  PREDICTED: trans-resveratrol di-O-methyltran...  90.1    2e-24   
sp|C6TAY1.1|SOMT2_SOYBN  RecName: Full=Flavonoid 4'-O-methyltrans...  77.0    4e-24   
gb|AAU20765.1|  (S)-norcoclaurine 6-O-methyltransferase               86.3    4e-24   
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...  72.0    4e-24   
gb|ACO90238.1|  norcoclaurine 6-O-methyltransferase                   86.3    4e-24   
gb|KHM99712.1|  Tabersonine 16-O-methyltransferase                      104   5e-24   
ref|XP_008455943.1|  PREDICTED: trans-resveratrol di-O-methyltran...  71.6    5e-24   
emb|CDP19712.1|  unnamed protein product                              77.8    5e-24   
gb|KDP24060.1|  hypothetical protein JCGZ_25717                         106   6e-24   
gb|KCW89597.1|  hypothetical protein EUGRSUZ_A01880                   85.1    6e-24   
dbj|BAM37634.1|  O-methyltransferase                                  77.4    7e-24   
ref|XP_007143925.1|  hypothetical protein PHAVU_007G114000g           77.8    8e-24   
pdb|4E70|A  Chain A, Crystal Structure Analysis Of Coniferyl Alco...  69.7    9e-24   
gb|ABJ88947.1|  coniferyl alcohol 9-O-methyltransferase               69.7    9e-24   



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score =   139 bits (349),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +SEWF+ND PTPF T HG T WDYAG EP+LNH FN+AMASDA+LVMN+V+KY + VFEG
Sbjct  139  VSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMNVVIKYSKDVFEG  198

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA+AFP L+CTVFDLPHVV GLE
Sbjct  199  LNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLE  238


 Score =   129 bits (323),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 73/94 (78%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSD------DEGYAL  163
            HKHG PMTL QL NAL IN AK+THL RLMR LIHSGFFV ++ Q ++       EGYAL
Sbjct  46   HKHGKPMTLDQLANALSINKAKTTHLRRLMRILIHSGFFVKSRIQENEGESERIGEGYAL  105

Query  164  APPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            APPS LLLKD PLSV PFLLA+LDPIL KPWH++
Sbjct  106  APPSRLLLKDEPLSVTPFLLAMLDPILVKPWHHV  139



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   138 bits (348),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +SEWF+ND PTPF T HG T WDYAG EP+LNH FN+AMASDA+LVMN+V+KY + VFEG
Sbjct  137  VSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMNVVIKYSKDVFEG  196

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA+AFP L+CTVFDLPHVV GLE
Sbjct  197  LNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLE  236


 Score =   117 bits (294),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 71/92 (77%), Gaps = 4/92 (4%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEG----YALAP  169
            HKHG PMTL QL NAL IN AK+THL RLMR LI SGFFV ++ Q ++ E     Y+LAP
Sbjct  46   HKHGKPMTLDQLANALSINKAKTTHLRRLMRILIRSGFFVKSRIQENEGESEGEGYSLAP  105

Query  170  PSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            PS LLLKD PLSV PFLLA+LDPIL KPWH++
Sbjct  106  PSRLLLKDEPLSVTPFLLAMLDPILVKPWHHV  137



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score =   127 bits (320),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV +++V  CR VFEGL
Sbjct  144  STWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIVDECRGVFEGL  203

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            DS+VDVGGG GT AK IADAFPH+KCTV DLPHVV  L+
Sbjct  204  DSLVDVGGGTGTVAKAIADAFPHIKCTVLDLPHVVADLQ  242


 Score =   112 bits (279),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPIN  KS  + RLMR LIHSGFF   K   SD+EGY L   S L
Sbjct  56   NKHGRPMTLSELTSALPINPTKSHSIYRLMRILIHSGFFAKKKLSKSDEEGYVLTDASQL  115

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPWH
Sbjct  116  LLKDHPLSITPFLNAMLDPVLTKPWH  141



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score =   135 bits (341),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HG T WDY G EPK N+ FNEAMASDARLV + ++K C+ VFEG
Sbjct  133  VSAWFQNDDPTPFDTAHGXTFWDYGGHEPKJNNFFNEAMASDARLVTSXLIKDCKGVFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA+AFPHL CTVFDLPHVV GLE
Sbjct  193  LNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLE  232


 Score =   103 bits (258),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSD-DEGYALAPPSI  178
            H HG PMTL +LV  LPI+  K   + RLMR L+ SGFF   K + S+ +EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPIHPKKVWCVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLL+D+PLSVRPFLLA+LDPILTKPWH +
Sbjct  105  LLLEDDPLSVRPFLLAMLDPILTKPWHYV  133



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   135 bits (340),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HG T WDY G EPK+N+ FNEAMASDARLV ++++K C+ VFEG
Sbjct  133  VSAWFQNDDPTPFDTAHGRTFWDYGGHEPKINNFFNEAMASDARLVTSVLIKDCKGVFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA+AFPHL CTVFDLPHVV GLE
Sbjct  193  LNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLE  232


 Score =   103 bits (258),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSD-DEGYALAPPSI  178
            H HG PMTL +LV  LPI+  K   + RLMR L+ SGFF   K + S+ +EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPIHPKKVWCVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLL+D+PLSVRPFLLA+LDPILTKPWH +
Sbjct  105  LLLEDDPLSVRPFLLAMLDPILTKPWHYV  133



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score =   129 bits (324),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            ++EWF +D+PTPF   HG T WDYAG E +LNH FN+AMASDA+LVM++V+KY + VFEG
Sbjct  141  VNEWFSSDEPTPFEVAHGRTFWDYAGHEQRLNHFFNDAMASDAKLVMSVVMKYSKDVFEG  200

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA  FP+L+CTVFDLPHVV GLE
Sbjct  201  LNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGLE  240


 Score =   107 bits (268),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFV--------ITKTQGSDDEGY  157
            HKHG PMTL +L NAL IN +K THL RLMR LIHSGFF+           +   + EGY
Sbjct  46   HKHGKPMTLNELANALSINKSKITHLRRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGY  105

Query  158  ALAPPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
             LAPP+ LLLKD PL+V PFLLA+LDPIL KPWH++
Sbjct  106  VLAPPARLLLKDEPLTVTPFLLAMLDPILVKPWHHV  141



>emb|CDP20220.1| unnamed protein product [Coffea canephora]
Length=270

 Score =   123 bits (308),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S+WFQN D TPFYT HG +L+D+A  EP++N  FN+AMASDARLV ++V K C+ VFEG
Sbjct  137  LSQWFQNSDETPFYTCHGRSLYDFASHEPRINQFFNKAMASDARLVSSVVTKDCKHVFEG  196

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFP LKCTV DLPHVV GLE
Sbjct  197  LNSLVDVGGGTGTLAKAIADAFPSLKCTVLDLPHVVDGLE  236


 Score =   114 bits (284),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 69/91 (76%), Gaps = 3/91 (3%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE---GYALAPP  172
            HKHG PMTL QL++ALPI NAK+T + RLM+ LIHSGFF+  K  G++++   GY L P 
Sbjct  47   HKHGQPMTLDQLIDALPIKNAKATFIYRLMQNLIHSGFFIEAKIPGNENDNQKGYLLTPA  106

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            S LLLK NP SV PFLLA+LDP LT PWH++
Sbjct  107  SELLLKSNPFSVTPFLLAMLDPTLTDPWHHL  137



>ref|XP_006364110.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=267

 Score =   129 bits (323),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            ++EWF +D+PTPF   HG T WDYAG E +LNH FN+AMASDA+LVM++V+KY + VFEG
Sbjct  141  VNEWFSSDEPTPFEVAHGRTFWDYAGHEQRLNHFFNDAMASDAKLVMSVVMKYSKDVFEG  200

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA  FP+L+CTVFDLPHVV GLE
Sbjct  201  LNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGLE  240


 Score =   107 bits (266),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFV--------ITKTQGSDDEGY  157
            HKHG PMTL +L NAL IN +K THL RLMR LIHSGFF+           +   + EGY
Sbjct  46   HKHGKPMTLDELANALSINKSKITHLRRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGY  105

Query  158  ALAPPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
             LAPP+ LLLKD PL+V PFLLA+LDPIL KPWH++
Sbjct  106  VLAPPARLLLKDEPLTVTPFLLAMLDPILVKPWHHV  141



>ref|XP_002277927.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   131 bits (330),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T H  TLWDYAG EP+LN+ FNEAMASDARLV +++VK  + VFEG
Sbjct  133  VSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLVKEGKGVFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA+AFPHLKCTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGTVAKAIANAFPHLKCTVLDLPHVVAGLQ  232


 Score =   103 bits (256),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            H HG PMTL QLV  LP++  K+ ++ RLMR L+ S FF   + Q S++E GY L   S 
Sbjct  45   HNHGKPMTLPQLVAKLPVHPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+ LSVRPFLLA+LDP LTKPWH +
Sbjct  105  LLLKDDSLSVRPFLLAMLDPTLTKPWHYV  133



>ref|XP_002517827.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44345.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   125 bits (314),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDD TPF TVHGM  W+YAG EPK N+ FNEAMASDARLVM +++   + VFEG
Sbjct  132  VSTWFQNDDATPFDTVHGMPFWEYAGNEPKFNNFFNEAMASDARLVMRVLIDEYKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT A  IA AFP L C VFDLPHVV GL+
Sbjct  192  LNSLVDVGGGTGTMAAAIAKAFPQLDCIVFDLPHVVAGLQ  231


 Score =   109 bits (272),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            H HG P++L+QL+ ALP+  AK+  + RLMR L+HSGFF   K +G+D+E G+ L   S 
Sbjct  44   HSHGRPISLSQLIAALPVLPAKARCIPRLMRILVHSGFFANAKIKGNDEEEGFVLTSASK  103

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKDNPLSV PFLLA+LDPILT+PWH +
Sbjct  104  LLLKDNPLSVTPFLLAMLDPILTEPWHYV  132



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   132 bits (333),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HG T WDYAG EPKLN+ FNEAMASDARLV ++++K C+ +F G
Sbjct  133  VSAWFQNDDPTPFDTAHGRTFWDYAGHEPKLNNFFNEAMASDARLVTSVLIKDCKGIFVG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT A+ IA+AFPHL CTV DLPHVV GLE
Sbjct  193  LNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLE  232


 Score =   100 bits (248),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGS-DDEGYALAPPSI  178
            H HG PMTL++LV  LP+N  K+  + RLMR L+ SGFF   + Q S  +EGY L   S 
Sbjct  45   HNHGKPMTLSELVAELPVNPEKTKCVYRLMRLLVQSGFFTRKRVQESGQEEGYVLTHASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+PLS RPFLLA+LDP+L  PW  +
Sbjct  105  LLLKDDPLSARPFLLAMLDPVLITPWQYV  133



>emb|CAN69333.1| hypothetical protein VITISV_003273 [Vitis vinifera]
Length=350

 Score =   130 bits (327),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T H  TLWDYAG EP+LN+ FNEAMASDARLV +++VK  + VFEG
Sbjct  126  VSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYXFNEAMASDARLVTSVLVKEGKGVFEG  185

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA+AFPHL CTV DLPHVV GL+
Sbjct  186  LNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQ  225


 Score =   102 bits (254),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            H HG PMTL QLV  LP++  K+ ++ RLMR L+ S FF   + Q S++E GY L   S 
Sbjct  38   HNHGKPMTLPQLVAKLPVHPKKTQYVYRLMRVLVQSDFFAAPRAQQSEEEEGYVLTHASR  97

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+ LSVRPFLLA+LDP LTKPWH +
Sbjct  98   LLLKDDSLSVRPFLLAMLDPTLTKPWHYV  126



>ref|XP_002274019.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   129 bits (324),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T H  TLWDYAG EP+LN+ FNEAMASDARLV +++VK  + VFEG
Sbjct  133  VSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLVKEGKGVFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA+AFPHL CTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQ  232


 Score =   102 bits (253),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            H HG PMTL +LV  LP++  K+ ++ RLMR L+ S FF   + Q S++E GY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+ LSVRPFLLA+LDP LTKPWH +
Sbjct  105  LLLKDDSLSVRPFLLAMLDPTLTKPWHYV  133



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   119 bits (298),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S+WFQN + TPF+T HG +LW+ AG++P+LN  FNE MASDARLV  MV++ C+ VF GL
Sbjct  135  SQWFQNSEETPFHTCHGTSLWELAGRQPQLNQFFNEGMASDARLVSTMVIENCKDVFMGL  194

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S++DVGGG GT AK IADAFPHL+C+V DLPHVV G E
Sbjct  195  NSLIDVGGGTGTVAKAIADAFPHLQCSVLDLPHVVDGWE  233


 Score =   111 bits (277),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKT-QGSDDEGYALAPPSI  178
            HKHG PM L QL++ALPINNAK+  + RLMR LIHSGFF+  K       EGYAL   S 
Sbjct  46   HKHGQPMALAQLIDALPINNAKAPFVYRLMRILIHSGFFIKAKIPDNEGQEGYALTSASK  105

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLL ++P SV PFLLA+LDPILT PWH+ 
Sbjct  106  LLLANDPFSVTPFLLAMLDPILTDPWHHF  134



>emb|CAH05083.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   121 bits (304),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDD TPF T HGMT+WDY   +P  +H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDLTPFATAHGMTMWDYGNHQPSFSHFFNDAMASDARLVASVIINECKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   108 bits (271),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  L RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGPPMTLSELTSALPIHPTKSHSLDRLMRILVHSGFFAKEKLSETDEEGYTLTDTSQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLKD+PLS+ PFL A+LDP+LTKPWH++
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWHHL  132



>emb|CAN83014.1| hypothetical protein VITISV_029725 [Vitis vinifera]
Length=357

 Score =   127 bits (320),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T H  TLWDYAG EP+LN+  NEAMASDARLV +++VK  + VFEG
Sbjct  133  VSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLVKEGKGVFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA+AFPHL CTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQ  232


 Score =   102 bits (254),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            H HG PMTL +LV  LP++  K+ ++ RLMR L+ S FF   + Q S++E GY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASX  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+ LSVRPFLLA+LDP LTKPWH +
Sbjct  105  LLLKDDSLSVRPFLLAMLDPTLTKPWHYV  133



>ref|XP_002278057.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   127 bits (320),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T H  TLWDYAG EP+LN+  NEAMASDARLV +++VK  + VFEG
Sbjct  133  VSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLVKEGKGVFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA+AFPHL CTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQ  232


 Score =   101 bits (252),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            H HG PMTL +LV  LP++  K+ ++ RLMR L+ S FF   + Q S++E GY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASQ  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+ LSVRPFLLA+LDP LTKPWH +
Sbjct  105  LLLKDDSLSVRPFLLAMLDPTLTKPWHYV  133



>emb|CAJ65612.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   124 bits (310),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P++ H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPRIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65638.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   120 bits (302),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMA DARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   108 bits (269),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGCPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPWH
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWH  130



>emb|CAJ65608.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   123 bits (308),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (263),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSITPFLTAMLDPVLTKPWN  130



>emb|CAJ65609.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   123 bits (308),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (262),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSITPFLTAMLDPVLTKPWN  130



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score =   122 bits (307),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQND P+ FYT H  T W+YAG E +LNH FNEAMASDARLV +++V  C+ VFEG
Sbjct  134  VSVWFQNDAPSSFYTAHQRTSWEYAGHETELNHFFNEAMASDARLVSSVLVNECKGVFEG  193

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA  F HL CTVFDLPHVV GLE
Sbjct  194  LNSLVDVGGGTGTVAKAIAKEFQHLDCTVFDLPHVVAGLE  233


 Score =   105 bits (263),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQG-SDDEGYALAPPSI  178
            H HG PMTL++LV  LPI+ +K+  + RLMR L+HSGFF      G ++ EGY L   S 
Sbjct  46   HNHGKPMTLSELVAVLPIHPSKAPGIYRLMRILVHSGFFATQNNSGETEGEGYVLTNASQ  105

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL+KDNP SV PFLLA+LDPILT+PWH +
Sbjct  106  LLIKDNPFSVTPFLLAMLDPILTQPWHYV  134



>emb|CAJ65641.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   122 bits (306),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LKSLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   106 bits (264),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL AVLDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAVLDPVLTKPWN  130



>emb|CAJ65602.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   121 bits (303),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDP PF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPAPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   107 bits (266),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMRTL+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRTLVHSGFFAKKKLSTTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65625.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65623.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65642.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65647.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65624.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65645.1| putative orcinol O-methyltransferase [Rosa roxburghii]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65648.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65635.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65646.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   122 bits (307),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65640.1| putative orcinol O-methyltransferase [Rosa majalis]
 emb|CAJ65650.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65651.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65652.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65653.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65654.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAH05087.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65604.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65607.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score =   122 bits (307),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  143  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  202

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  203  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  242


 Score =   105 bits (261),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  56   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  115

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  116  LLKDHPLSLTPFLTAMLDPVLTKPWN  141



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   119 bits (297),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S+WFQN D TPFYT HG +++ +A  EP LN  FNEAMASDAR+V ++V K C+ VFEG
Sbjct  137  LSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDARMVSSVVTKDCKHVFEG  196

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VD+GGG GT AK IADAFP LKCTV DLPHVV GLE
Sbjct  197  LNSLVDIGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLE  236


 Score =   108 bits (271),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 3/91 (3%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE---GYALAPP  172
            HKHG PMTL QL++ALPI NAK+  + RLM+ LIHSGFF+  K  G++++   GY L   
Sbjct  47   HKHGQPMTLDQLIDALPIKNAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSA  106

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            S LLLK NP SV PFLLA+LDP LT PWH++
Sbjct  107  SELLLKSNPFSVTPFLLAMLDPALTDPWHHL  137



>emb|CAJ65632.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
 emb|CAJ65658.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   123 bits (308),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65628.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   123 bits (308),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65663.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   123 bits (308),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAH05089.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   122 bits (307),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65630.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   123 bits (308),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65643.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   120 bits (302),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLP VV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPQVVADLQ  231


 Score =   106 bits (264),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL AVLDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAVLDPVLTKPWN  130



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score =   129 bits (325),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HG +LW+YAG EPK+N+ FNEAMASDARL   +V+  C+ VFEG
Sbjct  177  LSTWFQNDDPTPFDTAHGKSLWEYAGDEPKINNFFNEAMASDARLATRVVIHKCKDVFEG  236

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA AFP+L+CT FDLPHVV+GLE
Sbjct  237  LNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLE  276


 Score = 97.4 bits (241),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 62/90 (69%), Gaps = 5/90 (6%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFV-----ITKTQGSDDEGYALA  166
            +KHG PMTL +LV+AL IN +K+  + RLMR LIHSGFF       ++    +++GY L 
Sbjct  85   NKHGKPMTLNELVSALTINPSKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLT  144

Query  167  PPSILLLKDNPLSVRPFLLAVLDPILTKPW  256
              S LLLKDNPLSV PFL A+LDPIL  PW
Sbjct  145  NASKLLLKDNPLSVTPFLQAMLDPILLSPW  174



>emb|CAJ65655.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   123 bits (308),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   103 bits (258),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   +   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKRLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLAAMLDPVLTKPWN  130



>emb|CAH05086.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   122 bits (305),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P   H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSTAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAH05079.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   122 bits (305),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY    P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CDP19839.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   118 bits (295),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S+WFQN D TPFYT HG +++ +A  EP LN  FNEAMASD RLV  +V K C+ VFEG
Sbjct  106  LSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSRVVTKDCKHVFEG  165

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFP LKCTV DLPHVV GLE
Sbjct  166  LNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLE  205


 Score =   108 bits (271),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 67/91 (74%), Gaps = 3/91 (3%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE---GYALAPP  172
            HKHG PMTL QL++ALPI NAK+  + RLM+ LIHSGFF+  K  G++++   GY L   
Sbjct  16   HKHGQPMTLDQLIDALPIKNAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSA  75

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            S LLLK NP S+ PFLLA+LDP LT PWH++
Sbjct  76   SELLLKSNPFSMTPFLLAILDPTLTDPWHHL  106



>emb|CAH05081.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAJ65644.1| putative orcinol O-methyltransferase [Rosa phoenicia]
Length=346

 Score =   121 bits (304),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY    P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65621.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   121 bits (304),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY    P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65622.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   121 bits (304),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY    P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65633.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   123 bits (308),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQ  231


 Score =   103 bits (257),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PL++ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLTLTPFLTAMLDPVLTKPWN  130



>emb|CAH05082.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   121 bits (304),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPCIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65665.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   122 bits (307),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   103 bits (257),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL +L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLFELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score =   129 bits (323),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HG + W+YAG EPK+N+ FNEAMASDARL  ++V+  C+ VFEG
Sbjct  137  LSTWFQNDDPTPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATSVVIHKCKDVFEG  196

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA AFP+L+CT FDLPHVV+GLE
Sbjct  197  LNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLE  236


 Score = 97.8 bits (242),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 62/90 (69%), Gaps = 5/90 (6%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFV-----ITKTQGSDDEGYALA  166
            +KHG PMTL +LV+AL IN +K+  + RLMR LIHSGFF       ++    +++GY L 
Sbjct  45   NKHGKPMTLNELVSALTINPSKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLT  104

Query  167  PPSILLLKDNPLSVRPFLLAVLDPILTKPW  256
              S LLLKDNPLSV PFL A+LDPIL  PW
Sbjct  105  NASKLLLKDNPLSVTPFLQAMLDPILLSPW  134



>emb|CAJ65601.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   121 bits (303),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFP+++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQ  231


 Score =   104 bits (260),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65598.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   121 bits (303),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFP+++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQ  231


 Score =   104 bits (260),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score =   123 bits (308),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +  WFQNDDPTPF T HG T WDY G +P L+H FNE MASDARLV ++++  C  VF+G
Sbjct  138  LGAWFQNDDPTPFDTAHGRTFWDYGGHDPMLSHFFNEGMASDARLVSSILIHKCEGVFQG  197

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGGIGT AK I+DAFPHL+CTVFDLP VV GL+
Sbjct  198  LNSMVDVGGGIGTVAKAISDAFPHLECTVFDLPRVVAGLQ  237


 Score =   102 bits (255),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSD-DEGYALAPPSI  178
              HG PMT+T+LV ALPIN  K++ + RLMR L+HSGFF   K   +D +EGY L   S 
Sbjct  50   QNHGKPMTVTELVAALPINATKASSIYRLMRILVHSGFFAQQKLGNNDQEEGYVLTHASR  109

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL  +PLSV PFL A+LDPILTKPWH
Sbjct  110  LLLNGDPLSVTPFLKAMLDPILTKPWH  136



>emb|CAJ65597.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   121 bits (303),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFP+++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQ  231


 Score =   104 bits (260),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65664.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   123 bits (308),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQ  231


 Score =   102 bits (255),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K    D+EGY L   S L
Sbjct  45   NKHGYPMTLSELSSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65639.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   120 bits (302),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMA DARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S  
Sbjct  45   NKHGCPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQP  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPWH
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWH  130



>emb|CAJ65626.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   120 bits (302),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HG T WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGTTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65618.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   120 bits (302),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFP+++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   125 bits (314),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T H    WDYAG EP+LN+ FNEAMASDARLV ++++K  + VFEG
Sbjct  133  LSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLKEGKGVFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQ  232


 Score =   100 bits (249),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF    + Q G ++EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RP LLA+LDPILTKPWH
Sbjct  105  LLLMDDSLSIRPLLLAMLDPILTKPWH  131



>emb|CAJ65613.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
 emb|CAJ65619.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   120 bits (302),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFP+++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65620.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   120 bits (302),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFP+++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAD29556.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   122 bits (307),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  133  LSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVIIDDCKGVFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  193  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQ  232


 Score =   102 bits (255),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K    D+EGY L   S L
Sbjct  46   NKHGYPMTLSELSSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQL  105

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  106  LLKDHPLSLTPFLTAMLDPVLTKPWN  131



>emb|CAJ65617.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   123 bits (309),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   102 bits (253),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAJ65599.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   123 bits (309),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   102 bits (253),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score =   123 bits (309),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  143  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCKGVFEG  202

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  203  LESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQ  242


 Score =   102 bits (253),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  56   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  115

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  116  LLKDHPLSLTPYLTAMLDPVLTNPWN  141



>emb|CAJ65614.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   123 bits (309),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   102 bits (253),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAH05084.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   123 bits (309),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   101 bits (252),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAJ65615.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   123 bits (309),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   101 bits (252),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAH05085.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   123 bits (309),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   101 bits (252),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAH05091.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   121 bits (304),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGM  WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMAFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   103 bits (256),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +K+G PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKYGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   125 bits (314),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T H    WDYAG EP+LN+ FNEAMASDARLV ++++K  + VFEG
Sbjct  133  LSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLKEGKGVFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQ  232


 Score = 99.4 bits (246),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF      Q G ++EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQSVQQGEEEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RP LLA+LDPILTKPWH
Sbjct  105  LLLMDDSLSIRPLLLAMLDPILTKPWH  131



>emb|CAJ65606.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   101 bits (252),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +AL I+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALLIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65610.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   123 bits (308),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   101 bits (251),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +AL I+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALLIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   124 bits (310),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T H    WDYAG EP+LN+ FNEAMASD+RLV+++++K  + +FEG
Sbjct  133  LSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLLKEGKGLFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQ  232


 Score =   100 bits (249),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMT  +LV  LP++  +S  + RLMR L+HSGF    + Q G  +EGY L   S 
Sbjct  45   HNHGKPMTFPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RPFLLA+LDP+LTKPWH
Sbjct  105  LLLMDDSLSIRPFLLAMLDPVLTKPWH  131



>ref|XP_004248183.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score =   131 bits (329),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +SEWF +D+PT F   HG T WDYAG EP+LNH FN+AMASDA+LVM++V+KY + VFEG
Sbjct  138  VSEWFTSDEPTAFEVAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMSVVMKYSKDVFEG  197

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA  FP+L+CTVFDLPHVV GLE
Sbjct  198  LNSIVDVGGGTGTVAKTIAKTFPNLQCTVFDLPHVVEGLE  237


 Score = 93.6 bits (231),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 5/93 (5%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFV-----ITKTQGSDDEGYALA  166
            HKHG PMTL +L NAL IN++K THL RLMR L+HSGFF+          GS + GY LA
Sbjct  46   HKHGKPMTLDELANALSINHSKITHLRRLMRILVHSGFFLKSVSGSGSESGSGEGGYVLA  105

Query  167  PPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            PP++LLLKD PL+V PFLLA+LDPIL KPWH++
Sbjct  106  PPALLLLKDEPLTVTPFLLAMLDPILVKPWHHV  138



>emb|CAH05090.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   123 bits (308),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   101 bits (251),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG  MTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYLMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65600.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   123 bits (309),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   100 bits (250),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKGKLCKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAJ65656.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   123 bits (308),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQ  231


 Score =   101 bits (251),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELSSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLK +PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKGHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65603.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   119 bits (298),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTSWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAF H++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFSHIECTVLDLPHVVADLQ  231


 Score =   104 bits (260),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGFPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   121 bits (304),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDD T F T HGM  W+YAG EPKLN+ FNEAMASDARLVM +++   + VFEG
Sbjct  132  LSTWFQNDDATAFTTAHGMGFWEYAGNEPKLNNFFNEAMASDARLVMRVLIDEYKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGL  557
            L S+VDVGGG GT AK IA AFP L C VFDLPHVV GL
Sbjct  192  LKSLVDVGGGTGTMAKAIAKAFPRLDCIVFDLPHVVAGL  230


 Score =   102 bits (255),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDD-EGYALAPPSI  178
            H HG P++L+ L+ ALPI+ AK+  + RLMR LIHSGFF   K + +D+ EGY L   S 
Sbjct  44   HSHGKPISLSLLIAALPIHPAKARCIPRLMRILIHSGFFAKAKLKENDEAEGYVLTKASK  103

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLLKDNP SV PFLLA+LD ILT+PWH
Sbjct  104  LLLKDNPFSVTPFLLAMLDRILTEPWH  130



>emb|CAJ65649.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   122 bits (306),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSIWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   102 bits (253),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L + LPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSTLPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP LTKPW+
Sbjct  105  LLKDHPLSLAPFLTAMLDPALTKPWN  130



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   121 bits (304),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T HG T+WDY   EP+ N+ FNEAMASDARLV +++VK C+  FEG
Sbjct  133  VSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLVKECKGAFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S VDVGGG GT AK I +AFPHL  TV DLPHVV  L+
Sbjct  193  LNSFVDVGGGTGTVAKTIVEAFPHLHSTVLDLPHVVADLQ  232


 Score =   102 bits (254),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGS-DDEGYALAPPSI  178
            H H  PMTL +LV  LP+   K+  + RLMR L+HSGFF + + Q S D+EGY LA  S 
Sbjct  45   HNHCQPMTLHELVAKLPVRPNKTLCVHRLMRILVHSGFFTMQRVQESADEEGYVLANASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+PLSV PFLLA+LDP LT+PWH +
Sbjct  105  LLLKDHPLSVTPFLLAMLDPDLTEPWHYV  133



>emb|CAH05080.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   122 bits (305),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY    P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIINDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   101 bits (252),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+ DP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMPDPVLTKPWN  130



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score =   124 bits (312),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T H  + WDYAG EP+LN++FNEAMASDARL+ ++++K  + VF G
Sbjct  133  LSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVFAG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQ  232


 Score = 99.0 bits (245),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF    + Q G ++EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RP +LA+LDPILTKPWH
Sbjct  105  LLLMDDSLSIRPLVLAMLDPILTKPWH  131



>emb|CAJ65629.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   123 bits (308),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   100 bits (249),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL +L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLFELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   121 bits (303),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T HG T+WDY   EP+ N+ FNEAMASDARLV ++++K C+  FEG
Sbjct  133  VSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLIKECKGAFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S VDVGGG GT AK I DAFPHL  TV DLPHVV  L+
Sbjct  193  LNSFVDVGGGTGTVAKTIVDAFPHLHSTVLDLPHVVADLQ  232


 Score =   102 bits (254),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGS-DDEGYALAPPSI  178
            H H  PMTL +LV  LP+   K+  + RLMR L+HSGFF + + Q S D+EGYALA  S 
Sbjct  45   HNHCQPMTLHELVAKLPVRPNKTLCVHRLMRILVHSGFFTMQRVQESADEEGYALANASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+PLS  PFLLA+LDP LT+PWH +
Sbjct  105  LLLKDHPLSATPFLLAMLDPDLTEPWHYV  133



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score =   124 bits (312),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T H  + WDYAG EP+LN++FNEAMASDARL+ ++++K  + VF G
Sbjct  133  LSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVFAG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQ  232


 Score = 99.0 bits (245),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF    + Q G ++EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RP +LA+LDPILTKPWH
Sbjct  105  LLLMDDSLSIRPLVLAMLDPILTKPWH  131



>gb|KDO39394.1| hypothetical protein CISIN_1g021867mg [Citrus sinensis]
Length=306

 Score =   126 bits (316),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T+HG + W YAG EPK+N+ FNEAMASDARL   +V+  C+ VFEG
Sbjct  137  LSTWFQNDDPTPFDTLHGKSFWVYAGDEPKINNFFNEAMASDARLATRVVIHKCKDVFEG  196

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGGIGT AK IA AFP+L+CT FDLPHVV+GLE
Sbjct  197  LNSLVDVGGGIGTVAKAIAKAFPNLECTDFDLPHVVNGLE  236


 Score = 97.4 bits (241),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 62/90 (69%), Gaps = 5/90 (6%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFV-----ITKTQGSDDEGYALA  166
            +KHG PMTL +LV+AL IN +K+  + RLMR LIHSGFF       ++    +++GY L 
Sbjct  45   NKHGKPMTLNELVSALTINPSKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLK  104

Query  167  PPSILLLKDNPLSVRPFLLAVLDPILTKPW  256
              S LLLKDNPLSV PFL A+LDPIL  PW
Sbjct  105  NASKLLLKDNPLSVTPFLQAMLDPILLSPW  134



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score =   120 bits (301),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            ++ WFQND+PTPF+ VHGMT WDY  ++P L H FN+AMASDA+L+ ++++  C+ VF+G
Sbjct  131  LTTWFQNDNPTPFHVVHGMTFWDYGNQDPTLAHFFNDAMASDAQLISSLMIDDCKGVFQG  190

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +DS+VDVGGG GT AK IADAFPH+KCTV DLPHVV  L+
Sbjct  191  VDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLK  230


 Score =   103 bits (256),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
             KHG PM L++LV+ALPI+  K+  + RLMR L+HSGFF      G  ++GY L   S L
Sbjct  44   QKHGQPMILSELVSALPISPTKAHFIPRLMRILVHSGFFARESLSGGGEQGYVLTDASAL  103

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKDNP+S RPFLLA+L+P+LT PW 
Sbjct  104  LLKDNPMSARPFLLAMLNPMLTDPWQ  129



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   115 bits (289),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S+WFQN D TPFYT HG +++ +A  EP LN  FNEAMASD RLV ++V K C+ VFE 
Sbjct  137  LSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSSVVTKDCKHVFES  196

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFP LKCTV DLPHVV GLE
Sbjct  197  LNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLE  236


 Score =   107 bits (267),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE---GYALAPP  172
            HKHG PMTL QL++ALPI NAK+  + RLM+ LIHSGFF+  K  G++++   GY L   
Sbjct  47   HKHGQPMTLDQLIDALPIKNAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSA  106

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            S LLLK NP S+ PFLLA+LDP LT PW N+
Sbjct  107  SELLLKSNPFSMTPFLLAMLDPTLTDPWQNL  137



>emb|CAH05088.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   123 bits (308),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   100 bits (249),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL +L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLFELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAJ65661.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   118 bits (296),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S  FQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTRFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   105 bits (261),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAEKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65631.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   123 bits (308),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   100 bits (248),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +K+G PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKYGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAJ65627.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   123 bits (308),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   100 bits (248),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +K+G PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKYGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAJ65605.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   122 bits (305),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C  VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCNGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   101 bits (251),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +AL I+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHGYPMTLSELTSALLIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LLKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CAJ65659.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   123 bits (308),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   100 bits (248),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +K+G PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKYGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAD29555.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   123 bits (309),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  133  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  193  LESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQ  232


 Score =   100 bits (248),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +K+G PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  46   NKYGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  105

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  106  LLKDHPLSLTPYLTAMLDPVLTNPWN  131



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   123 bits (308),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            ++ WFQND+PTPF+ VHGMT WDY  ++P + H FN+AMASDARL+ ++V+  C+ VF+G
Sbjct  130  LTTWFQNDNPTPFHMVHGMTFWDYGNQDPTIAHFFNDAMASDARLISSLVIDECKGVFQG  189

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +DS+VDVGGG GT AK IADAFPH+KCTV DLPHVV  L+
Sbjct  190  VDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLK  229


 Score = 99.8 bits (247),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
             KHG PMTL++LV+ALPI+  K+  + RLMR L+HS FF      G + +GY L   S L
Sbjct  44   QKHGQPMTLSELVSALPISPTKAHFIPRLMRILVHSSFFARESLSGGE-QGYVLTDASTL  102

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LL+DNP+S RPFLLAVL+PILT PW 
Sbjct  103  LLEDNPMSARPFLLAVLNPILTDPWQ  128



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   114 bits (286),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDD T F T HGM  W+Y   +P LN+ FNEAMASDARLVM +++   + +FEG
Sbjct  132  LSTWFQNDDATAFDTAHGMGFWEYTASDPNLNNFFNEAMASDARLVMKVLIDEHKGLFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVGGG GT A  IA AFP L+CTVFDLPHVV GL+
Sbjct  192  LKSLVDVGGGTGTMAAAIAKAFPQLECTVFDLPHVVVGLQ  231


 Score =   108 bits (269),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            H HG P++L+QL+ ALPI+ AK+  + RLMR LIHSGFF   K +  D+E GY L   S 
Sbjct  44   HSHGRPISLSQLIAALPIHPAKARGIPRLMRILIHSGFFAKAKIEEKDEEEGYVLTNASK  103

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLLKDNPLS+ PFLLA+LDPIL KPWH
Sbjct  104  LLLKDNPLSIAPFLLAMLDPILIKPWH  130



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   122 bits (305),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S W +NDDPTPF T HG T WDY G EP  NH FN+AMASDARLV  +++  C+ VFEG
Sbjct  134  VSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLINECKEVFEG  193

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVGGG GT A  IA AFPHL CTVFDLPHVV  L+
Sbjct  194  LGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQ  233


 Score =   100 bits (249),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSD-DEGYALAPPSI  178
            +KH  P+TL +L+ ALP++ +K+  + RLMR LIHSGFF   K    D +EGY L   S 
Sbjct  46   NKHSKPVTLPELIAALPVHPSKARCVPRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQ  105

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLLKDNP SV PFL AVLDPILTKPWH
Sbjct  106  LLLKDNPFSVAPFLQAVLDPILTKPWH  132



>emb|CAJ65634.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   122 bits (307),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQ  231


 Score = 99.8 bits (247),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K    D+EGY L   S L
Sbjct  45   NKHGYPMTLSELSSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            L KD+PLS+ PFL A+LDP+LTKPW+
Sbjct  105  LPKDHPLSLTPFLTAMLDPVLTKPWN  130



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   115 bits (287),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S+WFQN   +PFYT HG +L+D+A  E +LN  FNEAMASDAR+V ++V K C+ VFE 
Sbjct  137  LSQWFQNSYESPFYTCHGRSLYDFASHESQLNQFFNEAMASDARMVSSVVTKDCKHVFES  196

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFP LKCTV DLPHVV GLE
Sbjct  197  LNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLE  236


 Score =   107 bits (266),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 3/91 (3%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE---GYALAPP  172
            HKHG PMTL QL++ALPI N K+  + RLM+ LIHSGFF+  K  G++++   GY L   
Sbjct  47   HKHGRPMTLDQLIDALPIKNEKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSA  106

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            S LLLK NP SV PFLLA+LDP LT PWH++
Sbjct  107  SELLLKSNPFSVTPFLLAMLDPALTDPWHHL  137



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   122 bits (306),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S W +NDDPTPF T HG T WDY G EP  NH FN+AMASDARLV  +++  C+ VFEG
Sbjct  134  VSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLINECKEVFEG  193

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVGGG GT AK IA AFPHL CTVFDLPHVV  L+
Sbjct  194  LGSLVDVGGGTGTVAKSIAKAFPHLDCTVFDLPHVVADLQ  233


 Score = 99.8 bits (247),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSD-DEGYALAPPSI  178
            +KH  P+TL +L+ ALP++  K+  + RLMR LIHSGFF   K    D +EGY L   S 
Sbjct  46   NKHSKPVTLPELIAALPVHPGKARCVPRLMRLLIHSGFFEKQKVSEDDQEEGYILTNASQ  105

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLLKDNP SV PFL AVLDPILTKPWH
Sbjct  106  LLLKDNPFSVAPFLQAVLDPILTKPWH  132



>emb|CAJ65636.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   122 bits (305),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+ DVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLADVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score =   100 bits (248),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +K+G PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKYGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAN70493.1| hypothetical protein VITISV_002330 [Vitis vinifera]
Length=363

 Score =   121 bits (303),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T HG T+WDY   EP+ N+ FNEAMASDARLV ++++K C+  FEG
Sbjct  133  VSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLIKECKGAFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S VDVGGG GT AK I  AFPHL  TV DLPHVV  L+
Sbjct  193  LNSFVDVGGGTGTVAKTIVXAFPHLHSTVLDLPHVVADLQ  232


 Score =   100 bits (249),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGS-DDEGYALAPPSI  178
            H H  PMTL +LV  LP+   K+  + RLMR L+HSGFF + + Q S D+EGY LA  S 
Sbjct  45   HNHCQPMTLHELVAKLPVRPNKTLCVHRLMRILVHSGFFTMQRVQESADEEGYXLANASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+PLS  PFLLA+LDP LT+PWH +
Sbjct  105  LLLKDHPLSATPFLLAMLDPDLTEPWHYV  133



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   115 bits (289),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S+WFQN D TPFYT HG +++ +A  EP LN  FNEAMASD RLV ++V K C+ VFE 
Sbjct  137  LSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSSVVTKDCKHVFES  196

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFP LKCTV DLPHVV GLE
Sbjct  197  LNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLE  236


 Score =   105 bits (263),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 3/91 (3%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE---GYALAPP  172
            HKHG P+TL QL++ALPI NAK+  + RLM+ LIHSGFF+  K  G++++   GY L   
Sbjct  47   HKHGQPITLDQLIDALPIKNAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSA  106

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            S LLLK NP S+ PFLLA+LDP LT PWH++
Sbjct  107  SELLLKSNPFSMTPFLLAMLDPTLTDPWHHL  137



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score =   121 bits (303),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T H    WDYAG EP+LN+ FNEAMASD+RLV+++++K  + +FEG
Sbjct  133  LSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLLKEGKGLFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV D PHVV GL+
Sbjct  193  LNSLVDVGGGTGKVAKAIANAFPHLNCTVLDPPHVVAGLQ  232


 Score =   100 bits (249),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMT  +LV  LP++  +S  + RLMR L+HSGF    + Q G  +EGY L   S 
Sbjct  45   HNHGKPMTFPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RPFLLA+LDP+LTKPWH
Sbjct  105  LLLMDDSLSIRPFLLAMLDPVLTKPWH  131



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score =   122 bits (306),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T +    WDYAG EP+LN++FNEAMASDARL+ ++++K  + VF G
Sbjct  133  LSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLIKEGKGVFAG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQ  232


 Score = 99.4 bits (246),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF    + Q G ++EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RP +LA+LDPILTKPWH
Sbjct  105  LLLMDDSLSIRPLVLAMLDPILTKPWH  131



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   122 bits (306),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T +  + WDYAG EP+LN++FNEAMASDARL+ ++++K  + VF G
Sbjct  133  LSAWFQNDDPTPFHTTYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVFAG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQ  232


 Score = 99.0 bits (245),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF    + Q G ++EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RP +LA+LDPILTKPWH
Sbjct  105  LLLMDDSLSIRPLVLAMLDPILTKPWH  131



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   121 bits (304),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T +    WDYAG EP+LN++FNEAMASDARL+ ++++K  + VF G
Sbjct  133  LSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGKGVFAG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DLPHVV GL+
Sbjct  193  LNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQ  232


 Score = 99.4 bits (246),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF    + Q G ++EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RP +LA+LDPILTKPWH
Sbjct  105  LLLMDDSLSIRPLVLAMLDPILTKPWH  131



>ref|XP_008245137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   120 bits (300),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            ++ WFQND+PTPF+  HGMT WDY  ++  L H FNEAMASDARL+ ++++  C+ VF+G
Sbjct  130  LTTWFQNDNPTPFHVAHGMTFWDYGNQDTTLAHFFNEAMASDARLISSLMIDDCKGVFQG  189

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +DS+VDVGGG GT AK IA AFPH+KCTV DLPHVV  L+
Sbjct  190  VDSLVDVGGGTGTVAKSIAAAFPHMKCTVLDLPHVVADLK  229


 Score =   100 bits (250),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
             KHG PMTL++LV+ALPI+  K+  + RL+R L+HSGFF      G + +GY L   S L
Sbjct  44   QKHGQPMTLSELVSALPISPTKAHFIPRLIRILVHSGFFASESLNGGE-QGYVLTDASAL  102

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKDNP+S RPFLLA+L+PILT PW 
Sbjct  103  LLKDNPMSARPFLLAMLNPILTDPWQ  128



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   122 bits (305),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S W +NDDPTPF T HG T WDY G EP  NH FN+AMASDARLV  +++  C+ VFEG
Sbjct  134  VSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLINECKEVFEG  193

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVGGG GT A  IA AFPHL CTVFDLPHVV  L+
Sbjct  194  LGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQ  233


 Score = 99.0 bits (245),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSD-DEGYALAPPSI  178
            +KH  P+TL +L+  LP++ +K+  + RLMR LIHSGFF   K    D +EGY L   S 
Sbjct  46   NKHSKPVTLPELIATLPVHPSKARCVPRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQ  105

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLLKDNP SV PFL AVLDPILTKPWH
Sbjct  106  LLLKDNPFSVAPFLQAVLDPILTKPWH  132



>gb|AAB71213.1| methyltransferase [Prunus armeniaca]
Length=354

 Score =   118 bits (296),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            ++ WFQND+PTPF+ V+GMT WDY  ++P L H FN+AMASDA+L+ ++V+  C+ VF+G
Sbjct  130  LTTWFQNDNPTPFHVVNGMTCWDYVNQDPTLAHFFNDAMASDAQLISSLVIDDCKEVFQG  189

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +DS+VDVGGG GT AK IADAFPH+KCTV DLPHVV  L+
Sbjct  190  VDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLK  229


 Score =   102 bits (254),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
             KHG PMTL++LV+ALPI+  K+  + RLMR L+HSGFF      G  ++GY L   S L
Sbjct  43   QKHGQPMTLSELVSALPISPTKAHFIPRLMRILVHSGFFAKESLSGCGEQGYILTDASAL  102

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKDNP+S RPFLLA+L PILT P+ 
Sbjct  103  LLKDNPMSARPFLLAMLSPILTDPYQ  128



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score =   121 bits (304),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQN+DPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  142  LSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  201

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  202  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  241


 Score = 99.4 bits (246),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  56   NKHG-PMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  114

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LT PW+
Sbjct  115  LLKDHPLSLTPFLTAMLDPVLTTPWN  140



>emb|CAJ65662.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   122 bits (307),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score = 97.8 bits (242),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +K+G PMTL++L +ALPI+  KS  + RLMR L+HS FF   K   +D+EGY L   S L
Sbjct  45   NKYGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAJ65666.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   123 bits (308),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  132  LSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  192  LESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQ  231


 Score = 97.4 bits (241),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +K+G PMTL++L +ALPI+  KS  + RLMR L+HS FF   K   +D+EGY L   S L
Sbjct  45   NKYGYPMTLSELTSALPIHPTKSHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  105  LLKDHPLSLTPYLTAMLDPVLTNPWN  130



>emb|CAJ65657.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   121 bits (303),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQN+DPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  131  LSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  190

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADAFPH++CTV DLPHVV  L+
Sbjct  191  LESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQ  230


 Score = 99.0 bits (245),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHG-PMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  103

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LT PW+
Sbjct  104  LLKDHPLSLTPFLTAMLDPVLTTPWN  129



>ref|XP_006387382.1| hypothetical protein POPTR_1124s00200g, partial [Populus trichocarpa]
 gb|ERP46296.1| hypothetical protein POPTR_1124s00200g, partial [Populus trichocarpa]
Length=227

 Score =   114 bits (285),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQND P+ FYT H  T W+YAG E +LNH FNEAMASDARLV +++V  C+ VFEG
Sbjct  134  VSVWFQNDAPSSFYTAHQRTCWEYAGHETELNHFFNEAMASDARLVSSVLVNECKGVFEG  193

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPH  542
            L+S+VDVGGG GT AK IA  F HL CTVFDLPH
Sbjct  194  LNSLVDVGGGTGTVAKAIAKEFQHLDCTVFDLPH  227


 Score =   105 bits (262),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQG-SDDEGYALAPPSI  178
            H HG PMTL++LV  LPI+ +K+  + RLMR L+HSGFF      G ++ EGY L   S 
Sbjct  46   HNHGKPMTLSELVAVLPIHPSKAPGIYRLMRILVHSGFFATQNNSGETEGEGYVLTNASQ  105

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL+KDNP SV PFLLA+LDPILT+PWH +
Sbjct  106  LLIKDNPFSVTPFLLAMLDPILTQPWHYV  134



>emb|CAJ65616.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=345

 Score =   120 bits (301),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  131  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCKGVFEG  190

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S++DVGGGIGT AK IADAFPH++CTV DLP+VV  L+
Sbjct  191  LESLIDVGGGIGTVAKAIADAFPHIECTVLDLPYVVADLQ  230


 Score = 99.0 bits (245),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHG-PMTLSELTSALPIHPTKSPSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  103

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LT PW+
Sbjct  104  LLKDHPLSLMPFLTAMLDPVLTTPWN  129



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score =   113 bits (282),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPT F TV+G+  W Y G+EPK+ + FN+AMASDARLV+++V++ C+ VF+ 
Sbjct  148  LSTWFQNDDPTAFDTVNGLPFWKYGGQEPKMANFFNDAMASDARLVISVVIENCKWVFDE  207

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S VDVGGG GT AK IA  FP ++CTVFDLPHVV  L+
Sbjct  208  LESFVDVGGGTGTVAKAIAATFPKMECTVFDLPHVVGDLQ  247


 Score =   106 bits (264),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFF---VITKTQGSDDEGYALAPP  172
            HKHG PMTL++L+ ALP++  K+ ++ RLMR L+HSGFF    I ++   ++EGY L   
Sbjct  58   HKHGKPMTLSKLIGALPVHQNKAPYVYRLMRILVHSGFFSLQTIGESDHQEEEGYVLTDA  117

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPW  256
            S LL+ DNPLSV PFLLA+LDP+LTKPW
Sbjct  118  SKLLVGDNPLSVAPFLLAMLDPVLTKPW  145



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score =   124 bits (310),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQ+DDP PF T HG + W+YAG EPK+N+ FNEAMASDARL   +V+  C+ VF+G
Sbjct  137  LSTWFQSDDPAPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATRVVIHKCKDVFQG  196

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA AFP+L+CT FDLPHVV+GLE
Sbjct  197  LNSLVDVGGGTGTVAKAIAIAFPNLECTDFDLPHVVNGLE  236


 Score = 95.5 bits (236),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 62/90 (69%), Gaps = 5/90 (6%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFV-----ITKTQGSDDEGYALA  166
            +KHG PMTL +LV+AL IN +K+  + RLMR LIHSGFF       ++    +++GY L 
Sbjct  45   NKHGKPMTLNKLVSALTINPSKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLT  104

Query  167  PPSILLLKDNPLSVRPFLLAVLDPILTKPW  256
              S LLLKD+PLSV PFL A+LDPIL  PW
Sbjct  105  NASKLLLKDSPLSVTPFLQAMLDPILLSPW  134



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score =   119 bits (299),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T +  + WDYAG EP+LN++FNEAMASDARL+ ++++K  + VF G
Sbjct  133  LSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVFAG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DL HVV GL+
Sbjct  193  LNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQ  232


 Score = 99.4 bits (246),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF    + Q G ++EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RP +LA+LDPILTKPWH
Sbjct  105  LLLMDDSLSIRPLVLAMLDPILTKPWH  131



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   119 bits (299),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T +  + WDYAG EP+LN++FNEAMASDARL+ ++++K  + VF G
Sbjct  133  LSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVFAG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DL HVV GL+
Sbjct  193  LNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQ  232


 Score = 99.4 bits (246),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF    + Q G ++EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RP +LA+LDPILTKPWH
Sbjct  105  LLLMDDSLSIRPLVLAMLDPILTKPWH  131



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   119 bits (299),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T +  + WDYAG EP+LN++FNEAMASDARL+ ++++K  + VF G
Sbjct  133  LSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVFAG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DL HVV GL+
Sbjct  193  LNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQ  232


 Score = 99.4 bits (246),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF    + Q G ++EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RP +LA+LDPILTKPWH
Sbjct  105  LLLMDDSLSIRPLVLAMLDPILTKPWH  131



>emb|CAJ65660.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   119 bits (299),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQN+DPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  131  LSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCKGVFEG  190

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IADA PH++CTV DLPHVV  L+
Sbjct  191  LESLVDVGGGTGTVAKAIADALPHIECTVLDLPHVVADLQ  230


 Score = 99.0 bits (245),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHG-PMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  103

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ PFL A+LDP+LT PW+
Sbjct  104  LLKDHPLSLTPFLTAMLDPVLTTPWN  129



>emb|CAJ65596.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=345

 Score =   120 bits (300),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T HGMT WDY   +P + H FN+AMASDARLV ++++  C+ VFEG
Sbjct  131  LSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCKGVFEG  190

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+ DVGGG GT AK IADAFP+++CTV DLPHVV  L+
Sbjct  191  LESLADVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQ  230


 Score = 98.2 bits (243),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            +KHG PMTL++L +ALPI+  KS  + RLMR L+HSGFF   K   +D+EGY L   S L
Sbjct  45   NKHG-PMTLSELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQL  103

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS+ P+L A+LDP+LT PW+
Sbjct  104  LLKDHPLSLTPYLTAMLDPVLTNPWN  129



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score =   121 bits (303),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQN DPTPF T +GM  WDY   EPKL   FN+AMASDARLV ++V++ C+ VFEG
Sbjct  151  LSNWFQNGDPTPFDTANGMAFWDYGSHEPKLARFFNDAMASDARLVTSVVIEKCKGVFEG  210

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            ++S+VDVGGG GT A  IA AFPH++CTVFDLPHVV  L+
Sbjct  211  VESLVDVGGGTGTVASSIAAAFPHIQCTVFDLPHVVADLQ  250


 Score = 96.3 bits (238),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 5/90 (6%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-----GSDDEGYALA  166
            + HG PMT++QL  ALPIN  KS  + RLMR LIHSGFF + K +     G ++EGY + 
Sbjct  59   NNHGKPMTISQLTLALPINRKKSPCVYRLMRILIHSGFFALQKAEVGEEGGGEEEGYVIT  118

Query  167  PPSILLLKDNPLSVRPFLLAVLDPILTKPW  256
              S LLLKDNP+SV PFLLA+LDP++TKPW
Sbjct  119  DASKLLLKDNPMSVTPFLLAMLDPVMTKPW  148



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score =   117 bits (292),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T +    WDYAG EP+LN++FNEAMASDARL+  +++K    VF G
Sbjct  133  LSAWFQNDDPTPFHTAYEXXFWDYAGHEPQLNNSFNEAMASDARLLTXVLLKEGXGVFAG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA AFPHL CTV DL HVV GL+
Sbjct  193  LNSLVDVGGGTGKVAKAIAXAFPHLNCTVLDLSHVVAGLQ  232


 Score = 99.8 bits (247),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF    + Q G ++EGY L   S 
Sbjct  45   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLL D+ LS+RP +LA+LDPILTKPWH
Sbjct  105  LLLMDDSLSIRPLVLAMLDPILTKPWH  131



>gb|KDP24059.1| hypothetical protein JCGZ_25716 [Jatropha curcas]
Length=243

 Score =   118 bits (296),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WF  DD TPF+  HG  LW+ AG+ PKLN+ FNEAMASDARLVM++++K C+ VF+G
Sbjct  135  LSTWFLKDDRTPFHIFHGNELWESAGQHPKLNNFFNEAMASDARLVMSIMIKECKEVFDG  194

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVGGG GT AK +A+AFPHL C VFDLPHVV GL+
Sbjct  195  LKSLVDVGGGTGTVAKTLANAFPHLDCFVFDLPHVVAGLQ  234


 Score = 97.8 bits (242),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ--GSDDEGYALAPPS  175
            +KHG  MTL+ L+NAL I+  K+  + RLMR L+HSGFF + K +  G + EGY L   S
Sbjct  46   NKHGKLMTLSDLINALSIHPTKAHCIPRLMRILVHSGFFAVAKIEENGREIEGYVLTNAS  105

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPWH  259
             LL+K+NPLSV PFLLA+LDP LT PWH
Sbjct  106  KLLVKENPLSVTPFLLAMLDPALTGPWH  133



>ref|XP_010097399.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67905.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   116 bits (291),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  258  TISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            ++S W Q+DDPTPF   HGM +WDY   +P+L + FNEAMASDARLV ++++  C+ V E
Sbjct  145  SLSTWLQSDDPTPFAATHGMGIWDYNEYDPRLGNLFNEAMASDARLVTSVLIDKCKSVLE  204

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL+S+VD+ GG GT AK IA AFPHL CTVFDLPHV+  L+
Sbjct  205  GLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQ  245


 Score = 99.8 bits (247),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 68/95 (72%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTH---LARLMRTLIHSGFFVITKTQGSD----DEGYA  160
            H HG PMTL+QL++ALPI+  K +    + RLMR L++SGFFV+ +    +    +EGY 
Sbjct  52   HSHGKPMTLSQLISALPIHQNKKSDSRLIYRLMRILVNSGFFVLQEVVVGETDLLEEGYV  111

Query  161  LAPPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            L   S LLL+DNPLSV P LL++LDPI+TKPWH++
Sbjct  112  LTTASKLLLRDNPLSVTPLLLSMLDPIMTKPWHSL  146



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   124 bits (312),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQ+DDP PF  VHG + W+YAG EPK+N+ FNEAMASDARL   +V+  C+ VFEG
Sbjct  137  LSTWFQSDDPAPFDMVHGKSFWEYAGDEPKINNFFNEAMASDARLATRVVIHKCKNVFEG  196

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGG  GT AK IA AFP+L+CT FDLPHVV+GLE
Sbjct  197  LNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLE  236


 Score = 90.9 bits (224),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 59/90 (66%), Gaps = 5/90 (6%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFV-----ITKTQGSDDEGYALA  166
            +KHG P TL  LV+AL IN +K+  + RLMR LIHSGFF       ++    +++GY L 
Sbjct  45   NKHGKPTTLNDLVSALTINPSKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLT  104

Query  167  PPSILLLKDNPLSVRPFLLAVLDPILTKPW  256
              S LLLKD+PLSV P L AVLDPIL  PW
Sbjct  105  NASKLLLKDSPLSVTPLLQAVLDPILLSPW  134



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   119 bits (297),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +3

Query  258  TISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +IS W Q+DDPTPF T HG   WDY   +P+L + FNEAMASDARLV ++V++ C+ +FE
Sbjct  145  SISTWLQSDDPTPFATTHGKEFWDYNEYDPRLGNLFNEAMASDARLVTSVVIEKCKSMFE  204

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL+S+VD+ GG GT AK IA AFPHL CTVFDLPHV+  L+
Sbjct  205  GLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQ  245


 Score = 96.7 bits (239),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 67/95 (71%), Gaps = 7/95 (7%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAK---STHLARLMRTLIHSGFFVITKTQGSD----DEGYA  160
            + HG PM L+QL+++LPI+  K   S  + RLMR L++SGFF + +    +    +EGY 
Sbjct  52   YSHGKPMILSQLISSLPIHQNKRPDSRLIYRLMRILVNSGFFALEEVVVGETNLLEEGYV  111

Query  161  LAPPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            L   S LLL+DNPLSV PFLL++LDPI+TKPWH+I
Sbjct  112  LTNASKLLLRDNPLSVTPFLLSMLDPIMTKPWHSI  146



>gb|KDO40717.1| hypothetical protein CISIN_1g037127mg, partial [Citrus sinensis]
Length=307

 Score =   124 bits (311),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQ+DDP PF  VHG + W+YAG EPK+N+ FNEAMASDARL   +V+  C+ VFEG
Sbjct  137  LSTWFQSDDPAPFDMVHGKSFWEYAGDEPKINNFFNEAMASDARLATRVVIHKCKNVFEG  196

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGG  GT AK IA AFP+L+CT FDLPHVV+GLE
Sbjct  197  LNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLE  236


 Score = 90.9 bits (224),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 59/90 (66%), Gaps = 5/90 (6%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFV-----ITKTQGSDDEGYALA  166
            +KHG P TL  LV+AL IN +K+  + RLMR LIHSGFF       ++    +++GY L 
Sbjct  45   NKHGKPTTLNDLVSALTINPSKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLT  104

Query  167  PPSILLLKDNPLSVRPFLLAVLDPILTKPW  256
              S LLLKD+PLSV P L AVLDPIL  PW
Sbjct  105  NASKLLLKDSPLSVTPLLQAVLDPILLSPW  134



>ref|XP_011100228.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=367

 Score =   110 bits (276),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = +3

Query  261  ISEWFQND-DPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +SEWF+ D D TPF T HG TLW+YAG++P+LN  FNE MASD++LV  ++ K CR VFE
Sbjct  143  VSEWFKTDGDLTPFLTTHGRTLWEYAGQDPRLNGLFNEGMASDSKLVATVITKDCRNVFE  202

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL S+VDVGGG GT AK +ADAF  L C V DLPHVV G E
Sbjct  203  GLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAGCE  243


 Score =   103 bits (257),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = +2

Query  5    KHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPSIL  181
            KHG PMTL++L ++L +N AKS  L RLMR +IHS FF+  K +   + EGY L P S L
Sbjct  48   KHGKPMTLSELTHSLHLNEAKSPSLERLMRIMIHSKFFINVKISHVEETEGYWLTPASHL  107

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL+D PLSVRPF L++LDPILT PWH++
Sbjct  108  LLRDEPLSVRPFALSMLDPILTDPWHHV  135



>ref|XP_011100233.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   108 bits (269),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = +3

Query  261  ISEWFQND-DPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +SEWF+ D D TPF T HG TLW++AG++P+LN  FNE MASD+ LV  ++ K CR VFE
Sbjct  135  LSEWFKTDGDLTPFLTTHGRTLWEHAGQDPRLNELFNEGMASDSELVATVITKDCRNVFE  194

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL S+VDVGGG GT AK IADAF  L C V DLPHVV G E
Sbjct  195  GLKSMVDVGGGTGTVAKAIADAFTGLNCVVLDLPHVVAGCE  235


 Score =   105 bits (262),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +2

Query  5    KHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPSIL  181
            KHG PMTL++L ++L +N+AKS  L RLMR +IHS FF+  K +Q  + EGY L P S L
Sbjct  48   KHGKPMTLSELTHSLHLNDAKSPSLERLMRIMIHSKFFINVKISQVEESEGYWLTPASHL  107

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL+D PLSVRPF L +LDPILT PWH++
Sbjct  108  LLRDEPLSVRPFALGMLDPILTDPWHHL  135



>ref|XP_010657144.1| PREDICTED: uncharacterized protein LOC100854832 [Vitis vinifera]
Length=731

 Score =   107 bits (266),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 51/89 (57%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            H HG PMTL QLV  LP++  K+ ++ RLMR L+ S FF   + Q S++E GY L   S 
Sbjct  452  HNHGKPMTLPQLVAKLPVHPKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASR  511

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+ LSVRPFLLA+LDP LTKPWH +
Sbjct  512  LLLKDDSLSVRPFLLAMLDPTLTKPWHYV  540


 Score =   105 bits (263),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T H  TLWDYAG EP+LN+ FNEAMASDARLV +++VK  + VFEG
Sbjct  540  VSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLVKEGKGVFEG  599

Query  441  LDSVVDV  461
            L+S+VDV
Sbjct  600  LNSLVDV  606



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score =   107 bits (266),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WFQNDDPT   T HG T WD+   EP L+H FN+AMASDARL+  +V    + VFEGL
Sbjct  134  STWFQNDDPTACVTAHGTTFWDFGCLEPSLSHIFNDAMASDARLISKVVSNEYKGVFEGL  193

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGGIGT  K IAD FPH++C VFDLPHVV  L+
Sbjct  194  ESLVDVGGGIGTMPKAIADVFPHVECIVFDLPHVVADLK  232


 Score =   105 bits (261),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  5    KHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPSIL  181
            KHG PM+L+ L++ALPI+  KS  + RLMR L+HSGFF   K ++  ++EGY L   S L
Sbjct  46   KHGNPMSLSDLISALPIHPKKSNCVYRLMRILVHSGFFCRQKLSELDEEEGYVLTDASRL  105

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLKD+PLS RPFLL  LDP +TKPWH
Sbjct  106  LLKDDPLSARPFLLGALDPFMTKPWH  131



>gb|KJB73404.1| hypothetical protein B456_011G231800 [Gossypium raimondii]
Length=365

 Score =   113 bits (283),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +  WF+N+D TPF T HG T WDYAG + KLN  FNE MASDARLV ++++  C+ VFEG
Sbjct  136  LGTWFKNNDHTPFDTTHGKTFWDYAGHDQKLNSLFNEGMASDARLVNSILIDKCKKVFEG  195

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT +K I DAFPHL+C V DLPHVV  L+
Sbjct  196  LNSLVDVGGGTGTLSKAIVDAFPHLECIVLDLPHVVANLQ  235


 Score = 97.8 bits (242),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPS  175
              HG PMT+T+LV ALP +N  K+ ++ RLMR L+HSGFF        + ++GY L   S
Sbjct  47   QNHGKPMTITELVAALPMLNPTKACNIYRLMRILVHSGFFAQRNLCNDAQEDGYVLTNAS  106

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPWH  259
             LLLKDNPLSV PFL A+LDPILT+PWH
Sbjct  107  RLLLKDNPLSVTPFLKAMLDPILTEPWH  134



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score =   122 bits (305),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  WFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGLDS  449
            WF+NDDP+PF T HGM +WDYA +EP+LN  FN+AMASD +LV N+V++ C+ VF GL+S
Sbjct  136  WFKNDDPSPFQTAHGMKIWDYADREPRLNDLFNDAMASDTQLVANVVIERCKGVFNGLES  195

Query  450  VVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +VDVGGG GT A  IA +FP L+CTVFDLPHVV  L+
Sbjct  196  LVDVGGGTGTMAMAIAKSFPQLECTVFDLPHVVATLQ  232


 Score = 87.4 bits (215),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            HK+G PM L++L  +L I+ +K+  + RLMR L HSGFF   K   ++ E GY L   S 
Sbjct  45   HKYGQPMPLSKLTTSLSIHPSKANCIYRLMRILTHSGFFSQHKVNENELEMGYVLTDAST  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LLLKDNPLS+ PFL A+LDP LT+PW
Sbjct  105  LLLKDNPLSMVPFLHAMLDPTLTQPW  130



>gb|KHN07780.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=323

 Score =   122 bits (305),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  WFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGLDS  449
            WF+NDDP+PF T HGM +WDYA +EP+LN  FN+AMASD +LV N+V++ C+ VF GL+S
Sbjct  107  WFKNDDPSPFQTAHGMKIWDYADREPRLNDLFNDAMASDTQLVANVVIERCKGVFNGLES  166

Query  450  VVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +VDVGGG GT A  IA +FP L+CTVFDLPHVV  L+
Sbjct  167  LVDVGGGTGTMAMAIAKSFPQLECTVFDLPHVVATLQ  203


 Score = 87.4 bits (215),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            HK+G PM L++L  +L I+ +K+  + RLMR L HSGFF   K   ++ E GY L   S 
Sbjct  16   HKYGQPMPLSKLTTSLSIHPSKANCIYRLMRILTHSGFFSQHKVNENELEMGYVLTDAST  75

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LLLKDNPLS+ PFL A+LDP LT+PW
Sbjct  76   LLLKDNPLSMVPFLHAMLDPTLTQPW  101



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score =   125 bits (314),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WF+N DPTPF T HGM LWDYAG +PKLNH FN+AMASDAR V ++V++ C+ VF GL
Sbjct  106  STWFKNGDPTPFETAHGMMLWDYAGADPKLNHLFNDAMASDARFVTSLVIEKCKGVFMGL  165

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGG GT AK IA +FP ++C VFDLPHVV GL+
Sbjct  166  ESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLK  204


 Score = 83.2 bits (204),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 60/93 (65%), Gaps = 8/93 (9%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEG-----YALA  166
            H +G PM L+ L+ +LPI+ +K+  + RLMR +IHSGFF     Q  D E      Y L 
Sbjct  16   HNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMIHSGFF---SQQNHDLENELEAKYVLT  72

Query  167  PPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
              S+LLLK++P+SV PFL A+LDP+LT PW+  
Sbjct  73   DASVLLLKNHPMSVTPFLHAMLDPVLTNPWNQF  105



>emb|CDP17644.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   119 bits (297),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S+WFQ+++ TPF++ HG ++W+ AG++P+LN  FNE MASDARLV  MV+K C+ VF GL
Sbjct  118  SQWFQDNEETPFHSCHGTSMWELAGRQPRLNQFFNEGMASDARLVCTMVIKNCKDVFMGL  177

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S++DVGGG GT AK IADAFPHLKC+V DLPHVV G E
Sbjct  178  NSLIDVGGGTGTVAKAIADAFPHLKCSVLDLPHVVDGSE  216


 Score = 89.4 bits (220),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 57/88 (65%), Gaps = 16/88 (18%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            HKHG PM L QL++ALPINNAK+  + RLMR LIHSGFF+  K +  D+EG+        
Sbjct  46   HKHGQPMALAQLIDALPINNAKAHFVYRLMRILIHSGFFI--KAKMPDNEGHE-------  96

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
                    V PFLLA+LDPILT PWH+ 
Sbjct  97   -------GVTPFLLAMLDPILTDPWHHF  117



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   115 bits (289),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            + +WFQN+DPTPF+T H  + WDYA  EPKLN  FNE M SD+RL+ NM+V+  + VFEG
Sbjct  135  LGDWFQNEDPTPFHTAHRKSFWDYAVHEPKLNDIFNETMVSDSRLIANMIVRQYKEVFEG  194

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVGGG GT  K IA AFP LKC VFD PHVV  LE
Sbjct  195  LASLVDVGGGTGTMVKAIAKAFPQLKCIVFDQPHVVANLE  234


 Score = 92.0 bits (227),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKT--QGSDDEGYALAPPS  175
            H HG PM L+QL+ AL +   K+  L RLMR L+HSGFF   K      ++EGY+L   S
Sbjct  46   HSHGQPMALSQLITALSLEPTKAPCLYRLMRVLVHSGFFAQQKLLHNSEEEEGYSLTFAS  105

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPWH  259
              LLKD P+S  PFLL  LDPILT PWH
Sbjct  106  QFLLKDEPVSGVPFLLLQLDPILTAPWH  133



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score =   112 bits (279),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  258  TISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +IS W Q+DDPTPF T HGM  WDY  ++P+  + FNEAMASDARLV++++      VFE
Sbjct  143  SISTWLQSDDPTPFATTHGMEFWDYTVRDPRFGNVFNEAMASDARLVVSVLFDKRISVFE  202

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL+S+VD+ GG GT  K IADAFPH++CTVFDLPHV+  L+
Sbjct  203  GLESLVDLAGGTGTVGKAIADAFPHVECTVFDLPHVIADLQ  243


 Score = 95.5 bits (236),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 65/94 (69%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAK--STHL-ARLMRTLIHSGFFVITKTQGSDDE---GYAL  163
            H HG PMTL+QL++ALPI+  K   +HL  RLMR L++S FF + +  G  D+   GY L
Sbjct  51   HSHGKPMTLSQLISALPIHQNKKLDSHLIYRLMRILVNSSFFSLQEVVGETDQLEDGYVL  110

Query  164  APPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
               S LL++DNP S+ P LL VLDPI+TKPWH+I
Sbjct  111  TNSSKLLVRDNPFSLTPILLTVLDPIMTKPWHSI  144



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score =   122 bits (307),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WF+N DPTPF T HGM LWDYAG +PKLN+ FN+AMASDAR V ++V++ C+ VF GL
Sbjct  135  STWFKNGDPTPFETAHGMMLWDYAGADPKLNNLFNDAMASDARFVTSLVIEKCKGVFMGL  194

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGG GT AK IA +FP ++C VFDLPHVV GL+
Sbjct  195  ESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLK  233


 Score = 84.3 bits (207),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK--TQGSDDEGYALAPPS  175
            H +G PM L+ L+ +LPI+ +K+  + RLMR +IHSGFF   K   +   +  Y L   S
Sbjct  45   HNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMIHSGFFSQQKHDLENELEAKYVLTDAS  104

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            +LLLK++P+SV PFL A+LDP+LT PW+  
Sbjct  105  VLLLKNHPMSVTPFLHAMLDPVLTNPWNQF  134



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score =   121 bits (303),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WF+N DPTPF T HG   WDYAG +PKLNH FN+AMASDAR V ++V++ C+ VF GL
Sbjct  135  STWFKNGDPTPFETAHGKMFWDYAGADPKLNHLFNDAMASDARFVTSLVIEKCKGVFMGL  194

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGG GT AK IA +FP ++C VFDLPHVV GL+
Sbjct  195  ESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLK  233


 Score = 83.6 bits (205),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK--TQGSDDEGYALAPPS  175
            H +G PM L+ L+ +LPI+ +K+  + RLMR +IHSGFF +     +   +  Y L   S
Sbjct  45   HNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMIHSGFFSLQNHDLENELEAKYVLTDAS  104

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            +LLLK++P+SV PFL A+LDP+LT PW+  
Sbjct  105  VLLLKNHPMSVTPFLHAMLDPVLTNPWNQF  134



>ref|XP_004490696.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=359

 Score =   119 bits (298),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S W  NDDPT F T HGM  WDYA +E K+N+ FN+AMASDARLV ++V++ C+ VF G
Sbjct  134  LSSWLTNDDPTAFETTHGMLFWDYAERESKINNLFNDAMASDARLVSSVVIEKCKEVFNG  193

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK +A +FP L+CTVFDLPHVV GL+
Sbjct  194  LESLVDVGGGTGTMAKALAKSFPQLECTVFDLPHVVVGLQ  233


 Score = 84.0 bits (206),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 63/91 (69%), Gaps = 5/91 (5%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE---GYALAPP  172
            H +G PM+L++L+  LPI+ +K+  + RLMR + HSGFF  ++   S++E    Y L   
Sbjct  46   HNYGKPMSLSKLIPLLPIHPSKTFFIYRLMRIMTHSGFF--SQHNISENELETEYVLTDT  103

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            S+LLLKDNP+++R F+  V DP+LTKPWH +
Sbjct  104  SLLLLKDNPMNMRSFVHLVFDPVLTKPWHQL  134



>gb|KJB72587.1| hypothetical protein B456_011G186600 [Gossypium raimondii]
Length=360

 Score =   114 bits (284),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +  WFQNDD TPF T HG  LWDY  ++P+L+  FNE+ A D+RLV + +V  C+ VFEG
Sbjct  134  LGAWFQNDDRTPFETAHGKILWDYCSQDPQLSDLFNESQACDSRLVTSFLVDKCKGVFEG  193

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGGIG   K IAD FPHL+CTVFDLPHVV GL+
Sbjct  194  LNSLVDVGGGIGIVGKAIADVFPHLECTVFDLPHVVAGLQ  233


 Score = 89.0 bits (219),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITKTQG-SDDEGYALAPPS  175
              HG PMT+T+LV+A P +N+ K+ ++ RLMR L HSGFF   K  G +  EGY L   S
Sbjct  45   QNHGKPMTITELVDAQPMLNSTKACNIYRLMRILAHSGFFAHQKLDGDAQKEGYVLTNSS  104

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPWH  259
             LLLK+N LS+ P L A +DPI TKPW+
Sbjct  105  RLLLKNNTLSITPTLKAAIDPIFTKPWN  132



>gb|KDP24062.1| hypothetical protein JCGZ_25719 [Jatropha curcas]
Length=358

 Score =   103 bits (256),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 2/86 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            H HG PMTL+ LV+AL I  +KS H+ RLM+ L+ SGFF + K   SD+ GY L   S+L
Sbjct  45   HSHGQPMTLSDLVSALKIPQSKSHHIHRLMQVLVQSGFFSLQKV--SDENGYLLTQSSLL  102

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWH  259
            L+K++P++ RP++LAVLDPILTKPWH
Sbjct  103  LVKEHPVTARPYVLAVLDPILTKPWH  128


 Score = 99.4 bits (246),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 67/103 (65%), Gaps = 3/103 (3%)
 Frame = +3

Query  261  ISEWFQNDD---PTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVV  431
            +S WFQN D    TPF   H    WD A  E + N  FNEAMASD+ +V  +V+  C+ V
Sbjct  130  LSSWFQNTDDKETTPFSVAHEQKFWDLASNEDRFNKFFNEAMASDSSIVKQVVISNCKEV  189

Query  432  FEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            F+GL S+VDVGG  G   K IA+ FP+LKCTV DLPHVV GL+
Sbjct  190  FKGLKSLVDVGGNTGAMTKAIAETFPNLKCTVLDLPHVVAGLK  232



>ref|XP_006371493.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
 gb|ERP49290.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
Length=283

 Score =   125 bits (313),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S W +NDDPTPF T HG T WDY G EP LNH FN+AMASDARLV  ++V  C+ VFEG
Sbjct  60   VSTWLKNDDPTPFDTAHGRTFWDYGGHEPMLNHFFNDAMASDARLVTRVLVNECKEVFEG  119

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVGGG GT AK +A AFPHL CTVFDLPHVV  L+
Sbjct  120  LGSLVDVGGGTGTVAKSLAKAFPHLDCTVFDLPHVVADLQ  159


 Score = 76.6 bits (187),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = +2

Query  89   MRTLIHSGFFVITKTQGSD-DEGYALAPPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            MR LIHSGFF   K    D +EGY L   S LLLKDNP SV PFL A+LDPILTKPWH +
Sbjct  1    MRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVTPFLQAMLDPILTKPWHFV  60



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score =   115 bits (289),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            ++ WF NDDPTPF T HG  +W YAG  P+LN +FNEAMA DA++V ++++K C  VF+G
Sbjct  138  LTTWFLNDDPTPFQTCHGRGIWKYAGHNPELNSSFNEAMACDAKMVASILIKECEGVFDG  197

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVGGG GT AK +AD+FP L C VFDLPHVV GL+
Sbjct  198  LKSLVDVGGGTGTVAKALADSFPQLDCCVFDLPHVVAGLQ  237


 Score = 85.9 bits (211),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 63/90 (70%), Gaps = 2/90 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ--GSDDEGYALAPPS  175
            +KHG PMTL+ L+ AL I+ AK+  + RL+R L+HSGF    KT+    + EGY L   S
Sbjct  49   NKHGKPMTLSDLIIALSIHPAKTHAIPRLVRILVHSGFLDKEKTEENSQETEGYVLTNAS  108

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
             LL+K++P S++ FLLA+LDP+LT PW ++
Sbjct  109  KLLVKEHPFSLKTFLLAMLDPVLTGPWDHL  138



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score =   106 bits (264),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKT-QGSDDEGYALAPPSI  178
            H H  PMTL QL+ AL I+  K+  + RLMR L+HSGFF + KT +   +EGY L   S 
Sbjct  49   HNHAKPMTLNQLLTALQIHPTKTQCVYRLMRILVHSGFFALQKTSENEQEEGYILTSASK  108

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+PLS+ PFLLA+LDPILTKPWH +
Sbjct  109  LLLKDHPLSLAPFLLAMLDPILTKPWHQV  137


 Score = 95.5 bits (236),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 70/104 (67%), Gaps = 4/104 (4%)
 Frame = +3

Query  261  ISEWFQNDDPTP----FYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRV  428
            +S W QNDD       F   HGM  WDYA +E +LNH FNE MASD RL  + ++  C+ 
Sbjct  137  VSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALIHKCKD  196

Query  429  VFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            VFEGL+++VDVGGG GT A  IA  FPH++CTVFD PHVV  L+
Sbjct  197  VFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLK  240



>ref|XP_006376388.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54185.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=365

 Score =   106 bits (265),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WF+ND+ T F   H  T W+YAG++P++ + FNEAMASD+ L   +VV  C+ +FEG
Sbjct  139  LSTWFRNDEATAFSVAHENTFWEYAGQDPRIKNLFNEAMASDSILASKLVVSKCKGIFEG  198

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVGGG GT AK IA+AFPH+ CTVFDLPHVV  L+
Sbjct  199  LSSLVDVGGGFGTMAKGIAEAFPHMDCTVFDLPHVVSDLQ  238


 Score = 94.0 bits (232),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQG-SDDEGYALAPPSI  178
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+HSGFF      G  + E Y+L   + 
Sbjct  51   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHSGFFSQQNLNGVHNQEAYSLTQSTR  110

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LLLKDNP ++RP LL  LD +LTKPW
Sbjct  111  LLLKDNPWNMRPLLLFELDSVLTKPW  136



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score =   115 bits (288),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WF+N D TPF T HGM LWDYAG +PK N+ FN+AMASDAR V ++V++ C+ +F GL
Sbjct  135  STWFKNGDTTPFETAHGMMLWDYAGADPKHNNLFNDAMASDARFVTSLVIEKCKGMFMGL  194

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGG GT AK IA +FP ++C VFDLPHVV GL+
Sbjct  195  ESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLK  233


 Score = 84.7 bits (208),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 8/93 (9%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSD-----DEGYALA  166
            H +G PM L+ L+ +LPI+ +K+  + RLMR +IHSGFF     Q  D     D  Y L 
Sbjct  45   HNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMIHSGFF---SQQNHDMENQLDAKYVLT  101

Query  167  PPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
              S+LLLK++P+SV PFL A+LDPILT PW+  
Sbjct  102  DASVLLLKNHPMSVTPFLHAMLDPILTNPWNQF  134



>ref|XP_004490687.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=354

 Score =   120 bits (300),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S W +NDDPT F T HGM +WDYA +EPK N+ FN+AMASDARLV ++V++ C+ VF G
Sbjct  130  LSTWLKNDDPTTFETTHGMLIWDYAAREPKFNNLFNDAMASDARLVTSVVIEKCKGVFNG  189

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK +A  FP ++C VFDLPHVV GL+
Sbjct  190  LESLVDVGGGTGTMAKALAKTFPMMECNVFDLPHVVDGLQ  229


 Score = 80.1 bits (196),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 60/91 (66%), Gaps = 5/91 (5%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE---GYALAPP  172
            H +  PM L+ L+++LPI+ +K   + RLMR + H GFF  +K   +++E    Y L   
Sbjct  42   HNYEKPMPLSVLISSLPIHPSKIPCIYRLMRIMTHLGFF--SKDNVTENELEIEYMLTDE  99

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            SILLLKD+P+SV PFL  VLDPI+  PWHN+
Sbjct  100  SILLLKDHPMSVTPFLQVVLDPIVANPWHNL  130



>gb|KJB84066.1| hypothetical protein B456_N001900 [Gossypium raimondii]
Length=361

 Score =   111 bits (277),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +3

Query  261  ISEWFQN-DDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +S WFQN D PT F   HG ++WDYAG EP++NH FN+AMASD  L  ++V+  C+ VFE
Sbjct  135  LSSWFQNLDHPTAFSAAHGESMWDYAGHEPRMNHFFNDAMASDGLLAASVVLSKCKGVFE  194

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            G  SVVDV GG GT  K++A AFP  + TVFDLPHVVHGL+
Sbjct  195  GFKSVVDVAGGTGTITKVLAKAFPQTEFTVFDLPHVVHGLQ  235


 Score = 88.6 bits (218),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            H HG  M L+ L  AL I+++K   L RLMR LIHSGFF  +KT  +D +  Y L P S 
Sbjct  47   HNHGQAMNLSDLALALGIHHSKLHCLHRLMRILIHSGFFAESKTNPTDQQKAYVLTPVSH  106

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LL KDNPLS  PF+L +LDP+L KPW
Sbjct  107  LLRKDNPLSSTPFILGMLDPVLLKPW  132



>ref|XP_006376381.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54178.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   105 bits (263),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDD   F   H  T W+YAG++ +LN+ FNEAMASD+ L   +VV  C+ +F+G
Sbjct  133  LSTWFQNDDRNAFSVAHEKTFWEYAGQDARLNNLFNEAMASDSILASKLVVSKCKGIFDG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            ++S+VDVGGG+GT  K IA+AFPH+ CTVFDLPHVV  L+
Sbjct  193  VNSLVDVGGGLGTMTKGIAEAFPHMDCTVFDLPHVVSDLQ  232


 Score = 94.0 bits (232),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQG-SDDEGYALAPPSI  178
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+HSGFF      G  + E Y+L   + 
Sbjct  45   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LLLKDNP SVRP LL +LDP+LTKPW
Sbjct  105  LLLKDNPWSVRPLLLLLLDPVLTKPW  130



>ref|XP_011037442.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   106 bits (265),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  252  HGTISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVV  431
            H  +S WF+ND+ + F   H  T W+YAG++P++N+ FN+AMASD+ L   +VV  C+ +
Sbjct  126  HDCLSTWFRNDEASAFSVAHENTFWEYAGQDPRINNLFNDAMASDSILASKVVVSKCKGI  185

Query  432  FEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            FEG++S+VDVGGG+GT AK I +AFPH+ CTVFDLPHVV  L+
Sbjct  186  FEGVNSLVDVGGGLGTMAKGIVEAFPHMDCTVFDLPHVVSDLQ  228


 Score = 93.2 bits (230),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
             KHG PMTL++LV ALPI+ +K+ ++ RLMR L+HSGFF     Q    E Y+L   + L
Sbjct  45   QKHGKPMTLSELVTALPIHPSKAQYVHRLMRILVHSGFF---SQQNLKQEAYSLTQSTRL  101

Query  182  LLKDNPLSVRPFLLAVLDPILTKP  253
            LLKDNP S+R  LL VLDP+LTKP
Sbjct  102  LLKDNPWSMRTLLLFVLDPVLTKP  125



>ref|XP_011100227.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score = 99.8 bits (247),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = +3

Query  261  ISEWFQND-DPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +S+WF++D D TPF T HG T W+YA ++P+LN  FNEAMA D  LV +++   CR VFE
Sbjct  135  VSKWFKSDHDLTPFLTTHGRTFWEYAAQDPRLNCFFNEAMACDTVLVASVITGDCRNVFE  194

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL S+VDVGGG GT AK +ADAF  L C V DLPHVV G E
Sbjct  195  GLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAGCE  235


 Score = 98.6 bits (244),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +2

Query  5    KHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPSIL  181
            KHG PMTL++L ++L +N+AKS  L RLMR +IHS FF+  K +Q  + +GY L P S L
Sbjct  48   KHGKPMTLSELTHSLHLNDAKSPSLERLMRIMIHSKFFINVKISQVEETDGYWLTPASHL  107

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL+D P S+RPF L +LDPIL  PWH++
Sbjct  108  LLRDEPSSMRPFALVLLDPILIDPWHHV  135



>gb|KCW75545.1| hypothetical protein EUGRSUZ_E04305 [Eucalyptus grandis]
Length=359

 Score =   112 bits (280),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = +3

Query  252  HGTISEWFQN-DDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRV  428
            HG +S WF N  DPTPF  V GM+ W YAG+EP LN  FN+ MASDARLV +MVV   + 
Sbjct  130  HG-LSAWFHNHADPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVVNEHKG  188

Query  429  VFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            VFEG+ S+VDVGGG GT AK IA++FPH++CT+FDLPHVV  LE
Sbjct  189  VFEGITSLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLE  232


 Score = 85.5 bits (210),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            H HG PMTL  LV+AL I+ +++  + RLMR L+HSGFF   K        Y L   S L
Sbjct  45   HHHGQPMTLDALVSALQIHPSRAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNRVSKL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL DNP +V PF L+VLDPIL  PWH +
Sbjct  105  LLTDNPSNVAPFALSVLDPILINPWHGL  132



>ref|XP_011091580.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score =   107 bits (268),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSI  178
            +KHG PMTLT+L+ ALP ++ AK+ H+ RLMRT++HSGFFV+ K   SD++GY L P S 
Sbjct  45   NKHGRPMTLTELMEALPGVDRAKADHVRRLMRTVVHSGFFVLEKVDSSDEQGYWLTPASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL++D+P+S++ FLL+ LD +L +PW ++
Sbjct  105  LLMEDHPMSMKAFLLSQLDSVLCEPWQHL  133


 Score = 90.1 bits (222),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 71/101 (70%), Gaps = 1/101 (1%)
 Frame = +3

Query  261  ISEWFQN-DDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +S WF+N +D T F+T HGM+LW+   + P+  H F++ M +D  +V +++ + CR VFE
Sbjct  133  LSGWFRNIEDRTAFHTTHGMSLWEQKEQNPRFGHLFDQGMGNDTPMVADVIARDCRQVFE  192

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL S+VDVGGG GT AK IA+AFP + CTV DL  +V GLE
Sbjct  193  GLGSLVDVGGGTGTLAKAIAEAFPEIHCTVLDLAPIVAGLE  233



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score =   108 bits (270),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            + WF+N +PT F    G   W+YAG +P++N  FN+AMASDA+LV ++V++ C+ VF GL
Sbjct  134  ANWFKNGNPTTFEMAQGKPFWEYAGSDPRINSLFNDAMASDAQLVTSVVIEKCKRVFMGL  193

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGG GT  K IA +FP L+CTVFDLPHVV GL+
Sbjct  194  ESLVDVGGGTGTMGKAIAKSFPQLECTVFDLPHVVSGLQ  232


 Score = 89.4 bits (220),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVI-TKTQGSDDEGYALAPPSI  178
            H HG PM+L+ L+++LPI+++K+  + RLMR ++HSGFF     T+   +  YAL   S+
Sbjct  45   HNHGQPMSLSNLISSLPIHSSKTHFIHRLMRIMVHSGFFSQHNHTENELEVKYALTDSSL  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLK N +SV PFL A+LDP+LT PW+  
Sbjct  105  LLLKSNAMSVTPFLQAMLDPVLTTPWNQF  133



>ref|XP_006376386.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 ref|XP_006376390.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54183.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 gb|ERP54187.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   103 bits (257),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDD   F   H  T W+YAG++P++N+ FN+AMA D+ LV  +VV  C+ +F+G
Sbjct  133  LSTWFQNDDRNAFSVAHENTFWEYAGQDPRINNLFNDAMARDSILVSKVVVCKCKGIFDG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            ++S+VDVGGG+GT AK IA+AFPH+ CTVFDLPHVV  L+
Sbjct  193  VNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQ  232


 Score = 94.4 bits (233),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 7/89 (8%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDD----EGYALAP  169
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+HSGFF     Q  +D    + Y+L  
Sbjct  45   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHSGFF---SQQNLNDIHNQDAYSLTQ  101

Query  170  PSILLLKDNPLSVRPFLLAVLDPILTKPW  256
             + LLLKDNP S+RP LL  LDP+LTKPW
Sbjct  102  STRLLLKDNPWSMRPLLLVFLDPVLTKPW  130



>ref|XP_010058047.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   112 bits (280),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = +3

Query  252  HGTISEWFQN-DDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRV  428
            HG +S WF N  DPTPF  V GM+ W YAG+EP LN  FN+ MASDARLV +MVV   + 
Sbjct  130  HG-LSAWFHNHADPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVVNEHKG  188

Query  429  VFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            VFEG+ S+VDVGGG GT AK IA++FPH++CT+FDLPHVV  LE
Sbjct  189  VFEGITSLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLE  232


 Score = 85.5 bits (210),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            H HG PMTL  LV+AL I+ +++  + RLMR L+HSGFF   K        Y L   S L
Sbjct  45   HHHGQPMTLDALVSALQIHPSRAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNRVSKL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL DNP +V PF L+VLDPIL  PWH +
Sbjct  105  LLTDNPSNVAPFALSVLDPILINPWHGL  132



>ref|XP_006376392.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
 gb|ERP54189.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
Length=355

 Score =   102 bits (253),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +3

Query  252  HGTISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVV  431
            H  +S WF+ND+ T F   H    W+YAG++ ++N+ FN+AMASD+ LV  +VV  C+ +
Sbjct  126  HDCLSTWFRNDEATAFSIAHESIFWEYAGQDSRINNLFNDAMASDSILVSKVVVSKCKGI  185

Query  432  FEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            FEG++S+VDVGGG+GT AK IA+AFPH+ CTVFDLP VV  L+
Sbjct  186  FEGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPRVVSDLQ  228


 Score = 95.5 bits (236),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 3/84 (4%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+HSGFF     Q  + E Y+L   + L
Sbjct  45   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHSGFF---SQQNLNQEAYSLTQSTRL  101

Query  182  LLKDNPLSVRPFLLAVLDPILTKP  253
            LLKDNPLS+R  LL VLDP+LTKP
Sbjct  102  LLKDNPLSMRTLLLFVLDPVLTKP  125



>emb|CDP15886.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   107 bits (268),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  258  TISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +++EWF+NDDP+PF+T HG   W YA +EP   + FNEAMA+D+ L++ +++  C+ VF+
Sbjct  123  SLTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLIVQVMMTQCKFVFD  182

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL S+ DVGGG G  A+ IA  FP+LKC V DLPHV+ G E
Sbjct  183  GLTSLADVGGGTGAVARAIAQNFPNLKCVVCDLPHVIAGQE  223


 Score = 89.7 bits (221),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 63/88 (72%), Gaps = 6/88 (7%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            ++HG P+TL++LV+ALPIN +K+ H+ RLMR L ++GFFV+       D+GYAL     L
Sbjct  43   NQHGKPITLSELVSALPINPSKANHIYRLMRFLSNAGFFVLQ------DQGYALTAAGRL  96

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLK+ P ++R F+  + DP+L KPW+++
Sbjct  97   LLKEEPFNLRAFIFYMSDPVLVKPWNSL  124



>ref|XP_011070200.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=458

 Score =   107 bits (267),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSI  178
            HKHG PMTLTQL+ ALP ++ AK+ H+ RLMRT++HSGFFV+ K   SD++GY L P S 
Sbjct  145  HKHGRPMTLTQLMEALPGVDRAKADHVRRLMRTVVHSGFFVLEKVDSSDEQGYWLTPASR  204

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL++D+P+S++ F+L+ L  +L +PW ++
Sbjct  205  LLMEDHPMSMKAFVLSQLGSVLCEPWQHL  233


 Score = 90.1 bits (222),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = +3

Query  261  ISEWFQN-DDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +S WF+N +D T F+T HGM+LW+   + P   H F+  M +DA +V +++ + CR VFE
Sbjct  233  LSGWFRNTEDRTSFHTTHGMSLWELKEQNPSFGHLFDRGMENDATIVADVITRDCRQVFE  292

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL S+VDVGGG GT AK IA+ FP + CTV DL  V+ GLE
Sbjct  293  GLGSLVDVGGGTGTVAKAIAEVFPQIHCTVLDLAPVIAGLE  333



>ref|XP_006452811.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
 gb|ESR66051.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
Length=365

 Score =   101 bits (252),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKT-QGSDDEGYALAPPSI  178
            H H  PMTL QL+  L I+  K+  +  LMR L+HSGFF + KT +   +EGY L   S 
Sbjct  49   HNHAKPMTLNQLLTTLQIHPTKTQCVYHLMRILVHSGFFALQKTSENEQEEGYILTSASK  108

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+PLS+ PFLLA+LDPILTKPWH +
Sbjct  109  LLLKDHPLSLAPFLLAMLDPILTKPWHQV  137


 Score = 95.9 bits (237),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 70/104 (67%), Gaps = 4/104 (4%)
 Frame = +3

Query  261  ISEWFQNDDPTP----FYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRV  428
            +S W QNDD       F   HGM  WDYA +E +LNH FNE MASD RL  + ++  C+ 
Sbjct  137  VSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALINKCKD  196

Query  429  VFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            VFEGL+++VDVGGG GT A  IA  FPH++CTVFD PHVV  L+
Sbjct  197  VFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLK  240



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score =   100 bits (249),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDD-EGYALAPPSI  178
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+HSGFF      G D+ E Y+L   + 
Sbjct  45   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LLLKDNP SVR  LL VLDP+LTKPW
Sbjct  105  LLLKDNPWSVRAHLLFVLDPVLTKPW  130


 Score = 97.1 bits (240),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDD T F   H    W+Y G++P++N+  NE MA D+ L   +VV  C+ +FEG
Sbjct  133  LSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDSILACKLVVNKCKGIFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            + S+VDVGGGIGT AK I +AFPH+ CTV DLPHVV  L+
Sbjct  193  VSSLVDVGGGIGTMAKGITEAFPHMDCTVLDLPHVVSDLQ  232



>ref|XP_002517834.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44352.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   103 bits (257),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = +3

Query  261  ISEWFQNDDP--TPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVF  434
            +S WFQNDD   +PF   HG T WD A  E + N  FNEAMASD+ +V  +V+  C+ VF
Sbjct  134  LSSWFQNDDSKCSPFSIAHGKTFWDLASHEARFNSIFNEAMASDSSVVREVVISKCKDVF  193

Query  435  EGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
             GL+S+VDVGG  G  AK I + FP LKCTV DLPHVV G++
Sbjct  194  MGLNSLVDVGGSTGIMAKAIVETFPELKCTVLDLPHVVAGMQ  235


 Score = 94.0 bits (232),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPS  175
            H HG PMTL++LV  LP +  +KS H+ RLMR L HSGFF + K +   D++GY L  P 
Sbjct  45   HNHGQPMTLSELVAGLPHVLPSKSHHVCRLMRVLTHSGFFTLQKASDNRDEDGYLLTKPC  104

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPW  256
            +LLLKD+P+S RP+L AVLDPILTKPW
Sbjct  105  LLLLKDSPISARPYLFAVLDPILTKPW  131



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score =   100 bits (248),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDD-EGYALAPPSI  178
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+HSGFF      G D+ E Y+L   + 
Sbjct  45   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LLLKDNP SVR  LL VLDP+LTKPW
Sbjct  105  LLLKDNPWSVRAHLLFVLDPVLTKPW  130


 Score = 96.7 bits (239),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDD T F   H    W+Y G++P++N+  NE MA D+ L   +VV  C+ +FEG
Sbjct  133  LSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDSILACKLVVNKCKGIFEG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            + S+VDVGGG+GT AK I +AFPH+ CTV DLPHVV  L+
Sbjct  193  VSSLVDVGGGLGTMAKGITEAFPHMDCTVLDLPHVVSDLQ  232



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score =   101 bits (252),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKT-QGSDDEGYALAPPSI  178
            H H  PMTL QL+  L I+  K+  +  LMR L+HSGFF + KT +   +EGY L   S 
Sbjct  49   HNHAKPMTLNQLLTTLQIHPTKTQCVYHLMRILVHSGFFALQKTSENEQEEGYILTSASK  108

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD+PLS+ PFLLA+LDPILTKPWH +
Sbjct  109  LLLKDHPLSLAPFLLAMLDPILTKPWHQV  137


 Score = 95.1 bits (235),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 70/104 (67%), Gaps = 4/104 (4%)
 Frame = +3

Query  261  ISEWFQNDDPTP----FYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRV  428
            +S W QNDD       F   HGM  WDYA +E +LNH FNE MASD RL  + ++  C+ 
Sbjct  137  VSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALIHKCKD  196

Query  429  VFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            VFEGL+++VDVGGG GT A  IA  FPH++CTVFD PHVV  L+
Sbjct  197  VFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLK  240



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   106 bits (265),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  258  TISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +++EWF+NDDP+PF+T HG   W YA +EP   + FNEAMA+D+ L + +++  C+ VF+
Sbjct  123  SLTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLTVQVMMTQCKFVFD  182

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL S+VDVGGG G  A+ IA  FP+L+C V DLPHV+ G E
Sbjct  183  GLTSLVDVGGGTGAVARAIAQNFPNLECVVCDLPHVIAGQE  223


 Score = 89.4 bits (220),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 62/88 (70%), Gaps = 6/88 (7%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            ++HG P+TL++LV+ALPIN +K+ H+ RLMR L ++GFFV+       D+GYAL     L
Sbjct  43   NQHGKPITLSELVSALPINPSKANHIYRLMRFLSNAGFFVLQ------DQGYALTAAGRL  96

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLK+ P ++R F+    DP+L KPW+++
Sbjct  97   LLKEEPFNLRAFIFYTSDPVLVKPWNSL  124



>ref|XP_011092041.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=355

 Score =   107 bits (266),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSI  178
            HKHGGPMTLT+L++ALP ++ AK+  + RLMRTL+HSGFFV+ K   S++EGY+L P   
Sbjct  45   HKHGGPMTLTELLDALPAVDKAKANCMYRLMRTLVHSGFFVLEKLNSSNEEGYSLTPAPR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL+ D P+S++PF+++ +DPILT+  H++
Sbjct  105  LLVGDRPMSMKPFVISQIDPILTESMHHL  133


 Score = 88.6 bits (218),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = +3

Query  261  ISEWFQND-DPTPFYTVH-GMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVF  434
            +  WFQ   D T F+T + G + W+   + P+ +H F++ M SD  +V +++ + CR VF
Sbjct  133  LGRWFQTTHDRTTFHTANNGTSFWEQKERNPRFSHLFDQGMESDTPMVASVITRDCRQVF  192

Query  435  EGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            EGLDSVVDVGGG GT AK IA+AFP + CTV DLPH+V GLE
Sbjct  193  EGLDSVVDVGGGTGTLAKAIAEAFPQIHCTVLDLPHIVAGLE  234



>ref|XP_010058046.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   108 bits (271),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 78/104 (75%), Gaps = 2/104 (2%)
 Frame = +3

Query  252  HGTISEWFQN-DDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRV  428
            HG +S WF N  DPTPF  V GM+ W YAG+EP  +  FN+ MASDARLV +MVV   + 
Sbjct  130  HG-LSAWFHNHADPTPFEMVQGMSFWRYAGQEPGFDRLFNDGMASDARLVASMVVNEHKG  188

Query  429  VFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            VFEG+ S+VDVGGG GT AK IA++FPH++CT+FDLPHVV  LE
Sbjct  189  VFEGITSLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLE  232


 Score = 85.5 bits (210),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            H HG PMTL  LV+AL I+ +++  + RLMR L+HSGFF   K        Y L   S L
Sbjct  45   HHHGQPMTLDALVSALQIHPSRAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNRVSKL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL DNP +V PF L+VLDPIL  PWH +
Sbjct  105  LLTDNPSNVAPFALSVLDPILINPWHGL  132



>ref|XP_010040912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW44790.1| hypothetical protein EUGRSUZ_L01646 [Eucalyptus grandis]
Length=357

 Score =   110 bits (275),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 2/104 (2%)
 Frame = +3

Query  252  HGTISEWFQND-DPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRV  428
            HG +S WF N  DPTPF  V GM+ W YAG+EP  N  FN+ MASDARLV +MVV   + 
Sbjct  128  HG-LSAWFHNHVDPTPFEMVQGMSFWRYAGQEPGFNRLFNDGMASDARLVASMVVNEHKG  186

Query  429  VFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            VFEG+ S+VDVGGG GT AK IA++FPH++CT+FDLPHVV  LE
Sbjct  187  VFEGITSLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLE  230


 Score = 84.0 bits (206),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            H HG PMTL  LV+AL I+ +++  + RLMR L+HSGFF   K        Y L   S L
Sbjct  43   HHHGQPMTLDALVSALQIHPSRAHCVDRLMRILVHSGFFEQKKLAPDGQGAYVLNHVSKL  102

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL DNP +V PF L++LDPIL  PWH +
Sbjct  103  LLTDNPSNVAPFALSMLDPILINPWHGL  130



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score =   108 bits (271),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WF+NDD TPF T HGM  WDYA ++PK+N+  NE+MA DA+L+  + ++ C+ +  G
Sbjct  133  LSTWFKNDDLTPFETAHGMLPWDYANRDPKVNNLLNESMACDAQLIAGVFIEKCKDMLNG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT A+ IA +FP LKCTVFDLPHVV  L+
Sbjct  193  LESLVDVGGGTGTMARAIAKSFPRLKCTVFDLPHVVADLQ  232


 Score = 85.1 bits (209),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPSI  178
            H +G PM L++L+ +LPI+++K+ ++ RLMR +IHSGFF     T+   +  Y L   SI
Sbjct  45   HNYGKPMPLSKLIASLPIHSSKAGNIPRLMRVMIHSGFFSQHNITENELEVEYTLTDDSI  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLK +P S+ PFLL   DPIL KPWH++
Sbjct  105  LLLKGHPFSILPFLLCSNDPILKKPWHHL  133



>ref|XP_002262833.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=358

 Score =   112 bits (279),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WF+N DPTPFYT HG   WDY  +EP  N  FNEAMASD+R++ ++++  C+  F+G
Sbjct  134  LSGWFRNGDPTPFYTAHGKPYWDYTAQEPDFNDLFNEAMASDSRIIASVLITKCKEQFKG  193

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVG G GT  K IA AFPHLKC VFD PHVV  L+
Sbjct  194  LFSLVDVGAGTGTMTKAIAKAFPHLKCIVFDQPHVVADLQ  233


 Score = 82.0 bits (201),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKT--QGSDDEGYALAPPS  175
            H HG PM L+QLV AL +  +K+  L RLMR L+HSGFF   +       +EGY+L   S
Sbjct  45   HSHGQPMLLSQLVTALSVQPSKAPCLHRLMRLLVHSGFFSQQQVIHNNEQEEGYSLTSAS  104

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPWH  259
              LLKD PL+  P  L  L+P+LT PWH
Sbjct  105  RFLLKDEPLTGLPLSLLHLNPVLTAPWH  132



>ref|XP_007132750.1| hypothetical protein PHAVU_011G122000g [Phaseolus vulgaris]
 gb|ESW04744.1| hypothetical protein PHAVU_011G122000g [Phaseolus vulgaris]
Length=297

 Score =   115 bits (287),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WF NDDPTPF+T + MTLWDYA +EPK NH FN+AM +D RL+ ++V++ C+ V +GL
Sbjct  105  STWFTNDDPTPFHTQNEMTLWDYASREPKFNHLFNDAMTNDTRLISSVVIEKCKGVLQGL  164

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHV  545
            +S+VDVGGG GT AK IA++FPHL C VFDLPHV
Sbjct  165  ESLVDVGGGTGTLAKAIANSFPHLNCIVFDLPHV  198


 Score = 79.3 bits (194),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVI-TKTQGSDDEGYALAPPSI  178
            HK+G PM L+QL+ +LP++ +K+  ++RLM+ L+HSGFF     T  + +  Y L   SI
Sbjct  16   HKYGKPMPLSQLIASLPVHPSKTCFISRLMQILVHSGFFSQHIVTHNNQEVSYVLTDASI  75

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LLLKD+P  +   L  +LDP+L  PW
Sbjct  76   LLLKDHPFRMTCLLQVILDPVLFNPW  101



>gb|KJB84021.1| hypothetical protein B456_N002000 [Gossypium raimondii]
Length=356

 Score =   110 bits (276),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +3

Query  261  ISEWFQN-DDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +S WFQN D PT F   HG ++WDYAG EP++NH FN+AMASD  L  ++V+  C+ VFE
Sbjct  130  LSYWFQNLDHPTAFSAAHGESMWDYAGHEPRVNHFFNDAMASDGLLAASVVLSKCKGVFE  189

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL SVVDVGGG G   K+ A AFP  + TVFDLPHVVHGL+
Sbjct  190  GLKSVVDVGGGTGIITKVFAKAFPQTEFTVFDLPHVVHGLQ  230


 Score = 82.8 bits (203),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            H HG  M L+ L  AL I+++K   L RLMR L HSGFF  +KT  +D +  Y L   S 
Sbjct  42   HNHGQAMNLSDLALALGIHHSKLHCLHRLMRILFHSGFFAESKTNSTDQQRAYVLTTVSH  101

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LL KD PLS  PF+L +LDP+L KPW
Sbjct  102  LLRKDYPLSSTPFILGMLDPVLLKPW  127



>emb|CAN76576.1| hypothetical protein VITISV_035390 [Vitis vinifera]
Length=232

 Score =   119 bits (297),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T HG T+WDY   EP+ N+ FNE MASDARLV +++VK C+  FEG
Sbjct  132  VSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEGMASDARLVTSVLVKECKGAFEG  191

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVV  548
            L+S VDVGGG GT AK I +AFPHL  TV DLPHVV
Sbjct  192  LNSFVDVGGGTGTVAKTIVEAFPHLHGTVLDLPHVV  227


 Score = 74.7 bits (182),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGS-DDEGYALAPPSI  178
            H H  PMTL +LV  LP+   K+  + RLMR L+HSGFF + + Q S D+EGY LA  S 
Sbjct  45   HNHCQPMTLHELVAKLPVRPNKTLCVYRLMRILVHSGFFTMQRVQESADEEGYVLANASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LLLKD+PLSV P  L +LDP LT+PW
Sbjct  105  LLLKDHPLSVTP-FLLLLDPDLTEPW  129



>ref|XP_010052409.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89598.1| hypothetical protein EUGRSUZ_A01881 [Eucalyptus grandis]
Length=358

 Score =   112 bits (280),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = +3

Query  252  HGTISEWFQND-DPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRV  428
            HG +S WF N  DPTPF  V GM+ W YAG+EP LN  FN+ MASDARLV +MVV   + 
Sbjct  130  HG-LSAWFHNRVDPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVVNEHKG  188

Query  429  VFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            VFEG+ S+VDVGGG GT AK IA+AFPH++CT+FDLPHVV  LE
Sbjct  189  VFEGITSLVDVGGGTGTTAKAIANAFPHMECTIFDLPHVVANLE  232


 Score = 80.9 bits (198),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            H HG PM L  LV+AL I+ +++  + RLMR L+HSGFF   K        Y L   S L
Sbjct  45   HHHGQPMNLDALVSALQIHPSRAHCVDRLMRILVHSGFFEQKKLAPDGRGAYVLNRVSKL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL DNP +V PF L++LDP L  PWH +
Sbjct  105  LLTDNPCNVAPFALSMLDPTLINPWHGL  132



>ref|XP_002278149.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   117 bits (293),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S+WF+N DPTPF T +G   WDYA  EPK N+ FNEAMASD++L+ ++VV  C+ VF G
Sbjct  133  LSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVVGECKEVFRG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S++DVGGG GT AK+IA AFPHLKCTVFD PHVV  L+
Sbjct  193  LSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQ  232


 Score = 75.1 bits (183),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEG-YALAPPSI  178
            + HG P+TL++LV AL IN  K+  L RLMR L+HSGFF   +   ++ E  Y+L   S 
Sbjct  45   NNHGQPITLSELVTALSINPIKAPCLHRLMRVLVHSGFFAQQQADHNEQEQLYSLTYASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
             LLKD P S  P LL  +DP LT P H
Sbjct  105  FLLKDEPTSGAPLLLVQVDPHLTNPCH  131



>gb|ACV65500.1| deoxyhemigossypol-6-O-methyltransferase [Gossypium hirsutum]
Length=365

 Score =   108 bits (270),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +  WFQNDD TPF T +G TLWDY   +P+L    N+ +ASD++LV +++V  C+  FEG
Sbjct  136  LGTWFQNDDHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTSVLVDKCKGAFEG  195

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IAD FPH++CTVFDLPH+V GL+
Sbjct  196  LESLVDVGGGTGTTAKAIADTFPHMECTVFDLPHIVAGLQ  235


 Score = 83.6 bits (205),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPS  175
            H HG PMT+TQLV AL  +N  K+  + RLM  L+HS FF   K    + +EGY L   S
Sbjct  47   HDHGKPMTITQLVGALQMLNPTKACDIYRLMHILVHSDFFARQKLDNDAQEEGYVLTNSS  106

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPW  256
             +LLK+NP  + P L A +DPI+TKPW
Sbjct  107  RILLKNNPFCITPTLKATMDPIITKPW  133



>emb|CDP21212.1| unnamed protein product [Coffea canephora]
Length=324

 Score = 97.8 bits (242),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 63/91 (69%), Gaps = 3/91 (3%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE---GYALAPP  172
            HKHG PMTL QL++ALPI NAK+  +  LM+ LIHSGFF+  K  G++++   GY L   
Sbjct  47   HKHGQPMTLDQLIDALPIKNAKAPFVYLLMQILIHSGFFIEAKIPGNENDNQKGYLLTSA  106

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            + LLLK NP S+ P LL  LDP LT PWH++
Sbjct  107  AELLLKSNPFSMTPLLLFTLDPTLTDPWHHL  137


 Score = 94.7 bits (234),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S+WFQN D TPFYT HG +L+D A  EP+LN  FNEAMASD RLV ++V K C+ VFEG
Sbjct  137  LSQWFQNSDETPFYTCHGRSLYDLASHEPRLNQFFNEAMASDTRLVSSVVTKDCKHVFEG  196

Query  441  LDSVVDV  461
            L+S+VDV
Sbjct  197  LNSLVDV  203



>ref|XP_003527405.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
 gb|KHN07776.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=359

 Score =   120 bits (302),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WF N+DPTPF+T +GM  WDYA  EPKLNH FN+AM +D+RL+ +++++ C+ VF GL
Sbjct  137  STWFTNEDPTPFHTQNGMAFWDYASSEPKLNHLFNDAMTNDSRLISSVLIEKCKGVFSGL  196

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGG GT AK IA +FP LKC VFDLPHVV GL+
Sbjct  197  ESLVDVGGGTGTMAKAIAKSFPQLKCIVFDLPHVVDGLQ  235


 Score = 71.2 bits (173),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 53/89 (60%), Gaps = 4/89 (4%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFV----ITKTQGSDDEGYALAP  169
            HK+G PM L+QL+ +LPI+ +K+  + RLM+ L HSGFF      T+    ++  Y L  
Sbjct  45   HKYGQPMPLSQLIASLPIHPSKACFIFRLMQILTHSGFFSQHNNATENYEQEEVSYVLTD  104

Query  170  PSILLLKDNPLSVRPFLLAVLDPILTKPW  256
             S LLLKD+  S+      +LDPIL  PW
Sbjct  105  ASKLLLKDHHFSMISLPQVILDPILVNPW  133



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   119 bits (298),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WFQNDDPTPF+T HG TLWDY   EP+ N+ FNE MASDARLV +++VK C+  FEGL
Sbjct  133  SAWFQNDDPTPFFTAHGRTLWDYGCHEPRFNNFFNEGMASDARLVTSVLVKECKGAFEGL  192

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S VDVGGG GT AK I +AFPHL  TV DLPHVV  L 
Sbjct  193  NSFVDVGGGTGTVAKTIVEAFPHLHGTVLDLPHVVADLR  231


 Score = 72.4 bits (176),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGS-DDEGYALAPPSI  178
            H H  PMTL +LV  LP+   K+  + RLMR L+HSGFF   + Q S D+EGY LA  S 
Sbjct  45   HNHCKPMTLHELVAKLPVRPNKTLCVHRLMRILVHSGFFTKQRVQESADEEGYVLANASR  104

Query  179  LLLKDNPLSV  208
            LLLKD+PLS+
Sbjct  105  LLLKDHPLSI  114



>gb|KJB73399.1| hypothetical protein B456_011G231300 [Gossypium raimondii]
Length=365

 Score =   104 bits (259),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +  WFQNDD TPF T +G TLWDY   +P+L    N+ +ASD++LV +++V  C+  FEG
Sbjct  136  LGTWFQNDDHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTSVLVDKCKGAFEG  195

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            LDS+VDVGGG GT AK IAD FP ++CTVFDLP++V GL+
Sbjct  196  LDSLVDVGGGTGTTAKAIADTFPLMECTVFDLPNIVAGLQ  235


 Score = 87.4 bits (215),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPS  175
            H HG PMT+T+LV AL  +N AK+  + RLMR L+HS FF   K    + +EGY L   S
Sbjct  47   HDHGKPMTITELVAALQMLNPAKACDIYRLMRILVHSAFFARQKLDTDAQEEGYVLTNSS  106

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPW  256
             +LLK+NP  V P L A +DPI+TKPW
Sbjct  107  RILLKNNPFCVTPTLKATMDPIITKPW  133



>gb|AEN94899.1| desoxyhemigossypol-6-O-methyltransferase [Gossypium barbadense]
Length=365

 Score =   104 bits (260),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +  WFQNDD TPF T +G TLWDY   +P+L    N+ +ASD++LV +++V  C+  FEG
Sbjct  136  LGTWFQNDDHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTSVLVDKCKGAFEG  195

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            LDS+VDVGGG GT AK IAD FP ++CTVFDLP++V GL+
Sbjct  196  LDSLVDVGGGTGTTAKAIADTFPLMECTVFDLPNIVAGLQ  235


 Score = 87.0 bits (214),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPI-NNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPS  175
            H HG PMT+TQLV AL I N  K+  + RLMR L+HS FF   K    + +EGY L   S
Sbjct  47   HDHGKPMTITQLVAALQILNPTKACDIYRLMRILVHSDFFARQKLDNDAQEEGYVLTNSS  106

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPW  256
             +LLK+NP  + P L A +DPI+TKPW
Sbjct  107  RILLKNNPFCITPTLKATMDPIITKPW  133



>ref|XP_003615966.1| O-methyltransferase [Medicago truncatula]
 gb|AES98924.1| orcinol O-methyltransferase [Medicago truncatula]
Length=360

 Score =   104 bits (260),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S W +NDDPT F T H M LW+Y   + K ++ FNE+MASD RLV N++++ CR VF GL
Sbjct  136  STWLKNDDPTTFETTHRMLLWEYVACDSKFSNLFNESMASDTRLVTNLLIEKCRGVFNGL  195

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGG GT AK +A +FP ++ +VFDLPHVV GL+
Sbjct  196  ESLVDVGGGTGTMAKALAKSFPQMEFSVFDLPHVVDGLQ  234


 Score = 86.7 bits (213),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFV-ITKTQGSDDEGYALAPPSI  178
            H +G P++L++L++ LPI+ +K+  + RLMR + HS FF     T+   +  Y L   SI
Sbjct  47   HNYGKPISLSKLISLLPIHPSKTCFIHRLMRIMTHSSFFSQYNVTENELEIEYMLTDASI  106

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLLKDNP+SV PF+ A+LDP+LT PWH
Sbjct  107  LLLKDNPMSVTPFVHAMLDPVLTNPWH  133



>emb|CBI22005.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   119 bits (298),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T +  + WDYAG EP+LN++FNEAMASDARL+ ++++K  + VF G
Sbjct  85   LSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVFAG  144

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DL HVV GL+
Sbjct  145  LNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQ  184


 Score = 70.9 bits (172),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 20/87 (23%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKT-QGSDDEGYALAPPSI  178
            H HG PMTL +LV  LP++  +S  + RLMR L+HSGF    +  QG ++EG        
Sbjct  16   HNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGKEEEG--------  67

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
                       P +LA+LDPILTKPWH
Sbjct  68   -----------PLVLAMLDPILTKPWH  83



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score =   102 bits (253),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WF+N +PT F   +G   W+YA  +P+ N  FN+AMASDA+LV ++V + C+ VF GL
Sbjct  134  SNWFKNGNPTTFEMENGKPFWEYASCDPRFNILFNDAMASDAQLVTSLVTEKCKGVFMGL  193

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGG G   K IA +FP L+CTVFDLPHVV GL+
Sbjct  194  ESLVDVGGGTGIMGKAIAKSFPQLECTVFDLPHVVSGLQ  232


 Score = 88.2 bits (217),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVI-TKTQGSDDEGYALAPPSI  178
            H HG PM+L+ L+++LPI+++K+  + RLMR ++HSGFF     T+   +  YAL   S+
Sbjct  45   HNHGQPMSLSNLISSLPIHSSKTHFIHRLMRIMVHSGFFSQHNPTENELELKYALTDSSL  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLK N +SV PFL A+LDP++T PW+  
Sbjct  105  LLLKSNAMSVTPFLQAMLDPVMTNPWNQF  133



>ref|XP_004505627.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=389

 Score =   109 bits (272),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVH-GMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +S W++N+DP+PFYT + G+  WDYAG +P+ NH FNEAMA + R+   +V+  C+ VF+
Sbjct  164  LSNWYKNEDPSPFYTENNGIEFWDYAGHDPEFNHLFNEAMACETRMASTVVMGKCKGVFQ  223

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL+S+VDVGGGIGT +K IA +FP+++C VFDLPHVV GL+
Sbjct  224  GLESLVDVGGGIGTMSKAIAKSFPNIECIVFDLPHVVDGLQ  264


 Score = 80.9 bits (198),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            H +G P+ L+QL+++LPI+ +KS  + RLMR L HS FF++TK +   +  Y L   S L
Sbjct  79   HNYGQPIPLSQLISSLPIHPSKSGDIDRLMRVLTHSNFFIVTKNEL--EVMYELTDASRL  136

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLKD+P S+   L  +L PI++KPWH +
Sbjct  137  LLKDHPFSMTSMLHVILGPIMSKPWHQL  164



>ref|XP_007142076.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
 gb|ESW14070.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
Length=357

 Score =   112 bits (279),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WF+ND PT F   HG   W+YAG +P+ N  FN+AMASDA+LV ++V++ C+ VF GL
Sbjct  134  SNWFKNDSPTTFEMAHGKPFWEYAGSDPRFNILFNDAMASDAQLVTSVVIEKCKGVFMGL  193

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGG GT  K I+ +FP L+CTVFDLPHVV GL+
Sbjct  194  ESLVDVGGGTGTMGKAISKSFPQLECTVFDLPHVVSGLQ  232


 Score = 77.8 bits (190),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPSI  178
            H HG PM+L+ L+++LPI+++K+  + RLMR ++ SGFF     T+   +  YAL   S+
Sbjct  45   HNHGQPMSLSNLISSLPIHSSKTHFIHRLMRIMVQSGFFSQHNPTENELEVKYALTDSSL  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLK + +S+ P+L A LDP  T PW+  
Sbjct  105  LLLKSHAMSMTPYLQAKLDPAFTNPWNQF  133



>gb|KDP24057.1| hypothetical protein JCGZ_25714 [Jatropha curcas]
Length=307

 Score =   106 bits (265),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S    N D TPF+T HG  LW+YA   P LN+ FN++MASDARLVM++++K C+ VF+G
Sbjct  84   LSTRLLNGDQTPFHTSHGKALWEYAEDNPNLNNLFNKSMASDARLVMSIMIKECKEVFDG  143

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            + S+ DVGGG GT A  +ADAFPHL C VFDLPHVV GL+
Sbjct  144  MKSLTDVGGGPGTMATGLADAFPHLDCVVFDLPHVVAGLQ  183


 Score = 83.2 bits (204),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +2

Query  20   MTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQ--GSDDEGYALAPPSILLLKD  193
            MTL+ L+ AL I+  K+    RLMR L+HSGFF I K +  G + EGY L   + LL+ +
Sbjct  1    MTLSDLITALSIHPTKAHCFPRLMRILVHSGFFAIAKIEENGQESEGYVLPKATELLVNE  60

Query  194  NPLSVRPFLLAVLDPILTKPWH  259
            NP SV PFLL  LDP+LT PW+
Sbjct  61   NPSSVTPFLLVSLDPVLTGPWY  82



>gb|KJB73403.1| hypothetical protein B456_011G231700 [Gossypium raimondii]
Length=365

 Score =   103 bits (258),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +  WFQNDD TPF T +G TLWDY   +P+L    N+ +ASD++LV +++V  C+  FEG
Sbjct  136  LGTWFQNDDHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTSVLVDKCKGAFEG  195

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            LDS+VDVGGG GT AK IAD FP + CTVFDLP++V GL+
Sbjct  196  LDSLVDVGGGTGTTAKAIADTFPLMDCTVFDLPNIVAGLQ  235


 Score = 85.9 bits (211),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPS  175
            H HG PMT+TQLV AL  +N  K+  + RLMR L+HS FF   K    + +EGY L   S
Sbjct  47   HDHGKPMTITQLVAALQMLNPTKACDIYRLMRILVHSDFFARQKLDNDAQEEGYVLTNSS  106

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPW  256
             +LLK+NP  + P L A +DPI+TKPW
Sbjct  107  RILLKNNPFCITPTLKATMDPIITKPW  133



>gb|KJB73396.1| hypothetical protein B456_011G231000 [Gossypium raimondii]
Length=378

 Score =   105 bits (263),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +  WFQNDD TPF T +  TLWDY   +P+L    N+ +ASD++LV N++V  C+  FEG
Sbjct  149  LQHWFQNDDHTPFATTYAETLWDYFAHDPQLKDLINDGLASDSQLVTNILVDKCKEAFEG  208

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IAD FPH++CTVFDLP++V GL+
Sbjct  209  LNSLVDVGGGTGTTAKAIADTFPHMECTVFDLPNIVAGLQ  248


 Score = 83.6 bits (205),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPS  175
              HG PMT+T+LV ALP +N  K+  + R+MR L+HSG F   K    + +EGY L   S
Sbjct  47   QNHGKPMTITELVVALPMLNPTKACDIYRIMRILVHSGIFARQKLYNDAQEEGYVLTNSS  106

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPW  256
             +LLKDNP  + P L  ++DP++TKPW
Sbjct  107  RILLKDNPFCITPALNGMMDPVITKPW  133



>emb|CAN73269.1| hypothetical protein VITISV_021917 [Vitis vinifera]
Length=357

 Score =   117 bits (293),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S+WF+N DPTPF T +G   WDYA  EPK N+ FNEAMASD++L+ ++VV  C+ VF G
Sbjct  133  LSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVVGECKEVFRG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S++DVGGG GT AK+IA AFPHLKCTVFD PHVV  L+
Sbjct  193  LSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQ  232


 Score = 72.0 bits (175),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEG-YALAPPSI  178
            + HG P+TL++LV AL IN  K+  L RLMR L+ SGFF   +   ++ E  Y+L   S 
Sbjct  45   NNHGQPITLSELVTALSINPIKAPCLHRLMRVLVXSGFFAQQQADHNEQEQLYSLTYASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
             LLKD P S  P LL  +DP LT P H
Sbjct  105  FLLKDEPTSGAPLLLVQVDPHLTNPCH  131



>gb|KCW89599.1| hypothetical protein EUGRSUZ_A01884 [Eucalyptus grandis]
Length=357

 Score =   108 bits (270),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = +3

Query  252  HGTISEWFQND-DPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRV  428
            HG +S WF N  DPTPF  V GM++W Y G+EP LN  FN+ MA+DARLV +MVV   + 
Sbjct  128  HG-LSAWFHNHVDPTPFEMVQGMSIWRYVGQEPGLNRLFNDGMATDARLVASMVVNEHKG  186

Query  429  VFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +FEG+ S+VDVGGG GT AK IA++FPH++CT+FDLPHVV  LE
Sbjct  187  MFEGITSLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLE  230


 Score = 80.9 bits (198),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            H H  PMTL  LV+AL I+ +++  L RLMR L+HSGFF   K        Y L   S L
Sbjct  43   HHHDQPMTLDALVSALQIHPSRAHCLDRLMRILVHSGFFEQKKLAPDGRGAYVLNRVSKL  102

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL DNP +V PF L++LDPI+  PWH +
Sbjct  103  LLTDNPSNVAPFALSMLDPIVINPWHGL  130



>ref|XP_010070255.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   108 bits (270),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = +3

Query  252  HGTISEWFQND-DPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRV  428
            HG +S WF N  DPTPF  V GM++W Y G+EP LN  FN+ MA+DARLV +MVV   + 
Sbjct  130  HG-LSAWFHNHVDPTPFEMVQGMSIWRYVGQEPGLNRLFNDGMATDARLVASMVVNEHKG  188

Query  429  VFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +FEG+ S+VDVGGG GT AK IA++FPH++CT+FDLPHVV  LE
Sbjct  189  MFEGITSLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLE  232


 Score = 80.9 bits (198),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            H H  PMTL  LV+AL I+ +++  L RLMR L+HSGFF   K        Y L   S L
Sbjct  45   HHHDQPMTLDALVSALQIHPSRAHCLDRLMRILVHSGFFEQKKLAPDGRGAYVLNRVSKL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL DNP +V PF L++LDPI+  PWH +
Sbjct  105  LLTDNPSNVAPFALSMLDPIVINPWHGL  132



>gb|KJB73401.1| hypothetical protein B456_011G231500 [Gossypium raimondii]
Length=365

 Score =   101 bits (252),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +  WFQNDD TPF T +G TLWDY   +P+L    N+ +ASD++LV +++V  C+  F G
Sbjct  136  LGTWFQNDDHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTSVLVDKCKGAFGG  195

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            LDS+VDVGGG GT AK IAD FP ++CTVFDLP++V GL+
Sbjct  196  LDSLVDVGGGTGTTAKAIADTFPLMECTVFDLPNIVAGLQ  235


 Score = 87.4 bits (215),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 58/87 (67%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPS  175
            H HG PMT+T+LV+AL  +N AK+  + RLMR L+HS FF   K    + +EGY L   S
Sbjct  47   HDHGKPMTITELVSALQMLNPAKACDIYRLMRILVHSDFFARQKLDNDAQEEGYVLTNSS  106

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPW  256
             +LLK+NP  + P L A +DPI+TKPW
Sbjct  107  RILLKNNPFCITPTLKATMDPIITKPW  133



>emb|CBI21932.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   122 bits (307),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T HG T+WDY   EP+ N+ FNEAMASDARLV +++VK C+  FEG
Sbjct  210  VSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLVKECKGAFEG  269

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S VDVGGG GT AK I +AFPHL  TV DLPHVV  L+
Sbjct  270  LNSFVDVGGGTGTVAKTIVEAFPHLHSTVLDLPHVVADLQ  309


 Score = 66.2 bits (160),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +2

Query  80   ARLMRTLIHS------GFFVITKTQGSDDEGYALAPPSILLLKDNPLSVRPFLLAVLDPI  241
            A L++ ++H        F    + + +D+EGY LA  S LLLKD+PLSV PFLLA+LDP 
Sbjct  143  ASLLKWILHDWSDVGKQFLARKREESADEEGYVLANASRLLLKDHPLSVTPFLLAMLDPD  202

Query  242  LTKPWHNI  265
            LT+PWH +
Sbjct  203  LTEPWHYV  210


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  366  NEAMASDARLVMNMVVKYCRVVFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHV  545
              AM SDARLV +++VK  + VFEGL+S+VDVGG  GT AK+IA+AFP+L CTV DLP V
Sbjct  58   KRAMVSDARLVTSVLVKEGKGVFEGLNSLVDVGGCTGTMAKVIANAFPYLNCTVLDLPRV  117

Query  546  VHGLE  560
            V GL+
Sbjct  118  VAGLQ  122



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score =   103 bits (256),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S W +NDD T F T HGM LW+YA  + K N+ FNE+MA+DA+LV N++V+ C+ VF   
Sbjct  136  SMWLKNDDTTSFETTHGMLLWEYAACDSKFNNLFNESMANDAQLVSNLLVEKCKGVFNEF  195

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGG GT AK  A +FP ++C VFDLPHVV GL+
Sbjct  196  ESLVDVGGGTGTMAKTFAKSFPQMECIVFDLPHVVDGLQ  234


 Score = 85.9 bits (211),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
            H HG PM +++L+++LPI+ +K   + RLMR + HSGFF       ++ E  Y L   S 
Sbjct  47   HNHGKPMPISKLISSLPIHPSKKPCIHRLMRIMTHSGFFSQQNIAANEPEIEYMLTDASR  106

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLLKDNP+SV PF+ A+LDP++  PWH
Sbjct  107  LLLKDNPMSVTPFVYAMLDPVMMNPWH  133



>emb|CDP19713.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   102 bits (253),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  258  TISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +++EWF+NDDP PF T HG   W YA +EP   + FNEAMA+D+  ++ +++  C+ VF+
Sbjct  123  SLTEWFRNDDPAPFDTAHGKNFWAYAAEEPNFANRFNEAMANDSTFIVQVMMTRCKFVFD  182

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL S+VDVGGG GT A+ IA  FP+L+C V DLPHV+   E
Sbjct  183  GLTSLVDVGGGTGTVARAIAQNFPNLECVVCDLPHVIACQE  223


 Score = 85.9 bits (211),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 6/88 (7%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            ++HG P+TL++LV+ALP+N +K++H+ RLMR L  +GFFV+       D+ YAL     L
Sbjct  43   NQHGKPITLSELVSALPVNPSKASHIYRLMRFLSKAGFFVLQ------DQCYALTAAGRL  96

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLKD+P ++R  +  + DP+L KPW+++
Sbjct  97   LLKDDPFNLRALIFFMSDPVLVKPWNSL  124



>ref|XP_011091579.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score = 95.9 bits (237),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSI  178
            HKHGGPMTL +LV+ALP ++ AK+  + RLMR L+HSGFFV+ K   S++EGY+L P S 
Sbjct  45   HKHGGPMTLLELVDALPGVDKAKADCMYRLMRILVHSGFFVLEKINSSNEEGYSLTPASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LL+ D+P+S++P+ ++ + PIL  P H
Sbjct  105  LLVGDHPMSMKPY-VSQIHPILLDPMH  130


 Score = 91.7 bits (226),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = +3

Query  264  SEWFQN-DDPTPFYTVH-GMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            S WFQ+ ++PTPF+TV+ GM+LW+   + P  +H F+++MASD  +V +++ + CR VFE
Sbjct  133  SRWFQDANNPTPFHTVNNGMSLWELKERHPGFSHLFDQSMASDTSVVADVITRDCRQVFE  192

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GLDS+VDVGGG GT AK IA+AFP + CTV DL  VV G++
Sbjct  193  GLDSLVDVGGGTGTLAKAIAEAFPQIHCTVLDLAPVVAGMD  233



>emb|CBI21931.3| unnamed protein product [Vitis vinifera]
Length=278

 Score =   125 bits (314),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T H    WDYAG EP+LN+ FNEAMASDARLV ++++K  + VFEG
Sbjct  54   LSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLKEGKGVFEG  113

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DLPHVV GL+
Sbjct  114  LNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQ  153


 Score = 60.8 bits (146),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  TQGSDDEGYALAPPSILLLKDNPLSVRPFLLAVLDPILTKPWH  259
            ++G ++EGY L   S LLL D+ LS+RP LLA+LDPILTKPWH
Sbjct  10   SRGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPILTKPWH  52



>ref|XP_006346269.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=364

 Score =   101 bits (252),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 5/106 (5%)
 Frame = +3

Query  258  TISEWFQN--DDP--TPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCR  425
            ++S+WF N  DD   TP+ T HGM  + YA  EP+LNH FNEAMASD RLVM ++++  +
Sbjct  134  SLSKWFNNVSDDSNTTPYATAHGMPFFKYAENEPRLNHLFNEAMASDTRLVMTVLIQNGK  193

Query  426  -VVFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
             ++FEGL S+VDVGGG GT AK IAD FP + CTVF+LPHV+ GL+
Sbjct  194  GLIFEGLKSLVDVGGGTGTIAKAIADTFPQINCTVFELPHVIEGLK  239


 Score = 84.3 bits (207),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 57/93 (61%), Gaps = 10/93 (11%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINN---AKSTH--LARLMRTLIHSGFFVITKTQGSDDEGYALA  166
            H HG PM L+ L  ALPINN      TH  + RLMR L+H+GFF+        +EGY L 
Sbjct  48   HSHGRPMNLSDLAEALPINNNHDKAKTHDCVYRLMRILVHAGFFI-----QEAEEGYLLT  102

Query  167  PPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            P S LLLKD P+S+ PFL   LDP L  PWH++
Sbjct  103  PTSRLLLKDEPMSMIPFLNFQLDPNLMDPWHSL  135



>ref|XP_002517835.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44353.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   100 bits (248),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = +3

Query  246  QSHGTISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCR  425
            + + +++ + +NDD TPF T  G+TLW Y G E + NH  N+ MASD+ ++   V+  C+
Sbjct  127  EPYNSLTPFLRNDDLTPFVTAFGVTLWGYTGNEARANHLVNDCMASDSSVIGRAVIIKCK  186

Query  426  VVFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
             VFEGL+S+VDVGGG G  AK IA  FP+LKCTV DLPHVV  L+
Sbjct  187  EVFEGLNSLVDVGGGTGNMAKAIAQTFPNLKCTVLDLPHVVDKLQ  231


 Score = 86.3 bits (212),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            + HG PMTL++LV AL ++  K+ HL  LMR L+HSGFF +     +  + Y L P S L
Sbjct  45   NSHGQPMTLSELVRALQVHPTKTHHLYCLMRVLVHSGFFNLQNASDNYSQKYVLTPASRL  104

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLKD+    RPF+  VLDPI+T+P++++
Sbjct  105  LLKDSSFDTRPFISLVLDPIMTEPYNSL  132



>ref|XP_011016237.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   104 bits (259),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WF+NDD   F   H  TLW+YAG++ + N+ FNEAMASD+ L   +VV  C+ +F+G
Sbjct  133  LSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSILASKLVVSKCKGIFDG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            ++S+VDVGGG+GT AK IA+AFPH+ CTVFDLPHVV  L+
Sbjct  193  VNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQ  232


 Score = 81.6 bits (200),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQG-SDDEGYALAPPSI  178
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+HSGFF      G  + E Y+L   + 
Sbjct  45   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LLLKDNP SVRP LL VLDP+LTKPW
Sbjct  105  LLLKDNPWSVRPLLLLVLDPVLTKPW  130



>ref|XP_011037437.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   104 bits (259),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WF+NDD   F   H  TLW+YAG++ + N+ FNEAMASD+ L   +VV  C+ +F+G
Sbjct  133  LSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSILASKLVVSKCKGIFDG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            ++S+VDVGGG+GT AK IA+AFPH+ CTVFDLPHVV  L+
Sbjct  193  VNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQ  232


 Score = 81.6 bits (200),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQG-SDDEGYALAPPSI  178
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+HSGFF      G  + E Y+L   + 
Sbjct  45   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LLLKDNP SVRP LL VLDP+LTKPW
Sbjct  105  LLLKDNPWSVRPLLLLVLDPVLTKPW  130



>gb|EYU30782.1| hypothetical protein MIMGU_mgv1a021078mg [Erythranthe guttata]
Length=359

 Score = 97.8 bits (242),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = +3

Query  261  ISEWFQNDD--PTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVF  434
            +SEWFQ++D    PF T +GM  ++YA  + + N  FNE MASDAR V +++++  + VF
Sbjct  131  VSEWFQSNDEISCPFVTKYGMGFFEYARNKERWNKVFNEGMASDARFVNSLLIREYKQVF  190

Query  435  EGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            EGLDS+VDVGGG G AAK I  AFP LKCTV +LPHV+ GLE
Sbjct  191  EGLDSIVDVGGGTGAAAKAIVSAFPGLKCTVLELPHVIAGLE  232


 Score = 87.8 bits (216),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            HKHG PM+L QLV+AL I+ +KS  + RLMR L HS FFV  + +      Y+L   S L
Sbjct  46   HKHGKPMSLDQLVDALSIDKSKSRCVYRLMRILTHSKFFVEEEEEEE--ARYSLTLASRL  103

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLKD PLS+ PF LA++DPIL +P H++
Sbjct  104  LLKDEPLSIAPFALAMMDPILIEPCHHV  131



>ref|XP_004490686.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=358

 Score =   114 bits (284),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S W  N DPT F T HGM  WD A +EPK N+ FN+AMASDARLV ++V++ C+ VF G
Sbjct  134  LSTWLTNGDPTAFETKHGMLFWDCAEREPKFNNLFNDAMASDARLVSSVVIEKCKEVFNG  193

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGGIGT AK +A +FP L+CTV DLPHVV GL+
Sbjct  194  LESIVDVGGGIGTMAKALAKSFPQLECTVLDLPHVVAGLQ  233


 Score = 70.9 bits (172),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPSI  178
            H +G P++L++L+  LPI+ +K+  + RLMR + HSGFF     T+   +  Y L   S+
Sbjct  46   HNYGKPISLSKLIPLLPIHPSKTIFIYRLMRIMTHSGFFSQQNITENELETEYMLTDTSL  105

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLL DNP+SV PF+ A+LDP+LT PWH +
Sbjct  106  LLLSDNPMSVAPFVHAMLDPVLTNPWHQL  134



>emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera]
Length=323

 Score =   125 bits (313),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T H    WDYAG EP+LN+ FNEAMASDARLV ++++K  + VFEG
Sbjct  99   LSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLKEGKGVFEG  158

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA+AFPHL CTV DLPHVV GL+
Sbjct  159  LNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQ  198


 Score = 59.7 bits (143),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  137  GSDDEGYALAPPSILLLKDNPLSVRPFLLAVLDPILTKPWH  259
            G ++EGY L   S LLL D+ LS+RP LLA+LDPILTKPWH
Sbjct  57   GEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPILTKPWH  97



>ref|XP_011091578.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=360

 Score = 97.4 bits (241),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITKTQGSD-DEGYALAPPS  175
            H+HGGPM+LT+LV+ALP ++  K+  + RLMR L+HSGFFV+ K   S+ +EGY+L   S
Sbjct  45   HQHGGPMSLTELVDALPGVDKTKADCVYRLMRILVHSGFFVLEKIDSSNYEEGYSLTSTS  104

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
             LL+ D+P S++P ++  L+PILT+PW  +
Sbjct  105  RLLVGDHPFSMKPLVICGLNPILTEPWRQL  134


 Score = 87.4 bits (215),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = +3

Query  261  ISEWFQN-DDPTPFYTVH-GMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVF  434
            +  W QN +D TPF+  + GM+ W+Y  + P+ +H  ++ MASD  LV  ++ + CR VF
Sbjct  134  LGRWLQNTEDHTPFHIANNGMSFWEYKERNPRFSHLLDQVMASDTPLVAGVITRDCRQVF  193

Query  435  EGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            EGLDS+VDVGGG GT AK+IA+ FP + CTV DL  VV GLE
Sbjct  194  EGLDSLVDVGGGTGTLAKVIAEGFPQIHCTVLDLAPVVAGLE  235



>ref|XP_011091583.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   102 bits (255),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSI  178
            HKHGGPMTL +LV+ALP ++ AK+  + RLMR L+HSGFFV+ K   S++E Y+L P S 
Sbjct  45   HKHGGPMTLLELVDALPGVDKAKADCMYRLMRILVHSGFFVLEKINSSNEEAYSLTPASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL+ D P+S++P++++ +DPIL +P H++
Sbjct  105  LLVGDLPMSMKPYVISQIDPILVEPMHHL  133


 Score = 82.0 bits (201),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 73/102 (72%), Gaps = 2/102 (2%)
 Frame = +3

Query  261  ISEWFQN-DDPTPFYTVH-GMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVF  434
            +S WFQN ++ TPF T++ GM+ W+   +  + +H F++ +ASD  +V +++ + CR VF
Sbjct  133  LSRWFQNANNHTPFQTINNGMSFWEQKERNLRFSHLFDQGVASDTPMVAHVITRDCRQVF  192

Query  435  EGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            EGLDS+VDVGGG GT AK IA+AFP + CTV DL  VV G++
Sbjct  193  EGLDSLVDVGGGTGTLAKAIAEAFPQIHCTVLDLAPVVAGMD  234



>emb|CDO96819.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   101 bits (252),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            ++EWF+NDDP+PF T HG   W YA  EP+    FNEAMA D+ L++ +V+  C+ VFE 
Sbjct  124  LTEWFKNDDPSPFDTAHGKNFWSYAAAEPQFGKIFNEAMAGDSSLIVEVVMTQCKSVFED  183

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVV  548
            L S+VDVGGG G   K IA  FP+L+C V DLPHVV
Sbjct  184  LTSLVDVGGGTGEFVKAIAQNFPNLECLVCDLPHVV  219


 Score = 83.2 bits (204),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 6/85 (7%)
 Frame = +2

Query  5    KHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSILL  184
            +HG P+TL+ L++ALPIN +KS H+ RLMR L ++GFFV        +EGY+L+    LL
Sbjct  44   QHGKPITLSGLISALPINPSKSIHIHRLMRFLSNAGFFV------RQNEGYSLSTTGRLL  97

Query  185  LKDNPLSVRPFLLAVLDPILTKPWH  259
            LK+ P ++R FL  V DPI  KPW+
Sbjct  98   LKNEPFNMRAFLYYVSDPIALKPWN  122



>emb|CBI21927.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   121 bits (303),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF+T HG T+WDY   EP+ N+ FNEAMASDARLV ++++K C+  FEG
Sbjct  51   VSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLIKECKGAFEG  110

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S VDVGGG GT AK I DAFPHL  TV DLPHVV  L+
Sbjct  111  LNSFVDVGGGTGTVAKTIVDAFPHLHSTVLDLPHVVADLQ  150


 Score = 63.2 bits (152),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  134  QGSDDEGYALAPPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            + +D+EGYALA  S LLLKD+PLS  PFLLA+LDP LT+PWH +
Sbjct  8    ESADEEGYALANASRLLLKDHPLSATPFLLAMLDPDLTEPWHYV  51



>gb|KJB84245.1| hypothetical protein B456_N013000 [Gossypium raimondii]
Length=233

 Score = 97.8 bits (242),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +  WFQNDD TPF T +G TLW Y   +P+L    N+ + SD++LV +++V  C+  FEG
Sbjct  105  LGTWFQNDDHTPFATAYGKTLWGYFTHDPQLKDLINDGLPSDSQLVTSVLVDKCKGAFEG  164

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IAD FP ++CTVFDLP++V GL+
Sbjct  165  LNSLVDVGGGTGTTAKAIADTFPLMECTVFDLPNIVAGLQ  204


 Score = 86.3 bits (212),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITKTQ-GSDDEGYALAPPS  175
            H HG PMT+T+LV AL  +N AK+  + RLMR L+HS FF   K    + +EGY L   S
Sbjct  16   HDHGKPMTITELVAALQMLNPAKACDIYRLMRILVHSAFFARQKLDTDAQEEGYVLTNSS  75

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPW  256
             +LLK+NP  V P L A +DPI+TKPW
Sbjct  76   RILLKNNPFCVTPTLKATMDPIITKPW  102



>ref|XP_006377432.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP55229.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=372

 Score = 97.4 bits (241),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +3

Query  258  TISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            ++ +WF+  +PT F   +GM  W+Y  + P+LN  FN AMA D+++ MN+V++ C+ +FE
Sbjct  148  SLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNGLFNAAMACDSQM-MNLVIRDCKPIFE  206

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GLDS+VDVGGG G+ A+II++ FPH+ CTV ++P V+  LE
Sbjct  207  GLDSMVDVGGGTGSLARIISETFPHMNCTVLEIPQVIANLE  247


 Score = 86.7 bits (213),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 60/91 (66%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKT---QGSDDEGYALAPP  172
            H HG P+TL +LV+AL I   KS+ + RLMR L+HSGFF  TK    QG  +E Y L PP
Sbjct  60   HNHGRPITLPELVSALHIPPNKSSCIYRLMRMLVHSGFFATTKAVIGQGGGEEAYVLTPP  119

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            S LL+KDN   + PF +++++P    PWH++
Sbjct  120  SQLLVKDNTNCLSPF-MSLINPAFVTPWHSL  149



>ref|XP_006388573.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
 gb|ERP47487.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
Length=359

 Score =   104 bits (260),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WF+NDD   F   H  TLW+YAG++ +LN+ FN+AMASD+ L   +VV  C+ +F+G
Sbjct  133  LSTWFRNDDRNAFSVAHEKTLWEYAGQDARLNNLFNDAMASDSILASKLVVSKCKGIFDG  192

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            ++S+VDVGGG+GT AK IA+AFPH+ CTVFDLPHVV  L+
Sbjct  193  VNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQ  232


 Score = 79.0 bits (193),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE-GYALAPPSI  178
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+HSGFF      G  ++  Y+L   + 
Sbjct  45   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHSGFFSQQNLNGIHNQVAYSLTQSTR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPW  256
            LLLKDNP SVRP LL VLDP+LTKPW
Sbjct  105  LLLKDNPWSVRPLLLLVLDPVLTKPW  130



>ref|XP_010260367.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nelumbo 
nucifera]
Length=366

 Score = 94.4 bits (233),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +3

Query  261  ISEWFQ-NDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +S WFQ N   TPF   +G   W+Y   +P+ N+ FN AMA+DARLVM++V++ C   F+
Sbjct  141  LSAWFQGNGLATPFEATNGRAFWNYGAHDPEYNNLFNVAMANDARLVMSVVLRECEATFQ  200

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGL  557
            GL S+VDVGGG G AA  IAD FP LKC VFDLPHVV  L
Sbjct  201  GLGSLVDVGGGTGAAAMAIADKFPQLKCIVFDLPHVVGNL  240


 Score = 89.0 bits (219),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGS------DDEGYAL  163
            H HG PM L++LV AL +  +++  L RLMR L+HSGFF + +          +++GY L
Sbjct  48   HSHGKPMLLSELVLALGVPQSRTACLHRLMRMLVHSGFFSMHRVYKDPEEEEEEEKGYVL  107

Query  164  APPSILLLKDNPLSVRPFLLAVLDPILTKPWH  259
             P S LLLKDNPL+V  FL+A+LDP+L  PWH
Sbjct  108  TPSSRLLLKDNPLNVSQFLIAMLDPVLVTPWH  139



>ref|XP_006388574.1| hypothetical protein POPTR_0151s00220g [Populus trichocarpa]
 gb|ERP47488.1| hypothetical protein POPTR_0151s00220g [Populus trichocarpa]
Length=326

 Score =   112 bits (279),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  252  HGTISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVV  431
            H  +S WFQND+ T F   H  TLW+YAG++P+L++ FNEAMASD+ L   +V+  C+ +
Sbjct  97   HDCLSTWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDSILASKLVLNQCKGI  156

Query  432  FEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            F+G+DS+VDVG G+GT  K IA+AFPH+ CTVFDLPHVV  L+
Sbjct  157  FDGVDSLVDVGVGLGTMTKGIAEAFPHMDCTVFDLPHVVSDLQ  199


 Score = 71.2 bits (173),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 63/84 (75%), Gaps = 3/84 (4%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+HSGFF     Q  + E Y+L   + L
Sbjct  16   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHSGFF---SQQNLNQEAYSLTQSTRL  72

Query  182  LLKDNPLSVRPFLLAVLDPILTKP  253
            LLKDNPLS+RP LL +LDP+LTKP
Sbjct  73   LLKDNPLSMRPLLLMLLDPVLTKP  96



>emb|CDP21582.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   103 bits (257),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPSI  178
            HKH  PMTL +L NALPI NAK+  + RLMR LIHSGFF+  K +Q  ++EGY L   S 
Sbjct  63   HKHCKPMTLDELTNALPIGNAKAPFVYRLMRILIHSGFFIEAKISQHDEEEGYMLTSSSK  122

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLLKD PLS+  FLL++LDP L  PW+++
Sbjct  123  LLLKDEPLSLTAFLLSMLDPTLMDPWYHL  151


 Score = 79.7 bits (195),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +3

Query  261  ISEWFQN-DDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +S+WFQN  D  PF T HG   W+ AG++ KLN+ FNE MASD+RLV +++++ C+ VF 
Sbjct  151  LSQWFQNYSDVNPFKTCHGKVAWELAGQDQKLNNFFNEGMASDSRLVGSILIRDCKDVFS  210

Query  438  GLDSVVDV  461
            GL+S+VDV
Sbjct  211  GLNSLVDV  218



>ref|XP_010093978.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXB54965.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=364

 Score =   105 bits (261),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S W QN DPTPF  VHG T WD  G EP+L + F EAMA+D++L++ ++V+ C+ VFEG
Sbjct  140  VSTWLQNSDPTPFEMVHGKTFWDGVGDEPRLKYLFTEAMATDSQLMVKVIVEECKQVFEG  199

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVV  548
            L S+VDVGGG G  AK IA  FP++ CTV DLP+VV
Sbjct  200  LTSLVDVGGGTGIVAKAIAKTFPNIMCTVLDLPYVV  235


 Score = 77.8 bits (190),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 56/94 (60%), Gaps = 8/94 (9%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDD--------EGY  157
            + HG P+TL++L+++LPI+++K+  + RLMR L+HSGFF   K     D        E Y
Sbjct  45   NNHGQPITLSKLISSLPIHSSKAHCIYRLMRILVHSGFFATQKVDNKIDEGEEEEEEEAY  104

Query  158  ALAPPSILLLKDNPLSVRPFLLAVLDPILTKPWH  259
            +L   S LLLKD P    PF L  L+P L  PWH
Sbjct  105  SLTIASRLLLKDGPWRATPFFLVQLEPHLMTPWH  138



>emb|CDO96828.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   102 bits (255),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            ++EWF+NDDP+PF T HG   W YA  EP+    FNEAMA D+ L++ +VV  C+ VFE 
Sbjct  124  LTEWFKNDDPSPFDTAHGKNFWSYAAAEPQFGKIFNEAMAGDSSLIVEVVVTQCKSVFED  183

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVV  548
            L S+VDVGGG G  AK I   FP+L+C V DLPHVV
Sbjct  184  LTSLVDVGGGTGEFAKAIVQNFPNLECLVCDLPHVV  219


 Score = 79.3 bits (194),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 6/85 (7%)
 Frame = +2

Query  5    KHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSILL  184
            +HG P+ L+ L++ LPIN +KS H+ RLMR L ++GFFV        +EGY+L+    LL
Sbjct  44   QHGKPIMLSGLISTLPINPSKSIHIHRLMRFLSNAGFFV------QQNEGYSLSTAGRLL  97

Query  185  LKDNPLSVRPFLLAVLDPILTKPWH  259
            LK+ P ++R F+  V DPI  KPW+
Sbjct  98   LKNEPFNMRAFIYYVSDPIALKPWN  122



>ref|XP_002517832.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44350.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score = 99.8 bits (247),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  WFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGLDS  449
            + +NDDPT F T  G TL+ YAG E ++NH FNE MASD+ ++   V+  C+ VFEG++S
Sbjct  136  FLRNDDPTAFVTAFGETLFGYAGNEARINHLFNECMASDSSVIGRAVIIKCKKVFEGVNS  195

Query  450  VVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +VDVGGG G  AK I   FP+LKCTV DLPHVV  L+
Sbjct  196  LVDVGGGTGNMAKAIGQTFPNLKCTVLDLPHVVDKLQ  232


 Score = 82.0 bits (201),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGS-DDEGYALAPPSI  178
            + HG PMTL++LV  L ++  K+ HL RLMR L+HSGFF +     +   EGY L P S 
Sbjct  45   NSHGQPMTLSELVLTLQVHPTKTDHLYRLMRVLVHSGFFNLQNASDNHSQEGYILTPASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLLKD     RPF+   LDP+ T+P++
Sbjct  105  LLLKDCSFDTRPFISLALDPVATEPYN  131



>ref|XP_006388414.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP47328.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=354

 Score =   110 bits (274),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  252  HGTISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVV  431
            H  +S WFQND+ T F   H  TLW+YAG++P+L++ FNEAMASD+ L   +V+  C+ +
Sbjct  126  HDCLSTWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDSILASKLVLSQCKGI  185

Query  432  FEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            F+G+DS+VDVGGG GT AK IA+AFPH+ CTVFDLP VV  L+
Sbjct  186  FDGVDSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQ  228


 Score = 71.6 bits (174),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 63/84 (75%), Gaps = 3/84 (4%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+HSGFF     Q  + E Y+L   + L
Sbjct  45   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHSGFF---SQQNLNQEAYSLTQSTRL  101

Query  182  LLKDNPLSVRPFLLAVLDPILTKP  253
            LLKDNPLS+RP LL +LDP+LTKP
Sbjct  102  LLKDNPLSMRPLLLMLLDPVLTKP  125



>gb|KJB73395.1| hypothetical protein B456_011G230900 [Gossypium raimondii]
Length=325

 Score = 96.3 bits (238),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDD TPF T +  TLWDY   +P+L    N+ +ASD++LV N+ +  C+  FEG
Sbjct  105  LSTWFQNDDHTPFATTYEETLWDYFAHDPQLQDLINDGLASDSQLVTNVFIDKCKEAFEG  164

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L S+VDVGGG GT AK IAD FP +  TVFDLP++V GL+
Sbjct  165  LISLVDVGGGTGTTAKAIADTFPDMVSTVFDLPNIVAGLQ  204


 Score = 85.1 bits (209),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPS  175
              HG PMT+T+LV ALP +N  K+  + R+MR L+HSG F   K    + +EGY L   S
Sbjct  16   QNHGKPMTITELVVALPMLNPTKACDIYRIMRILVHSGIFARQKLYNDAQEEGYVLTNSS  75

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPW  256
             +LLKDNP  + P L A +DP++TKPW
Sbjct  76   RILLKDNPFCITPTLNATMDPVITKPW  102



>emb|CAN73270.1| hypothetical protein VITISV_021918 [Vitis vinifera]
Length=328

 Score =   100 bits (248),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGS-DDEGYALAPPSI  178
            H HG PMTL++LV  LP+N  K+  + RLMR L+ SGFF   + Q S  +EGY L   S 
Sbjct  45   HNHGKPMTLSELVAELPVNPEKTKCVYRLMRLLVQSGFFTRKRVQESGQEEGYVLTHASR  104

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWH  259
            LLLKD+PLS RPFLLA+LDP+L  PW 
Sbjct  105  LLLKDDPLSARPFLLAMLDPVLITPWQ  131


 Score = 80.9 bits (198),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 6/82 (7%)
 Frame = +3

Query  315  MTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGLDSVVDVgggigtaakii  494
            +T W Y      LN+ FNEAMASDARLV ++++K C+ +F GL+S+VDVGGG GT A+ I
Sbjct  127  ITPWQY------LNNFFNEAMASDARLVTSVLIKDCKGIFVGLNSLVDVGGGTGTVARAI  180

Query  495  adaFPHLKCTVFDLPHVVHGLE  560
            A+AFPHL CTV DLPHVV GLE
Sbjct  181  ANAFPHLNCTVLDLPHVVAGLE  202



>ref|XP_011037440.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
 ref|XP_011037441.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   110 bits (275),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  252  HGTISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVV  431
            H  +S WFQND+ T F   H  TLW+YAG++P+L++ FNEAMASD+ L   +VV  C+ +
Sbjct  126  HDCLSTWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDSILASKLVVSKCQGI  185

Query  432  FEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            FEG++S+VDVGGG GT AK IA+AFPH+ CTVFDLP VV  L+
Sbjct  186  FEGVNSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQ  228


 Score = 70.1 bits (170),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 63/84 (75%), Gaps = 3/84 (4%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
             KHG PMTL++LV+ALPI+ +K+ ++ RLMR L+H+GFF     Q  + E Y+L   + L
Sbjct  45   QKHGKPMTLSELVSALPIHPSKAQYVHRLMRILVHAGFF---SQQNLNQEAYSLTQSTRL  101

Query  182  LLKDNPLSVRPFLLAVLDPILTKP  253
            LLKDNPLS+RP LL +LDP+LTKP
Sbjct  102  LLKDNPLSMRPLLLMLLDPVLTKP  125



>gb|KHN07781.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=355

 Score = 99.0 bits (245),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S W  ++D TPF T +G+T +DYA ++PK  H +N+AMA D R   ++V++  + VFEGL
Sbjct  135  STWLTSEDRTPFQTENGVTYFDYAKRDPKFGHFYNDAMAKDTRFASSVVIENYKEVFEGL  194

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
             S+VDVGGGIGT AK IA AFP +KCTVFDLPHVV GL+
Sbjct  195  KSIVDVGGGIGTMAKAIAKAFPQVKCTVFDLPHVVDGLQ  233


 Score = 80.9 bits (198),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE--GYALAPPS  175
            HK+G PM L+QL+ +LPI+ +K+ ++ RLMR L HSGFF       ++ E   Y L   S
Sbjct  45   HKYGQPMPLSQLIASLPIHPSKTCYIHRLMRLLTHSGFFSRHDLVENEQEVITYELTDAS  104

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPW  256
             LLLKD+P S+RP LL  LDP + K W
Sbjct  105  RLLLKDHPFSLRPLLLVTLDPSVIKSW  131



>ref|XP_011001214.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=373

 Score = 97.8 bits (242),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +3

Query  258  TISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            ++ +WF+  +PT F   +GM  W+Y  + P+LN  FN AMA D+++ MN+V++ C+ +FE
Sbjct  149  SLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNCLFNAAMACDSQM-MNLVIRDCKPIFE  207

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GLDS+VDVGGG G+ A+II++ FPH+KCTV + P V+  LE
Sbjct  208  GLDSMVDVGGGTGSLARIISETFPHMKCTVLETPQVIANLE  248


 Score = 82.4 bits (202),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 61/92 (66%), Gaps = 5/92 (5%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKT---QGS-DDEGYALAP  169
            H HG P+TL +LV+AL I   K++ + RLMR L+HSGFF  T+    QG  ++E Y L P
Sbjct  60   HNHGSPITLPELVSALHIPPNKTSCIYRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTP  119

Query  170  PSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            PS LL+KDN   + PF +++++P    PWH++
Sbjct  120  PSQLLVKDNTNCLSPF-MSLINPAFVTPWHSL  150



>ref|XP_002522501.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39801.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score = 95.5 bits (236),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 75/100 (75%), Gaps = 1/100 (1%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            + +WF+ ++ T F   HGM  W+Y  + P+ N  FNEAMASD+R+ MN+V++ C+ +FEG
Sbjct  135  LGDWFRGNELTVFQRAHGMAFWEYNERNPEFNQLFNEAMASDSRM-MNLVIRDCKPIFEG  193

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            ++S+VDVGGG G+ A+II++AFP +KCTV +LP V+  LE
Sbjct  194  VNSLVDVGGGNGSLARIISEAFPDMKCTVLELPQVIGNLE  233


 Score = 84.3 bits (207),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 57/89 (64%), Gaps = 3/89 (3%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEG---YALAPP  172
            HKHG P+TL +LV+AL I+  K   + RLMR L+HSGFF ITK     +EG   Y L P 
Sbjct  45   HKHGKPITLPELVSALHIHPTKINFMYRLMRMLVHSGFFSITKAANGQEEGQEVYVLTPS  104

Query  173  SILLLKDNPLSVRPFLLAVLDPILTKPWH  259
            S LL+KDNP  ++PF+ ++L P    P H
Sbjct  105  SKLLVKDNPNCLKPFVDSLLKPDFVTPGH  133



>gb|ACU19152.1| unknown [Glycine max]
Length=282

 Score =   123 bits (309),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S WF+N DPTPF T HGM LWDYAG +PKLN+ FN+AMASDAR V ++V++ C+ VF GL
Sbjct  59   STWFKNGDPTPFETAHGMMLWDYAGADPKLNNLFNDAMASDARFVTSLVIEKCKGVFMGL  118

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            +S+VDVGGG GT AK IA +FP ++C VFDLPHVV GL+
Sbjct  119  ESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLK  157


 Score = 56.2 bits (134),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = +2

Query  98   LIHSGFFVITK--TQGSDDEGYALAPPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            +IHSGFF   K   +   +  Y L   S+LLLK++P+SV PFL A+LDP+LT PW+  
Sbjct  1    MIHSGFFSQQKHDLENELEAKYVLTDASVLLLKNHPMSVAPFLHAMLDPVLTNPWNQF  58



>sp|Q6VMW0.1|Q8OMT_MENPI RecName: Full=8-hydroxyquercetin 8-O-methyltransferase; AltName: 
Full=Flavonol 8-O-methyltransferase [Mentha x piperita]
 gb|AAR09600.1| flavonoid 8-O-methyltransferase [Mentha x piperita]
Length=366

 Score = 89.7 bits (221),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 8/96 (8%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFF--------VITKTQGSDDEGY  157
            HKHG P+TL+QL +AL IN AKS  L RLMR L+HSGFF        V  + +  +++ Y
Sbjct  46   HKHGNPITLSQLADALNINKAKSHGLFRLMRILVHSGFFDKVKVKVKVEGEDEEEEEDAY  105

Query  158  ALAPPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            +L P S LLL+  PLSV PF LA+ DP+ T+ WH++
Sbjct  106  SLTPASRLLLRSEPLSVAPFALAMSDPVYTETWHHL  141


 Score = 89.7 bits (221),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +SEWF+ND    F T +GMT  +YA  + +LN  FNEAMA DA  V +++   CR +F+G
Sbjct  141  LSEWFRNDAVAAFDTKYGMTFPEYAVADDRLNVLFNEAMACDAGFVNSILTTECREIFDG  200

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG G  AK IA AFP ++CTV DLP+VV GL+
Sbjct  201  LESMVDVGGGTGATAKGIAAAFPGMECTVLDLPNVVGGLK  240



>emb|CBI21925.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   121 bits (303),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEG  440
            +S WFQNDDPTPF T H    WDYA  EP+LN+ FNEAMASDARLV ++++K  + VFEG
Sbjct  56   VSAWFQNDDPTPFQTAHERPFWDYAAHEPQLNNFFNEAMASDARLVTSVLLKEGKGVFEG  115

Query  441  LDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            L+S+VDVGGG GT AK IA+AFPHL CTV DLPH+V GL+
Sbjct  116  LNSLVDVGGGTGTLAKAIANAFPHLNCTVLDLPHMVAGLQ  155


 Score = 58.2 bits (139),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  137  GSDDEGYALAPPSILLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            G ++EGY L   S LLL ++ LS+RP LLA LDPILTKPWH +
Sbjct  14   GEEEEGYVLTDASRLLLMNDSLSIRPLLLATLDPILTKPWHYV  56



>ref|XP_003607523.1| O-methyltransferase [Medicago truncatula]
Length=370

 Score =   106 bits (264),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVH-GMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +S W++NDDP+PF+T + G+  WDYAG +P  N+ FNEAMA + RL  ++V+  C+ VFE
Sbjct  144  LSNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVMGKCKGVFE  203

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL+S+VDVGGGIGT  K+IA +FP+++C VFDLPHVV GL+
Sbjct  204  GLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQ  244


 Score = 72.8 bits (177),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            H +G P+ L++L++ LPI+ +K+  + RLMR L HSGFF ++K     +  Y L   S L
Sbjct  59   HNYGQPIPLSKLISLLPIHPSKTGDIHRLMRVLTHSGFFNVSKNDL--EVMYELNDASRL  116

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLKD+P S+   L  +L PIL+KPW+ +
Sbjct  117  LLKDHPFSMTSLLHVILGPILSKPWYQL  144



>ref|XP_006582298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=355

 Score = 99.0 bits (245),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  264  SEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFEGL  443
            S W  ++D TPF T +G+T +DYA ++PK  H +N+AMA D R   ++V++  + VFEGL
Sbjct  135  STWLTSEDRTPFQTENGVTYFDYAKRDPKFGHFYNDAMAKDTRFASSVVIENYKEVFEGL  194

Query  444  DSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
             S+VDVGGGIGT AK IA AFP +KCTVFDLPHVV GL+
Sbjct  195  KSIVDVGGGIGTMAKAIAKAFPQVKCTVFDLPHVVDGLQ  233


 Score = 79.7 bits (195),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDE--GYALAPPS  175
            HK+G PM L+QL+ +LPI+ +K+ ++ RLMR   HSGFF       ++ E   Y L   S
Sbjct  45   HKYGQPMPLSQLIASLPIHPSKTCYIHRLMRLFTHSGFFSRHDLVENEQEVITYELTDAS  104

Query  176  ILLLKDNPLSVRPFLLAVLDPILTKPW  256
             LLLKD+P S+RP LL  LDP + K W
Sbjct  105  RLLLKDHPFSLRPLLLVTLDPSVIKSW  131



>gb|AES89720.2| orcinol O-methyltransferase [Medicago truncatula]
Length=355

 Score =   106 bits (264),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = +3

Query  261  ISEWFQNDDPTPFYTVH-GMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
            +S W++NDDP+PF+T + G+  WDYAG +P  N+ FNEAMA + RL  ++V+  C+ VFE
Sbjct  130  LSNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVMGKCKGVFE  189

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            GL+S+VDVGGGIGT  K+IA +FP+++C VFDLPHVV GL+
Sbjct  190  GLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQ  230


 Score = 72.4 bits (176),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSIL  181
            H +G P+ L++L++ LPI+ +K+  + RLMR L HSGFF ++K     +  Y L   S L
Sbjct  45   HNYGQPIPLSKLISLLPIHPSKTGDIHRLMRVLTHSGFFNVSKNDL--EVMYELNDASRL  102

Query  182  LLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLKD+P S+   L  +L PIL+KPW+ +
Sbjct  103  LLKDHPFSMTSLLHVILGPILSKPWYQL  130



>dbj|BAJ05384.1| O-methyltransferase [Carapichea ipecacuanha]
 dbj|BAJ05385.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   104 bits (260),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  258  TISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
             +SEWFQNDD TPF T HG + WDY  ++P+    F+EAMA D+ L+  ++V   + VFE
Sbjct  125  ALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVTEFKYVFE  184

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVV  548
            GL S+VDVGG  GT A+ IA AFP+LKCTVFDLP  V
Sbjct  185  GLKSLVDVGGANGTLARSIAKAFPNLKCTVFDLPEAV  221


 Score = 73.2 bits (178),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = +2

Query  5    KHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSILL  184
            +HG PM L++L +ALPIN +K+ ++ RLMR L+ +G+F        ++E + L P  +LL
Sbjct  46   QHGKPMNLSELTSALPINPSKAPYIHRLMRMLVKAGYF------AQENECFDLTPIGLLL  99

Query  185  LKDNPLSVRPFLLAVLDPILTKPW  256
            LKD+P+++R  +L  L P L  PW
Sbjct  100  LKDDPINIRALVLLELHPALLMPW  123



>ref|XP_002517833.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44351.1| o-methyltransferase, putative [Ricinus communis]
Length=372

 Score = 95.5 bits (236),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = +3

Query  246  QSHGTISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCR  425
            + + +++ + +NDD TPF T    TLW  AG E ++NH  N+ MASD+ ++   V+  C+
Sbjct  143  EPYNSLTSFLRNDDLTPFVTAFKDTLWGCAGNEARINHLVNDCMASDSSVIGRAVIIKCK  202

Query  426  VVFEGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
             VFEGL+S+VDVGGG G  AK IA  FP+LKCTV DLPHVV  L+
Sbjct  203  EVFEGLNSLVDVGGGTGNMAKAIAQTFPNLKCTVLDLPHVVDKLQ  247


 Score = 82.0 bits (201),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITK-TQGSDDEGYALAPPSI  178
            + HG PMTL++LV AL +   K+ HL RLMR L+ SGFF +   +     EGY L P S 
Sbjct  60   NSHGQPMTLSELVLALQVRPTKTHHLYRLMRVLVRSGFFNLQNASDNYSQEGYILTPASR  119

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LLL+++    RPF+  VLDPI+T+P++++
Sbjct  120  LLLQNSSFDTRPFISLVLDPIITEPYNSL  148



>dbj|BAI79244.1| O-methyltransferase [Carapichea ipecacuanha]
 dbj|BAJ05386.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   104 bits (259),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  258  TISEWFQNDDPTPFYTVHGMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVFE  437
             +SEWFQNDD TPF T HG + WDY  ++P+    F+EAMA D+ L+  ++V   + VFE
Sbjct  125  ALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVTEFKYVFE  184

Query  438  GLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVV  548
            GL S+VDVGGG GT A+ IA AFP+LKCTVFDLP  V
Sbjct  185  GLKSLVDVGGGNGTLARSIAKAFPNLKCTVFDLPEAV  221


 Score = 73.2 bits (178),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = +2

Query  5    KHGGPMTLTQLVNALPINNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSILL  184
            +HG PM L++L +ALPIN +K+ ++ RLMR L+ +G+F        ++E + L P  +LL
Sbjct  46   QHGKPMNLSELTSALPINPSKAPYIHRLMRMLVKAGYF------AQENECFDLTPIGLLL  99

Query  185  LKDNPLSVRPFLLAVLDPILTKPW  256
            LKD+P+++R  +L  L P L  PW
Sbjct  100  LKDDPINIRALVLLELHPALLMPW  123



>ref|XP_011091736.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=560

 Score =   100 bits (248),  Expect(2) = 6e-36, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    HKHGGPMTLTQLVNALP-INNAKSTHLARLMRTLIHSGFFVITKTQGSDDEGYALAPPSI  178
            HKHG PMTLT+LV+ALP  +  K+  + RLMR L+HSGFFV+ K    + E Y+L P S 
Sbjct  246  HKHGRPMTLTELVDALPGADKPKADCVYRLMRILVHSGFFVLEKIDSCNKEAYSLTPASR  305

Query  179  LLLKDNPLSVRPFLLAVLDPILTKPWHNI  265
            LL+ D+ +S++ ++L+ LDPILT+PW ++
Sbjct  306  LLIGDHTMSMKAYVLSQLDPILTEPWQHL  334


 Score = 77.4 bits (189),  Expect(2) = 6e-36, Method: Composition-based stats.
 Identities = 47/102 (46%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = +3

Query  261  ISEWFQNDD-PTPFYTVH-GMTLWDYAGKEPKLNHNFNEAMASDARLVMNMVVKYCRVVF  434
            +S WFQN +  T F+T + G ++W+   + P+ +H F++ MA D  +V + + + CR VF
Sbjct  334  LSRWFQNTEYHTAFHTANNGTSIWEQKERNPRFSHLFDQGMACDTPMVADAITRDCRQVF  393

Query  435  EGLDSVVDVgggigtaakiiadaFPHLKCTVFDLPHVVHGLE  560
            EGLDS+VDVGGG GT AK IA+AFP + C V +L  V+ GL+
Sbjct  394  EGLDSIVDVGGGTGTLAKAIAEAFPQIHCLVLELAPVIAGLQ  435



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840