BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G24

Length=497
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629502.1|  PREDICTED: vesicle-associated protein 1-1-like   61.6    2e-08   
ref|XP_009759405.1|  PREDICTED: vesicle-associated protein 2-2-like   59.7    1e-07   Nicotiana sylvestris
gb|KCW61698.1|  hypothetical protein EUGRSUZ_H04422                   56.2    1e-06   Eucalyptus grandis [rose gum]
ref|XP_004230148.1|  PREDICTED: vesicle-associated protein 1-2-like   56.2    1e-06   Solanum lycopersicum
gb|KCW61699.1|  hypothetical protein EUGRSUZ_H04422                   56.6    1e-06   Eucalyptus grandis [rose gum]
ref|XP_008223096.1|  PREDICTED: vesicle-associated protein 2-2-like   56.2    2e-06   Prunus mume [ume]
ref|XP_010025111.1|  PREDICTED: vesicle-associated protein 2-2-like   56.2    2e-06   Eucalyptus grandis [rose gum]
gb|KCW61701.1|  hypothetical protein EUGRSUZ_H04422                   56.2    2e-06   Eucalyptus grandis [rose gum]
ref|XP_006347836.1|  PREDICTED: vesicle-associated protein 2-2-like   55.5    3e-06   Solanum tuberosum [potatoes]
ref|XP_006489164.1|  PREDICTED: vesicle-associated protein 2-2-li...  54.7    5e-06   Citrus sinensis [apfelsine]
ref|XP_010027215.1|  PREDICTED: vesicle-associated protein 2-2-like   54.7    5e-06   Eucalyptus grandis [rose gum]
ref|XP_010667442.1|  PREDICTED: vesicle-associated protein 2-2-li...  54.7    5e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006419683.1|  hypothetical protein CICLE_v10005219mg           54.7    5e-06   Citrus clementina [clementine]
ref|XP_010667444.1|  PREDICTED: vesicle-associated protein 2-2-li...  54.7    5e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008390733.1|  PREDICTED: vesicle-associated protein 2-2-like   54.7    6e-06   Malus domestica [apple tree]
ref|XP_006489166.1|  PREDICTED: vesicle-associated protein 2-2-li...  54.7    6e-06   Citrus sinensis [apfelsine]
ref|XP_006419682.1|  hypothetical protein CICLE_v10005219mg           54.7    6e-06   Citrus clementina [clementine]
ref|XP_006419684.1|  hypothetical protein CICLE_v10005219mg           54.7    6e-06   
ref|XP_004971199.1|  PREDICTED: vesicle-associated protein 2-2-li...  54.7    6e-06   Setaria italica
ref|XP_006489165.1|  PREDICTED: vesicle-associated protein 2-2-li...  54.7    6e-06   
ref|XP_006419686.1|  hypothetical protein CICLE_v10005219mg           54.3    7e-06   
gb|KDP40029.1|  hypothetical protein JCGZ_02027                       54.3    7e-06   Jatropha curcas
ref|XP_004971198.1|  PREDICTED: vesicle-associated protein 2-2-li...  54.3    7e-06   
ref|XP_010245359.1|  PREDICTED: vesicle-associated protein 1-1-like   53.9    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010040745.1|  PREDICTED: vesicle-associated protein 2-2-like   53.9    1e-05   Eucalyptus grandis [rose gum]
ref|XP_006645299.1|  PREDICTED: vesicle-associated protein 1-3-like   53.9    1e-05   Oryza brachyantha
ref|XP_004296788.1|  PREDICTED: vesicle-associated protein 2-2-like   53.5    1e-05   Fragaria vesca subsp. vesca
ref|XP_009352199.1|  PREDICTED: vesicle-associated protein 2-2-like   53.5    1e-05   Pyrus x bretschneideri [bai li]
ref|NP_001045329.1|  Os01g0936800                                     53.5    1e-05   
ref|XP_002277190.1|  PREDICTED: vesicle-associated protein 1-2        52.4    3e-05   Vitis vinifera
ref|XP_010053915.1|  PREDICTED: vesicle-associated protein 1-3 is...  52.0    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010053916.1|  PREDICTED: vesicle-associated protein 1-3 is...  52.0    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010921728.1|  PREDICTED: vesicle-associated protein 1-2-like   52.4    3e-05   Elaeis guineensis
gb|KDP23596.1|  hypothetical protein JCGZ_23429                       52.4    3e-05   Jatropha curcas
ref|XP_008353239.1|  PREDICTED: vesicle-associated protein 2-2-like   52.0    4e-05   
ref|XP_002459063.1|  hypothetical protein SORBIDRAFT_03g045240        52.0    4e-05   Sorghum bicolor [broomcorn]
ref|XP_008794811.1|  PREDICTED: vesicle-associated protein 1-3 is...  51.2    5e-05   Phoenix dactylifera
ref|XP_008794810.1|  PREDICTED: vesicle-associated protein 1-3 is...  51.2    5e-05   Phoenix dactylifera
ref|XP_007222950.1|  hypothetical protein PRUPE_ppa008888mg           51.6    5e-05   
ref|XP_007035462.1|  Vesicle-associated membrane protein, putativ...  51.6    6e-05   Theobroma cacao [chocolate]
ref|XP_006855403.1|  hypothetical protein AMTR_s00057p00149330        51.2    6e-05   Amborella trichopoda
ref|XP_007222951.1|  hypothetical protein PRUPE_ppa008888mg           51.6    6e-05   Prunus persica
ref|XP_007035463.1|  Vesicle-associated membrane protein, putativ...  51.2    6e-05   
ref|XP_009369098.1|  PREDICTED: vesicle-associated protein 2-2-like   51.2    8e-05   Pyrus x bretschneideri [bai li]
ref|XP_011017464.1|  PREDICTED: vesicle-associated protein 1-3        50.8    9e-05   Populus euphratica
gb|EMT18973.1|  hypothetical protein F775_07960                       50.4    1e-04   
emb|CDP18378.1|  unnamed protein product                              50.4    1e-04   Coffea canephora [robusta coffee]
ref|XP_011469169.1|  PREDICTED: vesicle-associated protein 1-3 is...  49.7    1e-04   Fragaria vesca subsp. vesca
ref|XP_010241107.1|  PREDICTED: vesicle-associated protein 1-3-like   50.4    1e-04   
ref|XP_002266266.1|  PREDICTED: vesicle-associated protein 2-2        50.4    1e-04   Vitis vinifera
ref|NP_001136938.1|  uncharacterized protein LOC100217097             50.4    1e-04   Zea mays [maize]
gb|KJB72572.1|  hypothetical protein B456_011G185500                  50.4    1e-04   Gossypium raimondii
gb|ACG39854.1|  VAP27-2                                               50.4    1e-04   Zea mays [maize]
ref|XP_008808742.1|  PREDICTED: vesicle-associated protein 1-3-like   50.1    2e-04   Phoenix dactylifera
gb|KJB72569.1|  hypothetical protein B456_011G185500                  50.4    2e-04   Gossypium raimondii
ref|XP_002302522.1|  hypothetical protein POPTR_0002s14560g           50.1    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_004306946.1|  PREDICTED: vesicle-associated protein 1-3 is...  50.1    2e-04   Fragaria vesca subsp. vesca
gb|KJB72571.1|  hypothetical protein B456_011G185500                  50.1    2e-04   Gossypium raimondii
ref|XP_008388615.1|  PREDICTED: vesicle-associated protein 2-2        50.1    2e-04   
gb|KHG16837.1|  Vesicle-associated 2-2 -like protein                  50.1    2e-04   Gossypium arboreum [tree cotton]
ref|XP_010105013.1|  Vesicle-associated protein 2-2                   49.7    2e-04   
gb|KGN57064.1|  hypothetical protein Csa_3G151410                     49.7    3e-04   Cucumis sativus [cucumbers]
ref|XP_004962276.1|  PREDICTED: vesicle-associated membrane prote...  49.7    3e-04   Setaria italica
ref|XP_004134182.1|  PREDICTED: vesicle-associated protein 2-2-like   49.3    3e-04   Cucumis sativus [cucumbers]
ref|XP_004962275.1|  PREDICTED: vesicle-associated membrane prote...  49.7    3e-04   Setaria italica
ref|XP_009373916.1|  PREDICTED: vesicle-associated protein 2-2-like   49.3    4e-04   Pyrus x bretschneideri [bai li]
ref|XP_007218293.1|  hypothetical protein PRUPE_ppa010720mg           48.9    4e-04   Prunus persica
ref|XP_008438789.1|  PREDICTED: vesicle-associated protein 2-2-like   49.3    4e-04   Cucumis melo [Oriental melon]
gb|KDP28788.1|  hypothetical protein JCGZ_14559                       48.9    4e-04   Jatropha curcas
ref|XP_010941129.1|  PREDICTED: vesicle-associated protein 1-3        48.9    4e-04   Elaeis guineensis
ref|XP_008803084.1|  PREDICTED: vesicle-associated protein 1-2-li...  48.9    4e-04   Phoenix dactylifera
emb|CDO98923.1|  unnamed protein product                              48.9    4e-04   Coffea canephora [robusta coffee]
ref|XP_002280265.1|  PREDICTED: vesicle-associated protein 1-3        48.5    5e-04   Vitis vinifera
emb|CAN69799.1|  hypothetical protein VITISV_011904                   48.5    5e-04   Vitis vinifera
ref|XP_011032542.1|  PREDICTED: vesicle-associated protein 2-2-li...  48.9    6e-04   Populus euphratica
ref|XP_011032543.1|  PREDICTED: vesicle-associated protein 1-1-li...  48.9    6e-04   Populus euphratica
ref|XP_010264233.1|  PREDICTED: vesicle-associated protein 1-3-like   48.5    6e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010024551.1|  PREDICTED: vesicle-associated protein 2-2-li...  48.5    6e-04   
ref|XP_010024553.1|  PREDICTED: vesicle-associated protein 2-2-li...  48.5    6e-04   
ref|XP_002319045.1|  VAMP/SYNAPTOBREVIN-ASSOCIATED protein 27-2       48.1    6e-04   
ref|XP_010938700.1|  PREDICTED: vesicle-associated protein 1-2-li...  48.1    7e-04   Elaeis guineensis
ref|XP_010938701.1|  PREDICTED: vesicle-associated protein 1-2-li...  48.1    7e-04   
ref|XP_006445308.1|  hypothetical protein CICLE_v10021988mg           47.0    8e-04   
gb|EYU43883.1|  hypothetical protein MIMGU_mgv1a008684mg              48.1    8e-04   Erythranthe guttata [common monkey flower]
ref|XP_006445306.1|  hypothetical protein CICLE_v10021988mg           47.4    9e-04   
ref|XP_006396216.1|  hypothetical protein EUTSA_v10028931mg           47.8    9e-04   Eutrema salsugineum [saltwater cress]
ref|XP_008655234.1|  PREDICTED: hypothetical protein isoform X1       48.1    0.001   



>ref|XP_009629502.1| PREDICTED: vesicle-associated protein 1-1-like [Nicotiana tomentosiformis]
 ref|XP_009629503.1| PREDICTED: vesicle-associated protein 1-1-like [Nicotiana tomentosiformis]
Length=318

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+F+L++I+PR++KFTFE KKQS+CTIRL NKS   VAF
Sbjct  1    MNFELVEIVPRELKFTFEPKKQSSCTIRLINKSQNHVAF  39



>ref|XP_009759405.1| PREDICTED: vesicle-associated protein 2-2-like [Nicotiana sylvestris]
 ref|XP_009759406.1| PREDICTED: vesicle-associated protein 2-2-like [Nicotiana sylvestris]
Length=318

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+F+L++I+PR++KF FE KKQS+CTIRL NKS   VAF
Sbjct  1    MNFELVEIVPRELKFIFEPKKQSSCTIRLINKSQNHVAF  39



>gb|KCW61698.1| hypothetical protein EUGRSUZ_H04422 [Eucalyptus grandis]
Length=268

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M + LLDI PR++KF FE KKQSTCTIRL N+S + VAF
Sbjct  1    MEWQLLDIQPRELKFIFELKKQSTCTIRLVNRSRQYVAF  39



>ref|XP_004230148.1| PREDICTED: vesicle-associated protein 1-2-like [Solanum lycopersicum]
Length=316

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M  DL++I PR+++FTFE KKQS+CTIRL NKS   VAF
Sbjct  1    MYSDLVEIAPRELQFTFEPKKQSSCTIRLINKSQNHVAF  39



>gb|KCW61699.1| hypothetical protein EUGRSUZ_H04422 [Eucalyptus grandis]
Length=350

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M + LLDI PR++KF FE KKQSTCTIRL N+S + VAF
Sbjct  1    MEWQLLDIQPRELKFIFELKKQSTCTIRLVNRSRQYVAF  39



>ref|XP_008223096.1| PREDICTED: vesicle-associated protein 2-2-like [Prunus mume]
Length=357

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 9/65 (14%)
 Frame = +2

Query  329  WTVANTGVTGC------KENKG---AMSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSD  481
            W   +    GC      +E  G    M+ +LLD+ PR++KFTFE KKQS C+I+L NKSD
Sbjct  18   WAFGSICSVGCLLRKKMEEKAGLTVMMTTELLDVQPRELKFTFELKKQSLCSIQLINKSD  77

Query  482  KDVAF  496
              VAF
Sbjct  78   HYVAF  82



>ref|XP_010025111.1| PREDICTED: vesicle-associated protein 2-2-like [Eucalyptus grandis]
 ref|XP_010025112.1| PREDICTED: vesicle-associated protein 2-2-like [Eucalyptus grandis]
 ref|XP_010025113.1| PREDICTED: vesicle-associated protein 2-2-like [Eucalyptus grandis]
 gb|KCW61700.1| hypothetical protein EUGRSUZ_H04422 [Eucalyptus grandis]
Length=369

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M + LLDI PR++KF FE KKQSTCTIRL N+S + VAF
Sbjct  1    MEWQLLDIQPRELKFIFELKKQSTCTIRLVNRSRQYVAF  39



>gb|KCW61701.1| hypothetical protein EUGRSUZ_H04422 [Eucalyptus grandis]
Length=312

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M + LLDI PR++KF FE KKQSTCTIRL N+S + VAF
Sbjct  1    MEWQLLDIQPRELKFIFELKKQSTCTIRLVNRSRQYVAF  39



>ref|XP_006347836.1| PREDICTED: vesicle-associated protein 2-2-like [Solanum tuberosum]
Length=316

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M  DL++I PR++KF FE KKQS+CTIRL NKS   VAF
Sbjct  1    MYSDLVEIAPRELKFIFEPKKQSSCTIRLINKSQNHVAF  39



>ref|XP_006489164.1| PREDICTED: vesicle-associated protein 2-2-like isoform X1 [Citrus 
sinensis]
Length=357

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LLDI P ++KFTFE KKQSTC I+L NKSD+ VAF
Sbjct  1    MAEELLDIQPLELKFTFEVKKQSTCVIQLGNKSDQCVAF  39



>ref|XP_010027215.1| PREDICTED: vesicle-associated protein 2-2-like [Eucalyptus grandis]
Length=316

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M   LLDI PR++KF FE KKQSTCTIRL N+S + VAF
Sbjct  1    MEKQLLDIQPRELKFIFELKKQSTCTIRLVNRSHQYVAF  39



>ref|XP_010667442.1| PREDICTED: vesicle-associated protein 2-2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010667443.1| PREDICTED: vesicle-associated protein 2-2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=311

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            MS +LLDI PR++ FT E+KKQS+C+I+L NK+D+ VA+
Sbjct  1    MSAELLDIHPRELCFTVEAKKQSSCSIQLGNKTDQHVAY  39



>ref|XP_006419683.1| hypothetical protein CICLE_v10005219mg [Citrus clementina]
 ref|XP_006419685.1| hypothetical protein CICLE_v10005219mg [Citrus clementina]
 gb|ESR32923.1| hypothetical protein CICLE_v10005219mg [Citrus clementina]
 gb|ESR32925.1| hypothetical protein CICLE_v10005219mg [Citrus clementina]
Length=357

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LLDI P ++KFTFE KKQSTC I+L NKSD+ VAF
Sbjct  1    MAEELLDIQPLELKFTFEVKKQSTCVIQLGNKSDQCVAF  39



>ref|XP_010667444.1| PREDICTED: vesicle-associated protein 2-2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=307

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            MS +LLDI PR++ FT E+KKQS+C+I+L NK+D+ VA+
Sbjct  1    MSAELLDIHPRELCFTVEAKKQSSCSIQLGNKTDQHVAY  39



>ref|XP_008390733.1| PREDICTED: vesicle-associated protein 2-2-like [Malus domestica]
Length=344

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            +LL++ PR++KFTFE KKQSTC+I+L NKSD  VAF
Sbjct  6    ELLEVHPRELKFTFEVKKQSTCSIQLGNKSDHYVAF  41



>ref|XP_006489166.1| PREDICTED: vesicle-associated protein 2-2-like isoform X3 [Citrus 
sinensis]
Length=336

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LLDI P ++KFTFE KKQSTC I+L NKSD+ VAF
Sbjct  1    MAEELLDIQPLELKFTFEVKKQSTCVIQLGNKSDQCVAF  39



>ref|XP_006419682.1| hypothetical protein CICLE_v10005219mg [Citrus clementina]
 gb|ESR32922.1| hypothetical protein CICLE_v10005219mg [Citrus clementina]
Length=336

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LLDI P ++KFTFE KKQSTC I+L NKSD+ VAF
Sbjct  1    MAEELLDIQPLELKFTFEVKKQSTCVIQLGNKSDQCVAF  39



>ref|XP_006419684.1| hypothetical protein CICLE_v10005219mg [Citrus clementina]
 gb|ESR32924.1| hypothetical protein CICLE_v10005219mg [Citrus clementina]
Length=367

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LLDI P ++KFTFE KKQSTC I+L NKSD+ VAF
Sbjct  1    MAEELLDIQPLELKFTFEVKKQSTCVIQLGNKSDQCVAF  39



>ref|XP_004971199.1| PREDICTED: vesicle-associated protein 2-2-like isoform X2 [Setaria 
italica]
Length=366

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M  DL++I PR+++FTFE KKQS+CT+ L NKS++ VAF
Sbjct  1    MGQDLVEIHPRELQFTFEVKKQSSCTVHLVNKSNEYVAF  39



>ref|XP_006489165.1| PREDICTED: vesicle-associated protein 2-2-like isoform X2 [Citrus 
sinensis]
Length=345

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LLDI P ++KFTFE KKQSTC I+L NKSD+ VAF
Sbjct  1    MAEELLDIQPLELKFTFEVKKQSTCVIQLGNKSDQCVAF  39



>ref|XP_006419686.1| hypothetical protein CICLE_v10005219mg [Citrus clementina]
 gb|ESR32926.1| hypothetical protein CICLE_v10005219mg [Citrus clementina]
Length=329

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LLDI P ++KFTFE KKQSTC I+L NKSD+ VAF
Sbjct  1    MAEELLDIQPLELKFTFEVKKQSTCVIQLGNKSDQCVAF  39



>gb|KDP40029.1| hypothetical protein JCGZ_02027 [Jatropha curcas]
Length=294

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LL+I PR+++FTFE KKQS+C+++L+N+SD+ VAF
Sbjct  1    MAAELLEIQPRELRFTFELKKQSSCSVQLSNRSDQYVAF  39



>ref|XP_004971198.1| PREDICTED: vesicle-associated protein 2-2-like isoform X1 [Setaria 
italica]
Length=370

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M  DL++I PR+++FTFE KKQS+CT+ L NKS++ VAF
Sbjct  1    MGQDLVEIHPRELQFTFEVKKQSSCTVHLVNKSNEYVAF  39



>ref|XP_010245359.1| PREDICTED: vesicle-associated protein 1-1-like [Nelumbo nucifera]
Length=315

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LLDI PR++KFTFE KKQS+C+++L N SD+ VAF
Sbjct  1    MNPELLDIRPRELKFTFELKKQSSCSVQLVNNSDQCVAF  39



>ref|XP_010040745.1| PREDICTED: vesicle-associated protein 2-2-like [Eucalyptus grandis]
Length=313

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M   LLDI PR++KF FE KKQSTCTIRL N+S + VAF
Sbjct  1    MEKQLLDIQPRELKFIFELKKQSTCTIRLVNRSRQYVAF  39



>ref|XP_006645299.1| PREDICTED: vesicle-associated protein 1-3-like [Oryza brachyantha]
Length=395

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M  DL +I PR+++FTFE KKQS+CT+ L NKS++ VAF
Sbjct  1    MGQDLAEIHPRELQFTFEVKKQSSCTVHLVNKSNEYVAF  39



>ref|XP_004296788.1| PREDICTED: vesicle-associated protein 2-2-like [Fragaria vesca 
subsp. vesca]
Length=285

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            ++ +LLD+ P +++FTFE KKQSTCTI+L N+SD+ VAF
Sbjct  2    ITTELLDVQPNELQFTFEVKKQSTCTIQLGNRSDQCVAF  40



>ref|XP_009352199.1| PREDICTED: vesicle-associated protein 2-2-like [Pyrus x bretschneideri]
Length=344

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            +LL++ PR++KFTFE KKQSTC+I+L N+SD  VAF
Sbjct  6    ELLEVHPRELKFTFEVKKQSTCSIQLGNRSDHYVAF  41



>ref|NP_001045329.1| Os01g0936800 [Oryza sativa Japonica Group]
 dbj|BAD87304.1| putative VAP27 [Oryza sativa Japonica Group]
 dbj|BAF07243.1| Os01g0936800 [Oryza sativa Japonica Group]
 dbj|BAG96016.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55966.1| hypothetical protein OsJ_04690 [Oryza sativa Japonica Group]
Length=380

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M  DL +I PR+++FTFE KKQS+CT+ L NKS++ VAF
Sbjct  1    MGQDLAEIHPRELQFTFEVKKQSSCTVHLVNKSNEYVAF  39



>ref|XP_002277190.1| PREDICTED: vesicle-associated protein 1-2 [Vitis vinifera]
 ref|XP_010649789.1| PREDICTED: vesicle-associated protein 1-2 [Vitis vinifera]
 ref|XP_010649790.1| PREDICTED: vesicle-associated protein 1-2 [Vitis vinifera]
 ref|XP_010649791.1| PREDICTED: vesicle-associated protein 1-2 [Vitis vinifera]
 ref|XP_010649792.1| PREDICTED: vesicle-associated protein 1-2 [Vitis vinifera]
 ref|XP_010649794.1| PREDICTED: vesicle-associated protein 1-2 [Vitis vinifera]
 ref|XP_010649795.1| PREDICTED: vesicle-associated protein 1-2 [Vitis vinifera]
 emb|CBI26121.3| unnamed protein product [Vitis vinifera]
Length=293

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  386  FDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
             +LL+I PR++KFTFE KKQS+C+I L NKSD+ +AF
Sbjct  1    MELLEIQPRELKFTFELKKQSSCSIHLVNKSDQYLAF  37



>ref|XP_010053915.1| PREDICTED: vesicle-associated protein 1-3 isoform X1 [Eucalyptus 
grandis]
 gb|KCW78297.1| hypothetical protein EUGRSUZ_D02475 [Eucalyptus grandis]
Length=235

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            +LLDI PR++KFTFE ++Q++C+++L+NK+DK VAF
Sbjct  5    NLLDIHPRELKFTFELRRQASCSMQLSNKTDKYVAF  40



>ref|XP_010053916.1| PREDICTED: vesicle-associated protein 1-3 isoform X2 [Eucalyptus 
grandis]
Length=234

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            +LLDI PR++KFTFE ++Q++C+++L+NK+DK VAF
Sbjct  5    NLLDIHPRELKFTFELRRQASCSMQLSNKTDKYVAF  40



>ref|XP_010921728.1| PREDICTED: vesicle-associated protein 1-2-like [Elaeis guineensis]
 ref|XP_010921729.1| PREDICTED: vesicle-associated protein 1-2-like [Elaeis guineensis]
Length=263

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  362  KEN-KGAMSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            KEN K  M   LL+I PR++KFTFE KKQS+C+I L NKS   VAF
Sbjct  2    KENAKEGMGQVLLEIEPRELKFTFELKKQSSCSIHLVNKSSDYVAF  47



>gb|KDP23596.1| hypothetical protein JCGZ_23429 [Jatropha curcas]
Length=384

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  371  KGAMSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            K  MS  LL++ PR++KF FE KKQS+C +RL N S  +VAF
Sbjct  12   KRVMSTQLLEVQPRELKFIFELKKQSSCVVRLTNNSHNNVAF  53



>ref|XP_008353239.1| PREDICTED: vesicle-associated protein 2-2-like [Malus domestica]
Length=323

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            +LLD+ P ++ FTFE KKQSTC+I+L NKSD+ VAF
Sbjct  6    ELLDVHPPELTFTFEVKKQSTCSIQLGNKSDRYVAF  41



>ref|XP_002459063.1| hypothetical protein SORBIDRAFT_03g045240 [Sorghum bicolor]
 gb|EES04183.1| hypothetical protein SORBIDRAFT_03g045240 [Sorghum bicolor]
Length=377

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M  DL++I PR+++FTFE KKQS+C + L NKS++ VAF
Sbjct  1    MGQDLVEIQPRELQFTFEVKKQSSCVVHLINKSNEYVAF  39



>ref|XP_008794811.1| PREDICTED: vesicle-associated protein 1-3 isoform X2 [Phoenix 
dactylifera]
Length=231

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  374  GAMSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            G  + D LDI P ++KF FE KKQS+C++RL NK+D+ VAF
Sbjct  2    GMSTGDFLDIQPTELKFPFELKKQSSCSMRLTNKTDQYVAF  42



>ref|XP_008794810.1| PREDICTED: vesicle-associated protein 1-3 isoform X1 [Phoenix 
dactylifera]
Length=240

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  374  GAMSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            G  + D LDI P ++KF FE KKQS+C++RL NK+D+ VAF
Sbjct  2    GMSTGDFLDIQPTELKFPFELKKQSSCSMRLTNKTDQYVAF  42



>ref|XP_007222950.1| hypothetical protein PRUPE_ppa008888mg [Prunus persica]
 gb|EMJ24149.1| hypothetical protein PRUPE_ppa008888mg [Prunus persica]
Length=254

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LLD+ P ++KFTFE KKQS C+I+L NKSD  VAF
Sbjct  2    MTTELLDVQPCELKFTFELKKQSLCSIQLGNKSDHYVAF  40



>ref|XP_007035462.1| Vesicle-associated membrane protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY06388.1| Vesicle-associated membrane protein, putative isoform 1 [Theobroma 
cacao]
Length=314

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LL+I P+++KFTFE KKQS+C I+L NK+D+ VAF
Sbjct  1    MAAELLEIHPQELKFTFELKKQSSCLIQLTNKTDQYVAF  39



>ref|XP_006855403.1| hypothetical protein AMTR_s00057p00149330 [Amborella trichopoda]
 gb|ERN16870.1| hypothetical protein AMTR_s00057p00149330 [Amborella trichopoda]
Length=264

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            MS +L+ I PR++KFTFE KK+S+C+++L N SD+ VAF
Sbjct  1    MSGELVGIQPRELKFTFELKKKSSCSVQLVNHSDQYVAF  39



>ref|XP_007222951.1| hypothetical protein PRUPE_ppa008888mg [Prunus persica]
 gb|EMJ24150.1| hypothetical protein PRUPE_ppa008888mg [Prunus persica]
Length=315

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LLD+ P ++KFTFE KKQS C+I+L NKSD  VAF
Sbjct  2    MTTELLDVQPCELKFTFELKKQSLCSIQLGNKSDHYVAF  40



>ref|XP_007035463.1| Vesicle-associated membrane protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY06389.1| Vesicle-associated membrane protein, putative isoform 2 [Theobroma 
cacao]
Length=263

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LL+I P+++KFTFE KKQS+C I+L NK+D+ VAF
Sbjct  1    MAAELLEIHPQELKFTFELKKQSSCLIQLTNKTDQYVAF  39



>ref|XP_009369098.1| PREDICTED: vesicle-associated protein 2-2-like [Pyrus x bretschneideri]
Length=321

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            +LLD+ P ++ FTFE KKQSTC+I+L NKSD  VAF
Sbjct  6    ELLDVHPPELTFTFEVKKQSTCSIQLGNKSDHYVAF  41



>ref|XP_011017464.1| PREDICTED: vesicle-associated protein 1-3 [Populus euphratica]
 ref|XP_011017465.1| PREDICTED: vesicle-associated protein 1-3 [Populus euphratica]
Length=237

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            DLL+I+P ++KF FE +KQS+C+++L NKSDK VAF
Sbjct  5    DLLNILPIELKFPFELRKQSSCSMQLTNKSDKYVAF  40



>gb|EMT18973.1| hypothetical protein F775_07960 [Aegilops tauschii]
Length=281

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M   +++I PR+++FTFE KKQS+C++ L NKSD+ VAF
Sbjct  1    MGQGVVEIQPRELQFTFELKKQSSCSVHLVNKSDEYVAF  39



>emb|CDP18378.1| unnamed protein product [Coffea canephora]
Length=285

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            MS +LLDI PR++KF  E KKQS+C++RL NKS   VAF
Sbjct  1    MSNELLDIQPRELKFIVELKKQSSCSVRLFNKSKHYVAF  39



>ref|XP_011469169.1| PREDICTED: vesicle-associated protein 1-3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=210

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            DLL I P ++KF FE KKQS+C+++L NK+DK VAF
Sbjct  5    DLLGIQPTELKFPFELKKQSSCSLQLTNKTDKHVAF  40



>ref|XP_010241107.1| PREDICTED: vesicle-associated protein 1-3-like [Nelumbo nucifera]
Length=284

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            MS +LL I PR++KFTFE KKQS+C ++L + SD+ VAF
Sbjct  2    MSQELLQIHPRELKFTFELKKQSSCLVQLVSNSDQCVAF  40



>ref|XP_002266266.1| PREDICTED: vesicle-associated protein 2-2 [Vitis vinifera]
 ref|XP_010659989.1| PREDICTED: vesicle-associated protein 2-2 [Vitis vinifera]
 ref|XP_010659990.1| PREDICTED: vesicle-associated protein 2-2 [Vitis vinifera]
 emb|CBI34290.3| unnamed protein product [Vitis vinifera]
Length=336

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M  +L+DI PR++KFTFE KKQS+C+IRL N +   VA+
Sbjct  1    MYSELVDIQPRELKFTFEVKKQSSCSIRLVNNTYHHVAY  39



>ref|NP_001136938.1| uncharacterized protein LOC100217097 [Zea mays]
 gb|ACF82928.1| unknown [Zea mays]
Length=389

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M  DL++I PR+++FTFE KKQS+C + L NKS++ VAF
Sbjct  1    MGQDLVEIHPRELQFTFEVKKQSSCVVCLTNKSNEYVAF  39



>gb|KJB72572.1| hypothetical protein B456_011G185500 [Gossypium raimondii]
Length=305

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LL+I P ++KFTFE KKQS+C I+L NK+D+ VAF
Sbjct  1    MTSELLEIQPLELKFTFELKKQSSCLIQLTNKTDQYVAF  39



>gb|ACG39854.1| VAP27-2 [Zea mays]
 tpg|DAA55922.1| TPA: VAP27-2 [Zea mays]
Length=389

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M  DL++I PR+++FTFE KKQS+C + L NKS++ VAF
Sbjct  1    MGQDLVEIHPRELQFTFEVKKQSSCVVCLTNKSNEYVAF  39



>ref|XP_008808742.1| PREDICTED: vesicle-associated protein 1-3-like [Phoenix dactylifera]
Length=238

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            D LDI P ++KF FE KKQS+C+++LANK+D+ VAF
Sbjct  5    DFLDIQPAELKFPFELKKQSSCSMQLANKTDQYVAF  40



>gb|KJB72569.1| hypothetical protein B456_011G185500 [Gossypium raimondii]
 gb|KJB72570.1| hypothetical protein B456_011G185500 [Gossypium raimondii]
Length=308

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LL+I P ++KFTFE KKQS+C I+L NK+D+ VAF
Sbjct  1    MTSELLEIQPLELKFTFELKKQSSCLIQLTNKTDQYVAF  39



>ref|XP_002302522.1| hypothetical protein POPTR_0002s14560g [Populus trichocarpa]
 gb|EEE81795.1| hypothetical protein POPTR_0002s14560g [Populus trichocarpa]
Length=237

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            DLL+I P ++KF FE KKQS+C+++L NKSDK VAF
Sbjct  5    DLLNIHPIELKFPFELKKQSSCSMQLTNKSDKYVAF  40



>ref|XP_004306946.1| PREDICTED: vesicle-associated protein 1-3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=237

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            DLL I P ++KF FE KKQS+C+++L NK+DK VAF
Sbjct  5    DLLGIQPTELKFPFELKKQSSCSLQLTNKTDKHVAF  40



>gb|KJB72571.1| hypothetical protein B456_011G185500 [Gossypium raimondii]
Length=254

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LL+I P ++KFTFE KKQS+C I+L NK+D+ VAF
Sbjct  1    MTSELLEIQPLELKFTFELKKQSSCLIQLTNKTDQYVAF  39



>ref|XP_008388615.1| PREDICTED: vesicle-associated protein 2-2 [Malus domestica]
 ref|XP_008388616.1| PREDICTED: vesicle-associated protein 2-2 [Malus domestica]
Length=379

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            MS  LL+I P+++KF FE KKQS+C+IRL N +D  VAF
Sbjct  1    MSTQLLEIQPKELKFLFELKKQSSCSIRLTNLTDNXVAF  39



>gb|KHG16837.1| Vesicle-associated 2-2 -like protein [Gossypium arboreum]
Length=306

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LL+I P ++KFTFE KKQS+C I+L NK+D+ VAF
Sbjct  1    MTSELLEIHPLELKFTFELKKQSSCLIQLTNKTDQYVAF  39



>ref|XP_010105013.1| Vesicle-associated protein 2-2 [Morus notabilis]
 gb|EXC03122.1| Vesicle-associated protein 2-2 [Morus notabilis]
Length=283

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LL+I P ++KFTFE KKQS+C+I+L NKS   VAF
Sbjct  1    MTSELLEIQPSELKFTFELKKQSSCSIQLGNKSAHYVAF  39



>gb|KGN57064.1| hypothetical protein Csa_3G151410 [Cucumis sativus]
Length=437

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +L +I P ++KFTFE KKQS+C I+L NKS++ +AF
Sbjct  98   MTMELFEIQPAELKFTFELKKQSSCLIQLINKSEQHIAF  136



>ref|XP_004962276.1| PREDICTED: vesicle-associated membrane protein-associated protein 
SCS2-like isoform X2 [Setaria italica]
Length=361

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  392  LLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            L++I PR+++F FE KKQS+C +RL NKSD+ VAF
Sbjct  7    LVEIHPRELRFLFEVKKQSSCCVRLVNKSDQYVAF  41



>ref|XP_004134182.1| PREDICTED: vesicle-associated protein 2-2-like [Cucumis sativus]
 ref|XP_004159830.1| PREDICTED: vesicle-associated protein 2-2-like [Cucumis sativus]
Length=340

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +L +I P ++KFTFE KKQS+C I+L NKS++ +AF
Sbjct  1    MTMELFEIQPAELKFTFELKKQSSCLIQLINKSEQHIAF  39



>ref|XP_004962275.1| PREDICTED: vesicle-associated membrane protein-associated protein 
SCS2-like isoform X1 [Setaria italica]
Length=362

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  392  LLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            L++I PR+++F FE KKQS+C +RL NKSD+ VAF
Sbjct  7    LVEIHPRELRFLFEVKKQSSCCVRLVNKSDQYVAF  41



>ref|XP_009373916.1| PREDICTED: vesicle-associated protein 2-2-like [Pyrus x bretschneideri]
 ref|XP_009373917.1| PREDICTED: vesicle-associated protein 2-2-like [Pyrus x bretschneideri]
Length=379

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            MS  LL+I P+++KF FE KKQS+C+IRL N +D  VAF
Sbjct  1    MSTQLLEIQPKELKFLFELKKQSSCSIRLTNLTDNYVAF  39



>ref|XP_007218293.1| hypothetical protein PRUPE_ppa010720mg [Prunus persica]
 ref|XP_008232590.1| PREDICTED: vesicle-associated protein 1-3 [Prunus mume]
 gb|EMJ19492.1| hypothetical protein PRUPE_ppa010720mg [Prunus persica]
Length=238

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            DLL I P ++KF FE KKQS+C+++L NK+DK VAF
Sbjct  5    DLLSIQPTELKFPFEVKKQSSCSLQLTNKTDKYVAF  40



>ref|XP_008438789.1| PREDICTED: vesicle-associated protein 2-2-like [Cucumis melo]
 ref|XP_008438790.1| PREDICTED: vesicle-associated protein 2-2-like [Cucumis melo]
 ref|XP_008438791.1| PREDICTED: vesicle-associated protein 2-2-like [Cucumis melo]
Length=340

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +L +I P ++KFTFE KKQS+C I L NKS++ +AF
Sbjct  1    MTMELFEIQPAELKFTFELKKQSSCLIHLINKSEQHIAF  39



>gb|KDP28788.1| hypothetical protein JCGZ_14559 [Jatropha curcas]
Length=238

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            DLL I P ++KF FE KKQS+C+++L NK+DK VAF
Sbjct  5    DLLSIQPSELKFPFELKKQSSCSLQLTNKTDKYVAF  40



>ref|XP_010941129.1| PREDICTED: vesicle-associated protein 1-3 [Elaeis guineensis]
Length=237

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            D LDI P ++KF FE KKQS+C++RL NK+D+ VAF
Sbjct  5    DFLDIQPIELKFPFELKKQSSCSMRLTNKTDQYVAF  40



>ref|XP_008803084.1| PREDICTED: vesicle-associated protein 1-2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008803085.1| PREDICTED: vesicle-associated protein 1-2-like isoform X1 [Phoenix 
dactylifera]
Length=260

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M   LL+I PR++KFTFE KKQS+C++ L NKS   VAF
Sbjct  1    MGQVLLEIEPRELKFTFELKKQSSCSVHLVNKSSDYVAF  39



>emb|CDO98923.1| unnamed protein product [Coffea canephora]
Length=316

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  392  LLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            LLD+ PR++KF FE KKQS+C + LAN SD  VAF
Sbjct  15   LLDVQPRELKFIFEVKKQSSCAVHLANLSDHYVAF  49



>ref|XP_002280265.1| PREDICTED: vesicle-associated protein 1-3 [Vitis vinifera]
 emb|CBI38880.3| unnamed protein product [Vitis vinifera]
Length=239

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            DLL+I P ++KF FE KKQS+C+++L NK+D+ VAF
Sbjct  5    DLLNIHPTELKFPFELKKQSSCSLQLTNKTDQYVAF  40



>emb|CAN69799.1| hypothetical protein VITISV_011904 [Vitis vinifera]
Length=234

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            DLL+I P ++KF FE KKQS+C+++L NK+D+ VAF
Sbjct  42   DLLNIHPTELKFPFELKKQSSCSLQLTNKTDQYVAF  77



>ref|XP_011032542.1| PREDICTED: vesicle-associated protein 2-2-like isoform X1 [Populus 
euphratica]
Length=432

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  392  LLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            LL+I P+++KF FE KKQS+C+IRL N + ++VAF
Sbjct  4    LLEIQPKELKFVFEVKKQSSCSIRLTNNAHQNVAF  38



>ref|XP_011032543.1| PREDICTED: vesicle-associated protein 1-1-like isoform X2 [Populus 
euphratica]
Length=376

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  392  LLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            LL+I P+++KF FE KKQS+C+IRL N + ++VAF
Sbjct  4    LLEIQPKELKFVFEVKKQSSCSIRLTNNAHQNVAF  38



>ref|XP_010264233.1| PREDICTED: vesicle-associated protein 1-3-like [Nelumbo nucifera]
Length=239

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  383  SFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            S DL++I P ++KF FE KKQS+C+++L NK+++ VAF
Sbjct  3    SGDLINIQPHELKFPFELKKQSSCSLQLTNKTEQYVAF  40



>ref|XP_010024551.1| PREDICTED: vesicle-associated protein 2-2-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010024552.1| PREDICTED: vesicle-associated protein 2-2-like isoform X1 [Eucalyptus 
grandis]
Length=258

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LL+I P ++KF FE +KQS+C+I+L NK+D+ VAF
Sbjct  1    MAEELLEIRPHELKFIFELRKQSSCSIQLRNKTDQYVAF  39



>ref|XP_010024553.1| PREDICTED: vesicle-associated protein 2-2-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW61008.1| hypothetical protein EUGRSUZ_H03764 [Eucalyptus grandis]
Length=256

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+ +LL+I P ++KF FE +KQS+C+I+L NK+D+ VAF
Sbjct  1    MAEELLEIRPHELKFIFELRKQSSCSIQLRNKTDQYVAF  39



>ref|XP_002319045.1| VAMP/SYNAPTOBREVIN-ASSOCIATED protein 27-2 [Populus trichocarpa]
 gb|EEE94968.1| VAMP/SYNAPTOBREVIN-ASSOCIATED protein 27-2 [Populus trichocarpa]
Length=240

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
             LL+I+P+++KF FE KKQS+C+IRL N +  +VAF
Sbjct  3    QLLEILPKELKFIFEVKKQSSCSIRLTNNTFHNVAF  38



>ref|XP_010938700.1| PREDICTED: vesicle-associated protein 1-2-like isoform X1 [Elaeis 
guineensis]
Length=274

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M   LL+I PR++KFTFE KKQS+C++ L NK++  +AF
Sbjct  1    MGQVLLEIEPRELKFTFELKKQSSCSVHLVNKTNDYIAF  39



>ref|XP_010938701.1| PREDICTED: vesicle-associated protein 1-2-like isoform X2 [Elaeis 
guineensis]
Length=255

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M   LL+I PR++KFTFE KKQS+C++ L NK++  +AF
Sbjct  1    MGQVLLEIEPRELKFTFELKKQSSCSVHLVNKTNDYIAF  39



>ref|XP_006445308.1| hypothetical protein CICLE_v10021988mg [Citrus clementina]
 gb|ESR58548.1| hypothetical protein CICLE_v10021988mg [Citrus clementina]
 gb|KDO85742.1| hypothetical protein CISIN_1g026478mg [Citrus sinensis]
Length=165

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            DL++I P ++KF FE KKQS+C+++L NK+DK VAF
Sbjct  5    DLVNIQPSELKFPFELKKQSSCSMQLTNKTDKFVAF  40



>gb|EYU43883.1| hypothetical protein MIMGU_mgv1a008684mg [Erythranthe guttata]
Length=365

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  380  MSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            M+  +++I PR+VKF FE KKQSTC + L N +D+ VAF
Sbjct  1    MNPQIVEIQPREVKFVFELKKQSTCIVHLGNVTDQYVAF  39



>ref|XP_006445306.1| hypothetical protein CICLE_v10021988mg [Citrus clementina]
 gb|ESR58546.1| hypothetical protein CICLE_v10021988mg [Citrus clementina]
 gb|KDO85739.1| hypothetical protein CISIN_1g026478mg [Citrus sinensis]
 gb|KDO85740.1| hypothetical protein CISIN_1g026478mg [Citrus sinensis]
 gb|KDO85741.1| hypothetical protein CISIN_1g026478mg [Citrus sinensis]
Length=180

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            DL++I P ++KF FE KKQS+C+++L NK+DK VAF
Sbjct  5    DLVNIQPSELKFPFELKKQSSCSMQLTNKTDKFVAF  40



>ref|XP_006396216.1| hypothetical protein EUTSA_v10028931mg [Eutrema salsugineum]
 gb|ESQ37669.1| hypothetical protein EUTSA_v10028931mg [Eutrema salsugineum]
Length=234

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  389  DLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
            DL++I P ++KF FE KKQS+C+++L NK+DK VAF
Sbjct  5    DLVNIHPTELKFPFELKKQSSCSMQLTNKTDKVVAF  40



>ref|XP_008655234.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=641

 Score = 48.1 bits (113),  Expect = 0.001, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  374  GAMSFDLLDIIPRDVKFTFESKKQSTCTIRLANKSDKDVAF  496
             AM  DL++I P +++FTFE KKQS+C + L NKS+  VAF
Sbjct  249  AAMGQDLVEIHPSELQFTFEVKKQSSCVVHLINKSNDYVAF  289



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190