BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G22

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            238   1e-72   Nicotiana tomentosiformis
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            235   9e-72   Nicotiana sylvestris
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            231   4e-70   Solanum lycopersicum
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       228   6e-69   Solanum tuberosum [potatoes]
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                226   3e-68   Erythranthe guttata [common monkey flower]
ref|XP_006453576.1|  hypothetical protein CICLE_v10008112mg             221   2e-67   
ref|XP_010531651.1|  PREDICTED: serine carboxypeptidase-like 29         215   3e-67   Tarenaya hassleriana [spider flower]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            222   9e-67   Sesamum indicum [beniseed]
ref|XP_002528403.1|  serine carboxypeptidase, putative                  222   2e-66   Ricinus communis
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             220   6e-66   Citrus clementina [clementine]
gb|KDO62275.1|  hypothetical protein CISIN_1g0418332mg                  215   9e-66   Citrus sinensis [apfelsine]
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             220   1e-65   Citrus clementina [clementine]
emb|CDP02851.1|  unnamed protein product                                217   6e-65   Coffea canephora [robusta coffee]
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    216   2e-64   Citrus sinensis [apfelsine]
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         216   2e-64   Jatropha curcas
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            215   4e-64   Vitis vinifera
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    214   4e-64   Phoenix dactylifera
gb|AFK34623.1|  unknown                                                 206   7e-64   Lotus japonicus
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            215   8e-64   Pyrus x bretschneideri [bai li]
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         215   9e-64   Tarenaya hassleriana [spider flower]
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    214   1e-63   Phoenix dactylifera
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             213   3e-63   Prunus persica
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            213   3e-63   Prunus mume [ume]
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       213   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          213   3e-63   Amborella trichopoda
gb|KDP38716.1|  hypothetical protein JCGZ_04069                         206   5e-63   Jatropha curcas
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       212   6e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             212   6e-63   
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         212   6e-63   
emb|CBI36578.3|  unnamed protein product                                212   6e-63   Vitis vinifera
gb|KJB76660.1|  hypothetical protein B456_012G098600                    210   7e-63   Gossypium raimondii
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            213   1e-62   Vitis vinifera
ref|XP_011018072.1|  PREDICTED: serine carboxypeptidase-like 29 i...    210   1e-62   Populus euphratica
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            211   1e-62   
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            211   1e-62   Fragaria vesca subsp. vesca
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            211   3e-62   Nelumbo nucifera [Indian lotus]
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    210   6e-62   Theobroma cacao [chocolate]
gb|KJB76659.1|  hypothetical protein B456_012G098600                    210   6e-62   Gossypium raimondii
gb|EPS71160.1|  hypothetical protein M569_03591                         209   6e-62   Genlisea aurea
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    209   7e-62   Populus euphratica
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    209   9e-62   Arabis alpina [alpine rockcress]
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         208   3e-61   Gossypium arboreum [tree cotton]
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            207   5e-61   Elaeis guineensis
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            207   6e-61   Cucumis melo [Oriental melon]
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            206   1e-60   Eucalyptus grandis [rose gum]
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       206   1e-60   Eucalyptus grandis [rose gum]
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            206   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006387151.1|  hypothetical protein POPTR_1689s00200g             202   1e-60   
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    206   1e-60   
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             206   2e-60   Capsella rubella
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    205   4e-60   Cucumis sativus [cucumbers]
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       206   5e-60   Cucumis sativus [cucumbers]
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         202   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         202   4e-59   Brassica rapa
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             202   5e-59   
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         202   6e-59   Camelina sativa [gold-of-pleasure]
emb|CDY28217.1|  BnaA01g06320D                                          201   8e-59   Brassica napus [oilseed rape]
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         201   1e-58   Brassica rapa
emb|CDX68696.1|  BnaC01g07570D                                          201   1e-58   
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         201   2e-58   Brassica rapa
emb|CDY13387.1|  BnaA03g51050D                                          201   2e-58   Brassica napus [oilseed rape]
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         201   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            200   2e-58   Brachypodium distachyon [annual false brome]
emb|CDY23258.1|  BnaA08g12880D                                          200   2e-58   Brassica napus [oilseed rape]
gb|KHN02055.1|  Serine carboxypeptidase II-2                            200   3e-58   Glycine soja [wild soybean]
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       200   3e-58   Glycine max [soybeans]
emb|CAN75200.1|  hypothetical protein VITISV_014887                     200   5e-58   Vitis vinifera
emb|CDY55623.1|  BnaC03g77560D                                          199   7e-58   Brassica napus [oilseed rape]
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                197   7e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CDY28216.1|  BnaA01g06330D                                          199   1e-57   Brassica napus [oilseed rape]
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         198   1e-57   
ref|NP_567854.1|  serine carboxypeptidase-like 29                       198   1e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72270.1|  BnaC07g42920D                                          201   2e-57   
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             196   7e-57   Eutrema salsugineum [saltwater cress]
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    196   2e-56   
dbj|BAJ99024.1|  predicted protein                                      195   2e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02147.1|  predicted protein                                      195   2e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX68695.1|  BnaC01g07580D                                          195   3e-56   
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             192   4e-55   Phaseolus vulgaris [French bean]
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       192   4e-55   Oryza brachyantha
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       192   5e-55   Cicer arietinum [garbanzo]
gb|ABK24285.1|  unknown                                                 191   6e-55   Picea sitchensis
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       191   1e-54   Setaria italica
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    189   1e-54   
emb|CDP11023.1|  unnamed protein product                                190   2e-54   Coffea canephora [robusta coffee]
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          190   2e-54   Zea mays [maize]
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    187   6e-54   Hordeum vulgare [barley]
ref|XP_003596536.1|  Serine carboxypeptidase                            188   5e-53   
ref|NP_001057009.1|  Os06g0186400                                       186   7e-53   
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       185   1e-52   Medicago truncatula
emb|CDY32091.1|  BnaC04g44750D                                          184   1e-52   Brassica napus [oilseed rape]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    185   2e-52   Glycine max [soybeans]
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         184   2e-52   Brassica rapa
emb|CDY40438.1|  BnaA04g20790D                                          183   3e-52   Brassica napus [oilseed rape]
gb|KJB78940.1|  hypothetical protein B456_013G026200                    182   4e-52   Gossypium raimondii
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         183   5e-52   Nelumbo nucifera [Indian lotus]
ref|XP_002534550.1|  serine carboxypeptidase, putative                  181   6e-52   
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         183   7e-52   Sesamum indicum [beniseed]
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         183   7e-52   Gossypium arboreum [tree cotton]
gb|KEH38195.1|  serine carboxypeptidase-like protein                    182   8e-52   Medicago truncatula
gb|AES66787.2|  serine carboxypeptidase-like protein                    183   8e-52   Medicago truncatula
emb|CDO99730.1|  unnamed protein product                                182   9e-52   Coffea canephora [robusta coffee]
gb|KJB78942.1|  hypothetical protein B456_013G026200                    181   1e-51   Gossypium raimondii
gb|KJB78939.1|  hypothetical protein B456_013G026200                    181   1e-51   Gossypium raimondii
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       182   1e-51   Medicago truncatula
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         182   2e-51   Populus trichocarpa [western balsam poplar]
gb|KJB78938.1|  hypothetical protein B456_013G026200                    181   3e-51   Gossypium raimondii
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         181   4e-51   Populus euphratica
ref|NP_181121.1|  serine carboxypeptidase-like 26                       181   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             181   6e-51   Phaseolus vulgaris [French bean]
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    180   6e-51   Arabis alpina [alpine rockcress]
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    181   6e-51   Glycine max [soybeans]
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             181   6e-51   
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         180   7e-51   Pyrus x bretschneideri [bai li]
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         180   8e-51   Fragaria vesca subsp. vesca
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         180   8e-51   Jatropha curcas
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             180   8e-51   Populus trichocarpa [western balsam poplar]
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             180   9e-51   Capsella rubella
ref|XP_009141517.1|  PREDICTED: serine carboxypeptidase-like 28         180   1e-50   Brassica rapa
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    180   1e-50   Solanum tuberosum [potatoes]
ref|XP_010067291.1|  PREDICTED: serine carboxypeptidase-like 28         180   1e-50   Eucalyptus grandis [rose gum]
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             179   1e-50   Eutrema salsugineum [saltwater cress]
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               180   1e-50   Medicago truncatula
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         180   1e-50   Glycine soja [wild soybean]
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          179   2e-50   Arabidopsis lyrata subsp. petraea
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         179   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             179   2e-50   
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         179   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         179   3e-50   Populus trichocarpa [western balsam poplar]
emb|CDY40439.1|  BnaA04g20780D                                          179   3e-50   Brassica napus [oilseed rape]
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         178   3e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         178   3e-50   Camelina sativa [gold-of-pleasure]
gb|KJB76564.1|  hypothetical protein B456_012G094900                    175   3e-50   Gossypium raimondii
gb|AFK37459.1|  unknown                                                 178   4e-50   Lotus japonicus
gb|KJB76565.1|  hypothetical protein B456_012G094900                    175   5e-50   Gossypium raimondii
gb|EYU39591.1|  hypothetical protein MIMGU_mgv1a009171mg                176   5e-50   Erythranthe guttata [common monkey flower]
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         178   5e-50   Populus euphratica
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         177   6e-50   Solanum lycopersicum
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    177   7e-50   Fragaria vesca subsp. vesca
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         177   7e-50   Populus euphratica
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    177   9e-50   Fragaria vesca subsp. vesca
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    177   1e-49   Cucumis sativus [cucumbers]
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         177   1e-49   Glycine soja [wild soybean]
gb|KDO48446.1|  hypothetical protein CISIN_1g016137mg                   175   1e-49   Citrus sinensis [apfelsine]
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         177   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         177   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_007009788.1|  Serine carboxypeptidase-like 27 isoform 2          176   2e-49   
gb|KJB76572.1|  hypothetical protein B456_012G095000                    176   2e-49   Gossypium raimondii
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             176   2e-49   Eutrema salsugineum [saltwater cress]
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         176   2e-49   Nicotiana sylvestris
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         176   2e-49   Malus domestica [apple tree]
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         176   2e-49   Vitis vinifera
ref|XP_006436272.1|  hypothetical protein CICLE_v10031437mg             176   2e-49   Citrus clementina [clementine]
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    176   3e-49   Glycine max [soybeans]
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         176   3e-49   Pyrus x bretschneideri [bai li]
gb|KJB76571.1|  hypothetical protein B456_012G095000                    176   3e-49   Gossypium raimondii
emb|CBI31484.3|  unnamed protein product                                176   3e-49   Vitis vinifera
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         176   3e-49   
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    175   4e-49   Nelumbo nucifera [Indian lotus]
gb|AEX12786.1|  hypothetical protein 2_8315_02                          166   5e-49   Pinus radiata
gb|AEX12772.1|  hypothetical protein 2_8315_02                          166   5e-49   Pinus taeda
gb|AEX12770.1|  hypothetical protein 2_8315_02                          166   5e-49   Pinus taeda
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         175   5e-49   Cucumis melo [Oriental melon]
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         175   6e-49   Nicotiana tomentosiformis
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    175   6e-49   Nelumbo nucifera [Indian lotus]
gb|KJB76563.1|  hypothetical protein B456_012G094900                    175   6e-49   Gossypium raimondii
ref|XP_007009790.1|  Serine carboxypeptidase-like 28                    175   7e-49   
gb|KJB76567.1|  hypothetical protein B456_012G094900                    175   9e-49   Gossypium raimondii
gb|KJB76566.1|  hypothetical protein B456_012G094900                    175   9e-49   Gossypium raimondii
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         174   9e-49   Prunus mume [ume]
gb|EYU39590.1|  hypothetical protein MIMGU_mgv1a0101821mg               167   1e-48   Erythranthe guttata [common monkey flower]
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   174   2e-48   Citrus sinensis [apfelsine]
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          176   2e-48   
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             174   2e-48   Citrus clementina [clementine]
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         174   2e-48   Vitis vinifera
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    174   2e-48   Arabis alpina [alpine rockcress]
gb|ACA61622.1|  hypothetical protein AP7_B10.2                          167   2e-48   Arabidopsis lyrata subsp. petraea
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              174   2e-48   Fragaria vesca subsp. vesca
gb|EPS66906.1|  hypothetical protein M569_07869                         172   2e-48   Genlisea aurea
ref|XP_010505097.1|  PREDICTED: serine carboxypeptidase-like 28         174   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          173   4e-48   Amborella trichopoda
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         172   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         172   7e-48   Nicotiana sylvestris
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               172   8e-48   
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               172   8e-48   Medicago truncatula
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     172   9e-48   Eucalyptus grandis [rose gum]
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         173   9e-48   Eucalyptus grandis [rose gum]
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    172   9e-48   Brassica rapa
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    172   9e-48   
gb|AES62200.2|  serine carboxypeptidase-like protein                    172   1e-47   Medicago truncatula
ref|NP_181120.2|  serine carboxypeptidase-like 28                       172   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AFK43035.1|  unknown                                                 172   1e-47   Medicago truncatula
gb|KDP25724.1|  hypothetical protein JCGZ_23945                         172   1e-47   Jatropha curcas
emb|CDY35977.1|  BnaA05g29730D                                          172   1e-47   Brassica napus [oilseed rape]
ref|NP_187456.1|  serine carboxypeptidase-like 27                       172   1e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDY28004.1|  BnaC05g44060D                                          171   1e-47   Brassica napus [oilseed rape]
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         171   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         171   2e-47   Gossypium arboreum [tree cotton]
ref|XP_006294164.1|  hypothetical protein CARUB_v10023157mg             171   2e-47   Capsella rubella
gb|KJB77374.1|  hypothetical protein B456_012G134700                    171   3e-47   Gossypium raimondii
emb|CAN74854.1|  hypothetical protein VITISV_028701                     171   3e-47   Vitis vinifera
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         171   3e-47   Nelumbo nucifera [Indian lotus]
gb|KJB76569.1|  hypothetical protein B456_012G094900                    170   3e-47   Gossypium raimondii
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         171   3e-47   Populus euphratica
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         170   5e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         170   5e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006410746.1|  hypothetical protein EUTSA_v10016610mg             170   5e-47   Eutrema salsugineum [saltwater cress]
gb|KJB77373.1|  hypothetical protein B456_012G134700                    171   5e-47   Gossypium raimondii
gb|KJB77375.1|  hypothetical protein B456_012G134700                    171   5e-47   Gossypium raimondii
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         170   6e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010260054.1|  PREDICTED: serine carboxypeptidase-like 25 i...    169   6e-47   Nelumbo nucifera [Indian lotus]
ref|XP_002881413.1|  hypothetical protein ARALYDRAFT_321290             170   6e-47   
dbj|BAK05698.1|  predicted protein                                      168   6e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004496293.1|  PREDICTED: serine carboxypeptidase-like 27-l...    169   6e-47   
emb|CBI21207.3|  unnamed protein product                                170   6e-47   Vitis vinifera
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         170   6e-47   Vitis vinifera
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               169   8e-47   Medicago truncatula
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         170   8e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    169   1e-46   Nelumbo nucifera [Indian lotus]
gb|KJB07560.1|  hypothetical protein B456_001G032600                    168   1e-46   Gossypium raimondii
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    169   1e-46   Cicer arietinum [garbanzo]
emb|CDO99728.1|  unnamed protein product                                169   2e-46   Coffea canephora [robusta coffee]
ref|XP_010509563.1|  PREDICTED: serine carboxypeptidase-like 28         169   2e-46   Camelina sativa [gold-of-pleasure]
gb|AAM15112.1|  putative serine carboxypeptidase II                     168   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297634.1|  hypothetical protein CARUB_v10013654mg             167   3e-46   
gb|KJB07562.1|  hypothetical protein B456_001G032600                    168   3e-46   Gossypium raimondii
ref|XP_009618061.1|  PREDICTED: serine carboxypeptidase-like 34         162   3e-46   Nicotiana tomentosiformis
ref|XP_010516781.1|  PREDICTED: serine carboxypeptidase-like 28         168   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         169   4e-46   Elaeis guineensis
ref|XP_006373363.1|  hypothetical protein POPTR_0017s12960g             167   4e-46   
emb|CDP10248.1|  unnamed protein product                                167   4e-46   Coffea canephora [robusta coffee]
gb|KJB07564.1|  hypothetical protein B456_001G032600                    168   5e-46   Gossypium raimondii
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             167   5e-46   
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         167   6e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         167   7e-46   Nicotiana tomentosiformis
ref|XP_002529402.1|  serine carboxypeptidase, putative                  167   7e-46   Ricinus communis
gb|KJB07559.1|  hypothetical protein B456_001G032600                    167   7e-46   Gossypium raimondii
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         167   8e-46   Populus trichocarpa [western balsam poplar]
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             167   1e-45   
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         167   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO75846.1|  hypothetical protein CISIN_1g0117382mg                  163   1e-45   Citrus sinensis [apfelsine]
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    166   1e-45   Glycine max [soybeans]
emb|CBI29056.3|  unnamed protein product                                167   1e-45   Vitis vinifera
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         167   1e-45   Vitis vinifera
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         166   1e-45   Fragaria vesca subsp. vesca
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             166   1e-45   Arabidopsis lyrata subsp. lyrata
gb|KFK36473.1|  hypothetical protein AALP_AA4G129300                    166   2e-45   Arabis alpina [alpine rockcress]
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    166   2e-45   Morus notabilis
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              166   2e-45   Sesamum indicum [beniseed]
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         166   2e-45   Glycine max [soybeans]
dbj|BAO04184.1|  hypothetical protein                                   166   2e-45   Delphinium grandiflorum
gb|KHN42831.1|  Serine carboxypeptidase 24                              166   2e-45   Glycine soja [wild soybean]
gb|ABR16028.1|  unknown                                                 166   3e-45   Picea sitchensis
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         166   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         166   3e-45   Prunus mume [ume]
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                165   4e-45   Gossypium arboreum [tree cotton]
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         165   4e-45   Solanum tuberosum [potatoes]
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          165   4e-45   
ref|XP_011018041.1|  PREDICTED: serine carboxypeptidase 24-like i...    163   5e-45   Populus euphratica
ref|NP_001152245.1|  lysosomal protective protein precursor             165   6e-45   
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         165   6e-45   Eucalyptus grandis [rose gum]
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    165   7e-45   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         164   7e-45   Populus euphratica
gb|KEH32355.1|  serine carboxypeptidase-like protein                    164   8e-45   Medicago truncatula
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    164   8e-45   
gb|KJB79850.1|  hypothetical protein B456_013G069700                    164   8e-45   Gossypium raimondii
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         164   9e-45   Solanum lycopersicum
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             164   9e-45   Phaseolus vulgaris [French bean]
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         164   9e-45   Populus euphratica
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    164   1e-44   Populus euphratica
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          165   1e-44   
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          164   1e-44   Sorghum bicolor [broomcorn]
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...    163   1e-44   
gb|KJB75609.1|  hypothetical protein B456_012G048700                    160   1e-44   Gossypium raimondii
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 164   1e-44   
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   163   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    163   2e-44   Solanum tuberosum [potatoes]
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              163   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    163   2e-44   Morus notabilis
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    164   2e-44   
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    163   2e-44   
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       164   2e-44   
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    163   2e-44   
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    163   2e-44   
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         163   2e-44   
gb|KHN35601.1|  Serine carboxypeptidase II-3                            164   2e-44   
ref|XP_007032751.1|  Serine carboxypeptidase-like 25 isoform 4          161   2e-44   
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         163   2e-44   
gb|KCW51319.1|  hypothetical protein EUGRSUZ_J00874                     162   2e-44   
emb|CAN79972.1|  hypothetical protein VITISV_010072                     162   3e-44   
ref|XP_006467848.1|  PREDICTED: serine carboxypeptidase-like 31-like    163   3e-44   
ref|XP_006449285.1|  hypothetical protein CICLE_v10015093mg             163   3e-44   
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         163   3e-44   
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              163   3e-44   
emb|CDY43258.1|  BnaC05g48510D                                          162   3e-44   
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         162   4e-44   
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    162   4e-44   
ref|XP_006453595.1|  hypothetical protein CICLE_v10008182mg             160   4e-44   
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                162   4e-44   
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         162   4e-44   
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    162   4e-44   
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              162   4e-44   
ref|XP_002520355.1|  serine carboxypeptidase, putative                  164   4e-44   
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       162   5e-44   
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    162   5e-44   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    162   5e-44   
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       162   6e-44   
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         162   6e-44   
ref|XP_009351733.1|  PREDICTED: serine carboxypeptidase-like 34         162   6e-44   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       162   6e-44   
ref|XP_007035881.1|  Serine carboxypeptidase-like 33                    162   6e-44   
gb|ABR16596.1|  unknown                                                 163   6e-44   
ref|XP_010108549.1|  Serine carboxypeptidase 24                         162   6e-44   
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         162   6e-44   
ref|XP_010645362.1|  PREDICTED: serine carboxypeptidase-like 31         162   7e-44   
emb|CBI18754.3|  unnamed protein product                                162   7e-44   
gb|ABR16997.1|  unknown                                                 162   7e-44   
ref|NP_001151874.1|  LOC100285510 precursor                             162   7e-44   
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             162   7e-44   
dbj|BAJ92218.1|  predicted protein                                      162   7e-44   
emb|CAN82217.1|  hypothetical protein VITISV_020424                     162   7e-44   
dbj|BAJ85578.1|  predicted protein                                      162   7e-44   
gb|KCW51318.1|  hypothetical protein EUGRSUZ_J00874                     161   8e-44   
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             161   8e-44   
ref|XP_010458486.1|  PREDICTED: serine carboxypeptidase-like 31         162   8e-44   
emb|CDY68103.1|  BnaCnng57600D                                          155   9e-44   
gb|KJB07563.1|  hypothetical protein B456_001G032600                    162   1e-43   
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          162   1e-43   
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         162   1e-43   
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             161   1e-43   
gb|EPS67442.1|  hypothetical protein M569_07330                         160   1e-43   
ref|XP_006830191.1|  hypothetical protein AMTR_s00173p00045470          161   1e-43   
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    161   1e-43   
ref|XP_008361910.1|  PREDICTED: serine carboxypeptidase-like 34         161   2e-43   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       161   2e-43   
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       161   2e-43   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             160   2e-43   
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         160   2e-43   
gb|KDP20920.1|  hypothetical protein JCGZ_21391                         161   2e-43   
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    160   2e-43   
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         160   2e-43   
gb|KHN05141.1|  Serine carboxypeptidase II-3                            161   2e-43   
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         160   2e-43   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         160   2e-43   
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    160   2e-43   
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         160   2e-43   
ref|XP_006354981.1|  PREDICTED: serine carboxypeptidase-like 34-like    160   2e-43   
ref|XP_010501423.1|  PREDICTED: serine carboxypeptidase-like 31         162   2e-43   
ref|XP_006392053.1|  hypothetical protein EUTSA_v10023955mg             160   2e-43   
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          160   3e-43   
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    161   3e-43   
ref|NP_001047514.1|  Os02g0634700                                       160   3e-43   
ref|XP_008801742.1|  PREDICTED: serine carboxypeptidase-like 33 i...    159   3e-43   
gb|ACU18095.1|  unknown                                                 155   3e-43   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         160   3e-43   
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          160   3e-43   
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       160   3e-43   
gb|KEH32356.1|  serine carboxypeptidase-like protein                    160   3e-43   
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    160   3e-43   
gb|EEC73659.1|  hypothetical protein OsI_08191                          160   3e-43   
gb|KJB75608.1|  hypothetical protein B456_012G048700                    160   3e-43   
gb|KJB76570.1|  hypothetical protein B456_012G095000                    160   3e-43   
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         160   3e-43   
gb|KHN05312.1|  Serine carboxypeptidase II-3                            160   3e-43   
ref|XP_008801741.1|  PREDICTED: serine carboxypeptidase-like 33 i...    160   4e-43   
emb|CDP02317.1|  unnamed protein product                                160   4e-43   
gb|ACN34203.1|  unknown                                                 153   4e-43   
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         159   4e-43   
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    158   4e-43   
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    160   5e-43   
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       160   5e-43   
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           159   5e-43   
ref|XP_010907374.1|  PREDICTED: serine carboxypeptidase-like 34         158   5e-43   
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             159   6e-43   
ref|XP_010914643.1|  PREDICTED: serine carboxypeptidase-like 33         159   6e-43   
ref|XP_003550568.2|  PREDICTED: serine carboxypeptidase-like 33-like    159   6e-43   
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    159   6e-43   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              159   7e-43   
gb|KHN03262.1|  Serine carboxypeptidase-like 33                         159   7e-43   
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         159   7e-43   
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          159   7e-43   
ref|XP_008812782.1|  PREDICTED: serine carboxypeptidase-like 34         159   8e-43   
emb|CDO99599.1|  unnamed protein product                                159   8e-43   
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               159   8e-43   
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    159   8e-43   
gb|AAQ63884.1|  putative serine carboxypeptidase                        159   8e-43   
ref|XP_004231499.1|  PREDICTED: serine carboxypeptidase-like 34         159   9e-43   
gb|AAB71481.1|  similar to serine carboxypeptidases                     159   9e-43   
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          159   9e-43   
ref|XP_004508115.1|  PREDICTED: serine carboxypeptidase-like 33-like    159   9e-43   
ref|NP_176308.2|  serine carboxypeptidase-like 32                       159   1e-42   
ref|XP_009399958.1|  PREDICTED: serine carboxypeptidase II-3-like       159   1e-42   
ref|XP_008806723.1|  PREDICTED: serine carboxypeptidase-like 33 i...    159   1e-42   
ref|XP_008806724.1|  PREDICTED: serine carboxypeptidase-like 33 i...    159   1e-42   
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          159   1e-42   
ref|NP_194790.1|  serine carboxypeptidase 24                            158   1e-42   
ref|XP_002886559.1|  serine carboxypeptidase S10 family protein         158   1e-42   
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    159   1e-42   
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    159   1e-42   
ref|NP_001078615.1|  serine carboxypeptidase-like 34                    158   1e-42   
ref|XP_008663967.1|  PREDICTED: serine carboxypeptidase-like 34         159   1e-42   
ref|XP_006301480.1|  hypothetical protein CARUB_v10021903mg             158   1e-42   
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       158   1e-42   
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             158   1e-42   
gb|EEC69980.1|  hypothetical protein OsI_00486                          158   1e-42   
gb|KEH21654.1|  serine carboxypeptidase-like protein                    158   1e-42   
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             159   1e-42   
ref|XP_007148207.1|  hypothetical protein PHAVU_006G189100g             158   1e-42   
gb|AFW56972.1|  hypothetical protein ZEAMMB73_293605                    159   1e-42   
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    158   1e-42   
ref|XP_006847849.1|  hypothetical protein AMTR_s00029p00064790          158   1e-42   
ref|XP_006662015.1|  PREDICTED: serine carboxypeptidase-like 34-like    158   2e-42   
gb|ACJ85847.1|  unknown                                                 155   2e-42   
ref|NP_001044713.1|  Os01g0833500                                       158   2e-42   
ref|XP_006392050.1|  hypothetical protein EUTSA_v10023439mg             158   2e-42   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       158   2e-42   
gb|EAY76388.1|  hypothetical protein OsI_04319                          158   2e-42   
ref|XP_006287580.1|  hypothetical protein CARUB_v10000790mg             158   2e-42   
ref|XP_009104389.1|  PREDICTED: serine carboxypeptidase-like 32         158   2e-42   
ref|XP_010918383.1|  PREDICTED: serine carboxypeptidase-like 34 i...    156   2e-42   
ref|XP_010533893.1|  PREDICTED: serine carboxypeptidase-like 31 i...    157   2e-42   
ref|XP_010421120.1|  PREDICTED: serine carboxypeptidase-like 34         158   2e-42   
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    158   2e-42   
ref|NP_001140896.1|  hypothetical protein precursor                     153   2e-42   
ref|XP_006392051.1|  hypothetical protein EUTSA_v10023439mg             158   2e-42   
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       158   2e-42   
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         158   2e-42   
ref|XP_007154418.1|  hypothetical protein PHAVU_003G118000g             158   2e-42   
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       158   2e-42   
gb|AES71591.2|  serine carboxypeptidase-like protein                    158   2e-42   
ref|NP_851062.2|  serine carboxypeptidase-like 34                       158   2e-42   
ref|XP_003529505.1|  PREDICTED: serine carboxypeptidase-like 33-l...    158   2e-42   
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         158   2e-42   
ref|XP_009619884.1|  PREDICTED: serine carboxypeptidase 24-like         158   2e-42   
gb|KHN02864.1|  Serine carboxypeptidase-like 33                         157   3e-42   
gb|KFK27639.1|  hypothetical protein AALP_AA8G409500                    158   3e-42   
ref|XP_010688683.1|  PREDICTED: serine carboxypeptidase-like 34         157   3e-42   
ref|XP_009601275.1|  PREDICTED: serine carboxypeptidase-like 40         158   3e-42   
ref|XP_008365144.1|  PREDICTED: serine carboxypeptidase II-3-like       156   3e-42   
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    157   3e-42   
ref|XP_008224993.1|  PREDICTED: serine carboxypeptidase-like 31         157   3e-42   
ref|XP_010533891.1|  PREDICTED: serine carboxypeptidase-like 31 i...    157   3e-42   
ref|NP_001150705.1|  LOC100284338 precursor                             157   3e-42   
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    157   3e-42   
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34-like    157   3e-42   
ref|XP_004967063.1|  PREDICTED: serine carboxypeptidase-like 34-like    157   3e-42   
ref|XP_002316057.2|  serine carboxypeptidase S10 family protein         157   3e-42   
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         157   3e-42   
ref|NP_001042076.1|  Os01g0158200                                       157   3e-42   
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         157   4e-42   
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         157   4e-42   
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         157   4e-42   
ref|XP_003592238.1|  Serine carboxypeptidase II-3                       157   4e-42   
gb|EMT20722.1|  Serine carboxypeptidase II-3                            157   4e-42   
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       157   4e-42   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             157   5e-42   
ref|XP_010454603.1|  PREDICTED: serine carboxypeptidase-like 34         157   5e-42   
dbj|BAB08188.1|  unnamed protein product                                157   5e-42   
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         157   5e-42   
ref|XP_004986851.1|  PREDICTED: serine carboxypeptidase-like 34-like    157   5e-42   
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             157   5e-42   
ref|XP_006301500.1|  hypothetical protein CARUB_v10021926mg             157   5e-42   
ref|XP_002892617.1|  hypothetical protein ARALYDRAFT_471242             157   5e-42   
ref|XP_006583804.1|  PREDICTED: serine carboxypeptidase-like 31-l...    157   5e-42   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         157   5e-42   
ref|XP_004135951.1|  PREDICTED: serine carboxypeptidase-like 40-like    157   5e-42   
ref|NP_186860.1|  serine carboxypeptidase-like 25                       157   5e-42   
ref|XP_008802653.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    157   5e-42   
ref|XP_009398853.1|  PREDICTED: serine carboxypeptidase-like 35         157   5e-42   
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         157   6e-42   
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         157   6e-42   
ref|XP_010493441.1|  PREDICTED: serine carboxypeptidase-like 34         157   6e-42   
ref|XP_003529304.1|  PREDICTED: serine carboxypeptidase-like 31-l...    157   6e-42   
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         156   6e-42   
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       157   7e-42   
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               156   7e-42   
gb|KEH30582.1|  serine carboxypeptidase-like protein                    156   7e-42   
ref|XP_002872043.1|  SCPL34                                             157   7e-42   
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    156   7e-42   
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       156   7e-42   
ref|XP_008383787.1|  PREDICTED: serine carboxypeptidase-like 31         156   7e-42   
ref|XP_007212080.1|  hypothetical protein PRUPE_ppa005035mg             156   8e-42   
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    156   8e-42   
ref|XP_010315499.1|  PREDICTED: serine carboxypeptidase II-3-like       157   8e-42   
gb|EPS67928.1|  hypothetical protein M569_06845                         156   9e-42   
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    156   9e-42   
ref|XP_003542771.1|  PREDICTED: serine carboxypeptidase-like 31-like    156   9e-42   
gb|AAM65698.1|  putative serine carboxypeptidase II                     156   9e-42   
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         156   1e-41   
ref|NP_001141117.1|  uncharacterized protein LOC100273202 precursor     154   1e-41   
ref|XP_006303173.1|  hypothetical protein CARUB_v10008980mg             155   1e-41   
ref|XP_008461353.1|  PREDICTED: serine carboxypeptidase-like 40         156   1e-41   
ref|XP_010918382.1|  PREDICTED: serine carboxypeptidase-like 34 i...    156   1e-41   
gb|ACL53740.1|  unknown                                                 153   1e-41   
gb|KDP38391.1|  hypothetical protein JCGZ_04316                         156   1e-41   
gb|KDP38392.1|  hypothetical protein JCGZ_04317                         154   1e-41   
ref|XP_011075284.1|  PREDICTED: serine carboxypeptidase-like 34         156   1e-41   
ref|XP_010473313.1|  PREDICTED: serine carboxypeptidase-like 32         155   1e-41   
ref|XP_002317229.2|  serine carboxypeptidase S10 family protein         155   1e-41   
ref|XP_010418062.1|  PREDICTED: serine carboxypeptidase-like 32         155   1e-41   



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            MS L WG L+F L   T +  G    +S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVNSNVVQKQLDKVTKLPGQGFNVNFENYAGYVTVN  60

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +ES RALFYWFFEAV+DPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNP
Sbjct  61   EESERALFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNP  120

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            YSWNLAANLLF+DSP GVGYSYSNTSSD L +GD R
Sbjct  121  YSWNLAANLLFLDSPVGVGYSYSNTSSDHLNNGDAR  156



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   235 bits (599),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 130/156 (83%), Gaps = 2/156 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            MS L WG L+F L   T +  G     S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVDSNVVQKQLDKVSKLPGQGFNVNFENYAGYVTVN  60

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +ES RALFYWFFEAV++PSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNP
Sbjct  61   EESERALFYWFFEAVDEPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNP  120

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            YSWNLAANLLF+DSP GVGYSYSNTSSD L +GD R
Sbjct  121  YSWNLAANLLFLDSPVGVGYSYSNTSSDHLNNGDAR  156



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            +FV+L   SI G    +   Q++LD V  LPG GFNV+FAHYSGYVTVN++S RALFYWF
Sbjct  7    VFVVLGLFSISGSFSVNPNAQKQLDRVSKLPGQGFNVNFAHYSGYVTVNEDSERALFYWF  66

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
            FEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLAAN+LF
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIEKDGKTLYWNPYSWNLAANVLF  126

Query  437  VDSPAGVGYSYSNTSSDILTHGDKR  511
            +DSP GVGYSYSNTSSD L +GD R
Sbjct  127  LDSPVGVGYSYSNTSSDHLNNGDAR  151



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            +FV+L    I G    +   Q+ LD V  LPG GFNV+FAHYSGYVTVN+ES RALFYWF
Sbjct  7    VFVVLGLFFISGSFSVTPNAQKLLDRVSKLPGQGFNVNFAHYSGYVTVNEESERALFYWF  66

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
            FEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLAAN+LF
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEELGPFHIEKDGKTLYWNPYSWNLAANVLF  126

Query  437  VDSPAGVGYSYSNTSSDILTHGDKR  511
            +DSP GVGYSYSNTSSD L +GD R
Sbjct  127  LDSPVGVGYSYSNTSSDHLNNGDTR  151



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 131/162 (81%), Gaps = 8/162 (5%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATS---IDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYS  205
            MS  +W   L +++L +    I  G G     +SS +QQ+LD V  LPG  FNVSFAHYS
Sbjct  1    MSTFNWVFNLVLVILISELHLISCGAGLSSSKNSSYEQQQLDRVSKLPGQSFNVSFAHYS  60

Query  206  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  385
            GY TVN+ESGRALFYWFFEA  DPSSKP+VLWLNGGPGCSS+AFGLAEE+GPFH+EKDGK
Sbjct  61   GYATVNKESGRALFYWFFEAEVDPSSKPIVLWLNGGPGCSSVAFGLAEEIGPFHIEKDGK  120

Query  386  TLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            ++Y NPYSWN AAN+LF+DSPAGVG+SYSNTSSD+ T+GDKR
Sbjct  121  SIYLNPYSWNKAANILFLDSPAGVGFSYSNTSSDLFTNGDKR  162



>ref|XP_006453576.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66816.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=352

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 120/147 (82%), Gaps = 6/147 (4%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+DSP GVG+SYSNTSSDI T+GDKR
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKR  158



>ref|XP_010531651.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=204

 Score =   215 bits (548),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
             L+F  LLA +  G    SS  +Q+ D V  LPG GFNVSFAHYSGYVTV+++SGRALFY
Sbjct  12   ALIFFTLLANAHLGNCALSS--RQEQDRVSKLPGQGFNVSFAHYSGYVTVHEKSGRALFY  69

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WFFEAVEDP SKPL+LWLNGGPGCSSI +GLAEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  70   WFFEAVEDPDSKPLLLWLNGGPGCSSIGYGLAEEIGPFHIKPDGKTLYLNPYSWNQVANV  129

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+D P GVG+SYSNTSSD+LT+GDKR
Sbjct  130  LFLDMPVGVGFSYSNTSSDLLTNGDKR  156



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   222 bits (566),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 127/159 (80%), Gaps = 5/159 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSID--GGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M+ L+W   L +++    +     + S S D   QQ LD VL LPG  FNVSFAHY+GYV
Sbjct  1    MTTLNWVFNLSLIICVAKLHFISCRASFSPDPPNQQLLDRVLKLPGQNFNVSFAHYAGYV  60

Query  215  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            TVN+ESGRALFYWFFEA EDPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFHVEKDGKTLY
Sbjct  61   TVNKESGRALFYWFFEADEDPSSKPLVLWLNGGPGCSSIAYGLAEEIGPFHVEKDGKTLY  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD L +GDKR
Sbjct  121  LNPYSWNKVANILFLDSPVGVGFSYSNTSSDSLNNGDKR  159



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 124/160 (78%), Gaps = 5/160 (3%)
 Frame = +2

Query  47   EMSALSWGCLLFVLL-----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGY  211
            EM  L     +F+L      +  S+     +  V QQ LD VL+LPG  FN+SFAHYSGY
Sbjct  7    EMGLLQLFITIFLLFSVNLYVGASVFESTLTDPVAQQGLDRVLELPGQTFNISFAHYSGY  66

Query  212  VTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  391
            VTVNQESGR LFYWF EAVEDP SKPL+LWLNGGPGCSSIA+G AEE+GPFH+++DGKTL
Sbjct  67   VTVNQESGRNLFYWFMEAVEDPDSKPLILWLNGGPGCSSIAYGEAEEIGPFHIQRDGKTL  126

Query  392  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            Y NPYSWN  ANLLFVDSP GVG+SYSNTSSD+L +GDKR
Sbjct  127  YLNPYSWNQVANLLFVDSPVGVGFSYSNTSSDLLNNGDKR  166



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 120/147 (82%), Gaps = 6/147 (4%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+DSP GVG+SYSNTSSDI T+GDKR
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKR  158



>gb|KDO62275.1| hypothetical protein CISIN_1g0418332mg, partial [Citrus sinensis]
Length=320

 Score =   215 bits (548),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFYWF EAVEDP SKPLVLWLNG
Sbjct  67   VAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLWLNG  126

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTSSDI
Sbjct  127  GPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGFSYSNTSSDI  186

Query  491  LTHGDKR  511
             T+GDKR
Sbjct  187  TTNGDKR  193



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 120/147 (82%), Gaps = 6/147 (4%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+DSP GVG+SYSNTSSDI T+GDKR
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKR  158



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 127/160 (79%), Gaps = 8/160 (5%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSS---SVD---QQKLDAVLDLPGLGFNVSFAHYSGY  211
            M+ L+W  +L +L+    ID    SS   S D   QQ+LD VL LPG  FNVSFAHY+G+
Sbjct  1    MATLNW--VLVILISTLLIDLTNCSSCGFSADPYAQQQLDRVLHLPGQNFNVSFAHYAGF  58

Query  212  VTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  391
            VTVN+E+GR LFYWFFEA EDP+SKPLVLWLNGGPGCSSIA+G+AEE+GPFHVEKDGK L
Sbjct  59   VTVNEEAGRTLFYWFFEAAEDPASKPLVLWLNGGPGCSSIAYGVAEEIGPFHVEKDGKHL  118

Query  392  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            Y NPYSWN AAN+LF+DSP GVGYSYSNT SD L +GD R
Sbjct  119  YLNPYSWNQAANMLFLDSPVGVGYSYSNTPSDHLNNGDLR  158



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            +  V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFYWF EAVEDP SKPLVLW
Sbjct  29   TDPVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLW  88

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTS
Sbjct  89   LNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGFSYSNTS  148

Query  482  SDILTHGDKR  511
            SDI T+GDKR
Sbjct  149  SDITTNGDKR  158



>gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD V +LPG  FNVSFAHYSGYVTVN+ESGRALFYWF EAVEDP+SKPLVLWLNGGP
Sbjct  40   QQELDRVWELPGQNFNVSFAHYSGYVTVNEESGRALFYWFIEAVEDPASKPLVLWLNGGP  99

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSI FG AEE+GPFH+  DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTSSD++ 
Sbjct  100  GCSSIGFGEAEEIGPFHIHADGKTLYLNPYSWNQVANILFIDSPVGVGFSYSNTSSDLVN  159

Query  497  HGDKR  511
            +GDKR
Sbjct  160  NGDKR  164



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 123/155 (79%), Gaps = 1/155 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             SGRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  61   NSGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  120

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            SWN  AN+LF+DSP GVG+SYSNTSSD+ T+GD R
Sbjct  121  SWNQVANILFLDSPVGVGFSYSNTSSDVSTNGDIR  155



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
            FEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSWN AAN+LF
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSWNQAANILF  133

Query  437  VDSPAGVGYSYSNTSSDILTHGDKR  511
            +DSP GVG+SYSN S D+L++GD+R
Sbjct  134  LDSPVGVGFSYSNNSQDVLSNGDER  158



>gb|AFK34623.1| unknown [Lotus japonicus]
Length=174

 Score =   206 bits (523),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 117/149 (79%), Gaps = 3/149 (2%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            +L + ++AT    I+    S    QQ  D V  LPG  FN SFAHYSGY+TVN ++GRAL
Sbjct  9    ILAIAIVATLFLCINFATSSDPFVQQHHDKVGRLPGQNFNTSFAHYSGYITVNDKAGRAL  68

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYWF EA +DP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPY+WN  A
Sbjct  69   FYWFMEADQDPQSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYAWNQVA  128

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N+LFVD+PAGVG+SYSNTSSD+L HGD++
Sbjct  129  NILFVDAPAGVGFSYSNTSSDLLNHGDRK  157



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   215 bits (547),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = +2

Query  71   CLLFVLLLAT-SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            CL+ +L L   S+     ++   QQKLD V +LPG  FN+SFAH+SGYV VN+E+GRALF
Sbjct  12   CLIILLNLHLGSVFSAPPANPFAQQKLDRVAELPGQSFNLSFAHFSGYVPVNEETGRALF  71

Query  248  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            YWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY NPYSWN  AN
Sbjct  72   YWFVEAAEDPHSKPIVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLYLNPYSWNQVAN  131

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +LF DSP GVG+SYSNTSSD+L++GDKR
Sbjct  132  VLFFDSPVGVGFSYSNTSSDLLSNGDKR  159



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   215 bits (547),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
             L+F+ LLA   +   G   + +Q+ D V  LPG  FNV+F HYSG+VTVN++ GRALFY
Sbjct  17   ALIFLTLLA---NAHLGICVLSRQQQDKVSKLPGQDFNVNFEHYSGFVTVNEKLGRALFY  73

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WFFEAVEDP SKPLVLWLNGGPGCSSIAFGLAEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  74   WFFEAVEDPDSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIKPDGKTLYLNPYSWNQVANV  133

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+D+P GVGYSYSNTSSD+LT+GDKR
Sbjct  134  LFLDAPVGVGYSYSNTSSDLLTNGDKR  160



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
            FEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSWN AAN+LF
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSWNQAANILF  133

Query  437  VDSPAGVGYSYSNTSSDILTHGDKR  511
            +DSP GVG+SYSN S D+L++GD+R
Sbjct  134  LDSPVGVGFSYSNNSQDVLSNGDER  158



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 126/159 (79%), Gaps = 5/159 (3%)
 Frame = +2

Query  50   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  215  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            TVN++SGRALFYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD+L++GDKR
Sbjct  121  LNPYSWNQVANILFLDSPVGVGFSYSNTSSDLLSNGDKR  159



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 126/159 (79%), Gaps = 5/159 (3%)
 Frame = +2

Query  50   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  215  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            TVN++SGRALFYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD+L++GDKR
Sbjct  121  LNPYSWNQVANILFLDSPVGVGFSYSNTSSDLLSNGDKR  159



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVL  298
            G+S+ ++Q+ D VL LPG  FNVSFAHYSGYVTV+ + GRALFYWFFEAVEDP+SKPLVL
Sbjct  28   GASAFERQEKDRVLRLPGQSFNVSFAHYSGYVTVDDDPGRALFYWFFEAVEDPASKPLVL  87

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSSIA+GLAEE+GPFH+  DGK+LY NPY+WN  AN+LF+DSP GVG+SYSN 
Sbjct  88   WLNGGPGCSSIAYGLAEELGPFHINADGKSLYLNPYTWNQVANILFLDSPVGVGFSYSNN  147

Query  479  SSDILTHGDKR  511
            S D+LT+GDKR
Sbjct  148  SQDVLTNGDKR  158



>ref|XP_006845388.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 123/155 (79%), Gaps = 12/155 (8%)
 Frame = +2

Query  71   CLLFVLLLATSI--------DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            CLLF++ L   +        D  +G+S V+    D VL LPG  F+VSFAHYSGYVTVN+
Sbjct  7    CLLFLIHLHIFLQVKGTIVEDEDRGASQVN----DRVLKLPGQAFDVSFAHYSGYVTVNK  62

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            E+GRALFYWFFEAV+DPSSKPLV+WLNGGPGCSSIA+G AEE+GPFH+  DGKTLY NP 
Sbjct  63   EAGRALFYWFFEAVDDPSSKPLVVWLNGGPGCSSIAYGEAEEIGPFHIRPDGKTLYLNPD  122

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            SWN  ANLLFVDSP GVG+SYSNTS DI+++GDKR
Sbjct  123  SWNQVANLLFVDSPVGVGFSYSNTSEDIISNGDKR  157



>gb|KDP38716.1| hypothetical protein JCGZ_04069 [Jatropha curcas]
Length=266

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 118/152 (78%), Gaps = 9/152 (6%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            CL F++ L      G G     S  + QQ+LD VL LPG  F+VSFAHYSGYVTVN+ESG
Sbjct  21   CLFFLINLYV----GTGVAFSLSDPIAQQELDRVLGLPGQTFDVSFAHYSGYVTVNEESG  76

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RA FYWF EAVEDP SKPLVLWLNG PGCSSI +G AEEVG F+++ DGKTLY NPYSWN
Sbjct  77   RAFFYWFMEAVEDPESKPLVLWLNGRPGCSSIGYGEAEEVGLFYIQADGKTLYLNPYSWN  136

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
              AN+LF+DSP GVG+SYSNTSSD+L +GDKR
Sbjct  137  NVANILFIDSPVGVGFSYSNTSSDVLNNGDKR  168



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 4/148 (3%)
 Frame = +2

Query  68   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            G   F+L+LA+S++    +S  +QQ  + VL LPG  F+VSFAHYSGYVTVN+E+GRA F
Sbjct  17   GPFFFLLVLASSLE----ASVFEQQARERVLRLPGQSFDVSFAHYSGYVTVNEEAGRAFF  72

Query  248  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            YWFFEA E+P+SKPLVLWLNGGPGCSSI  GLAEEVGPFHV  DGK+LY NPYSWN  AN
Sbjct  73   YWFFEATEEPASKPLVLWLNGGPGCSSIGLGLAEEVGPFHVNADGKSLYPNPYSWNQVAN  132

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +LF+DSP G G++YSN S D+LT+GDKR
Sbjct  133  ILFLDSPVGAGFAYSNNSQDVLTNGDKR  160



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLWLNG  97

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGYSYSNTSSDL  157

Query  491  LTHGDKR  511
            L +GDK+
Sbjct  158  LNNGDKK  164



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLWLNG  97

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGYSYSNTSSDL  157

Query  491  LTHGDKR  511
            L +GDK+
Sbjct  158  LNNGDKK  164



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  2    ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  61

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             +GRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  62   YTGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  121

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            SWN AAN+LF+D P GVG+SYSN+S DI ++GD R
Sbjct  122  SWNQAANILFLDFPVGVGFSYSNSSFDISSNGDLR  156



>gb|KJB76660.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=407

 Score =   210 bits (535),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  260  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  439
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN  AN+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVANILFL  138

Query  440  DSPAGVGYSYSNTSSDILTHGDKR  511
            +SP GVG+SYSNTSSD+L +GDKR
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKR  162



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  42   ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  101

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             +GRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  102  YTGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  161

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            SWN AAN+LF+D P GVG+SYSN+S DI ++GD R
Sbjct  162  SWNQAANILFLDFPVGVGFSYSNSSFDISSNGDLR  196



>ref|XP_011018072.1| PREDICTED: serine carboxypeptidase-like 29 isoform X2 [Populus 
euphratica]
Length=410

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+L LNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLRLNG  97

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSPAGVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPAGVGYSYSNTSSDL  157

Query  491  LTHGDKR  511
            L +GDK+
Sbjct  158  LNNGDKK  164



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 123/159 (77%), Gaps = 5/159 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSS-----VDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M+   W   L VL++  ++  G   S+     + QQ LD V  LPG  FN+SFAH+SGYV
Sbjct  1    MAKPRWDSALKVLIILLNLHLGSVFSAPPADPIAQQNLDRVAXLPGQSFNLSFAHFSGYV  60

Query  215  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
             VN++SGRALFYWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY
Sbjct  61   PVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLY  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             NPYSWN  AN+LF DSP GVG+SYSNTSSD+L++GDKR
Sbjct  121  LNPYSWNQVANVLFFDSPVGVGFSYSNTSSDLLSNGDKR  159



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 122/149 (82%), Gaps = 5/149 (3%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVD-----QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            FVL+   ++  G   ++V      QQ+LD V  LPG  FNVSFAHY+GYV VN+++GRAL
Sbjct  8    FVLIFLLNLHLGSVFATVPTDPLVQQQLDRVHGLPGQTFNVSFAHYAGYVNVNEDAGRAL  67

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYWF EA EDP+SKPLVLWLNGGPGCSSIA+G+AEEVGPFH++ DGKTLY NPYSWN  A
Sbjct  68   FYWFVEAAEDPTSKPLVLWLNGGPGCSSIAYGMAEEVGPFHIQADGKTLYLNPYSWNQVA  127

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N+LF+DSP GVG+SYSNTSSD++++GDKR
Sbjct  128  NILFLDSPVGVGFSYSNTSSDLMSNGDKR  156



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD VL+LPG  FNVSFAHY+GYVTVN+ SGRALFYWFFEAVEDPSSKPLVLWLNGGP
Sbjct  48   QQQLDRVLELPGQTFNVSFAHYAGYVTVNEASGRALFYWFFEAVEDPSSKPLVLWLNGGP  107

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G AEE+GPFH++ DGKTLY N YSWN  AN+LF++SP GVG+SYSN S D+L 
Sbjct  108  GCSSIAYGEAEEIGPFHIKADGKTLYLNQYSWNQVANVLFLESPVGVGFSYSNNSLDVLN  167

Query  497  HGDKR  511
            +GDKR
Sbjct  168  NGDKR  172



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 117/141 (83%), Gaps = 5/141 (4%)
 Frame = +2

Query  89   LLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAV  268
            ++ATS++      SV QQKLD V  LPG  FNVSFAHY+GYVTVN+ SGRALFYWFFEA 
Sbjct  27   VIATSLE-----DSVAQQKLDKVPKLPGQNFNVSFAHYAGYVTVNEGSGRALFYWFFEAA  81

Query  269  EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSP  448
            EDP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  ANLLF++SP
Sbjct  82   EDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTLYLNPYSWNKVANLLFLESP  141

Query  449  AGVGYSYSNTSSDILTHGDKR  511
             GVG+SYSNTS D+L +GDKR
Sbjct  142  IGVGFSYSNTSFDLLNNGDKR  162



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  260  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  439
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN  AN+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVANILFL  138

Query  440  DSPAGVGYSYSNTSSDILTHGDKR  511
            +SP GVG+SYSNTSSD+L +GDKR
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKR  162



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            +QQ+LD V  LPG  F+V+FA Y+GYVTVN+ESGRA FYWFFEA EDPSSKPL+LWLNGG
Sbjct  6    NQQELDRVSKLPGQNFDVNFASYAGYVTVNEESGRAYFYWFFEADEDPSSKPLLLWLNGG  65

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSSIA+GLAEEVGPFH+EKDGKTLY N +SWN  AN+LFVDSP GVG+SYSNTSSD+L
Sbjct  66   PGCSSIAYGLAEEVGPFHIEKDGKTLYLNQFSWNKVANVLFVDSPVGVGFSYSNTSSDLL  125

Query  494  THGDKR  511
             +GDKR
Sbjct  126  NNGDKR  131



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+L LNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLRLNG  97

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSPAGVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPAGVGYSYSNTSSDL  157

Query  491  LTHGDKR  511
            L +GDK+
Sbjct  158  LNNGDKK  164



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   209 bits (533),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 121/154 (79%), Gaps = 1/154 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+     CL  + +LA +       + + Q++ D V  LPG  FNVSFAHYSGYVT N++
Sbjct  1    MAKTRGSCLFAITILAIA-HFCNCEAVLSQKEQDKVSTLPGQDFNVSFAHYSGYVTTNEK  59

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYWFFEAVED +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAVEDANSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYS  119

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            WN AAN+LF+D+P GVGYSYSNTSSD+L++GDKR
Sbjct  120  WNQAANILFLDAPVGVGYSYSNTSSDLLSNGDKR  153



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNKHSGRALFYWFF  78

Query  260  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  439
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN   N+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVVNILFL  138

Query  440  DSPAGVGYSYSNTSSDILTHGDKR  511
            +SP GVG+SYSNTSSD+L +GDKR
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKR  162



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVL  298
            G S   +Q+ D V  LPG  FNVSFAHY+GYVTVN++SGRALFYWFFEAVEDP SKPLVL
Sbjct  26   GGSPFVRQEGDRVQRLPGQSFNVSFAHYAGYVTVNEDSGRALFYWFFEAVEDPVSKPLVL  85

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSSIA+GLAEEVGPFHV  DG++LY NPYSWN  AN+LF+DSP GVG+SYSN 
Sbjct  86   WLNGGPGCSSIAYGLAEEVGPFHVNADGQSLYLNPYSWNQVANILFLDSPVGVGFSYSNN  145

Query  479  SSDILTHGDKR  511
            S D+L++GD+R
Sbjct  146  SQDVLSNGDER  156



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIAFG AEE+GPFH+  DGK++Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  92   GCSSIAFGEAEEIGPFHINADGKSVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  151

Query  497  HGDKR  511
            +GDKR
Sbjct  152  NGDKR  156



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LFYWF EA EDP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G+AEE+GPFH+  D  +LY NPYSWNL ANLLF+DSP GVG+SYSNTSSD+L 
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSWNLVANLLFIDSPVGVGFSYSNTSSDLLN  154

Query  497  HGDKR  511
            +GDKR
Sbjct  155  NGDKR  159



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LFYWF EA EDP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G+AEE+GPFH+  D  +LY NPYSWNL ANLLF+DSP GVG+SYSNTSSD+L 
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSWNLVANLLFIDSPVGVGFSYSNTSSDLLN  154

Query  497  HGDKR  511
            +GDKR
Sbjct  155  NGDKR  159



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   LLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA  265
            L L T       S  + QQK+D V  LPG  F+V+F HYSGY+TVN+E GRALFYWF EA
Sbjct  22   LQLGTCSSSSSSSDPITQQKIDRVNYLPGQNFDVAFTHYSGYITVNEEFGRALFYWFIEA  81

Query  266  VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDS  445
            VEDPSSKPL+LWLNGGPGCSSIAFG AEE+GPFH++KDGKTLY NP SWN  AN++F+D+
Sbjct  82   VEDPSSKPLLLWLNGGPGCSSIAFGEAEELGPFHIQKDGKTLYLNPNSWNKVANVIFLDA  141

Query  446  PAGVGYSYSNTSSDILTHGDKR  511
            P GVG+SYSNT+SD+LT+GD R
Sbjct  142  PVGVGFSYSNTTSDLLTNGDNR  163



>ref|XP_006387151.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
 gb|ERP46065.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
Length=324

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 110/133 (83%), Gaps = 6/133 (5%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            V QQ LD V  LPG  F+V+FAHYSGYVTVN++ GRALFYW  EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVQKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWLVEAVEDPQSKPLLLWLNG  97

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN------LAANLLFVDSPAGVGYSYS  472
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN        AN+LF+DSP GVGYSYS
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQYFNQFAVANILFLDSPVGVGYSYS  157

Query  473  NTSSDILTHGDKR  511
            NTSSD+L +GDK+
Sbjct  158  NTSSDLLNNGDKK  170



>ref|XP_004162685.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G AEE+GPFH+  DGK++Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  92   GCSSIAYGEAEEIGPFHINADGKSVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  151

Query  497  HGDKR  511
            +GDKR
Sbjct  152  NGDKR  156



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 117/147 (80%), Gaps = 2/147 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
             L+ + LLAT+    +   S  +Q  D V  LPG  FNVSFAHYSG++T N++ GRALFY
Sbjct  12   ALIAIALLATTAHLCEAGLSRKEQ--DKVSKLPGQNFNVSFAHYSGFITTNEKLGRALFY  69

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WFFEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  70   WFFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  129

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+D+P GVGYSYSNTSSD+ T+GDKR
Sbjct  130  LFLDAPVGVGYSYSNTSSDLQTNGDKR  156



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G AEE+GPFH+  DGK +Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  92   GCSSIAYGEAEEIGPFHINADGKPVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  151

Query  497  HGDKR  511
            +GDKR
Sbjct  152  NGDKR  156



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            + QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNG
Sbjct  104  LRQQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNG  163

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G AEE+GPFH+  DGK +Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD+
Sbjct  164  GPGCSSIAYGEAEEIGPFHINADGKPVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDL  223

Query  491  LTHGDKR  511
            + +GDKR
Sbjct  224  MNNGDKR  230



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
             L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALFY
Sbjct  14   ALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALFY  70

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            W FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  71   WLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYSWNQAANI  130

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+D+P GVGYSYSNTSSD+ T+GDKR
Sbjct  131  LFLDAPVGVGYSYSNTSSDLQTNGDKR  157



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 118/152 (78%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            A +  C ++ +++   +   +   S   Q  D V +LPG  FNV+FAHYSG+VT N++ G
Sbjct  16   AKTRSCFVYAIIVIAHLCNCEAVLSEKDQ--DKVWNLPGQNFNVNFAHYSGFVTTNEKMG  73

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYW FEA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +SWN
Sbjct  74   RALFYWLFEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHSWN  133

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             AAN+LF+D+P GVGYSYSNTSSD+LT+GDKR
Sbjct  134  QAANILFLDAPVGVGYSYSNTSSDLLTNGDKR  165



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALFYW
Sbjct  14   LIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFNVSFAHYSGFVTTNEKLGRALFYW  70

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
             FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+L
Sbjct  71   LFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYSWNQAANIL  130

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F+D+P GVGYSYSNTSSD+ T+GDKR
Sbjct  131  FLDAPVGVGYSYSNTSSDLKTNGDKR  156



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            + Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALFYW FEAVED  SKPLVLWLNG
Sbjct  30   LSQKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALFYWLFEAVEDAKSKPLVLWLNG  89

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVGYSYSNTSSD+
Sbjct  90   GPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANILFLDAPVGVGYSYSNTSSDL  149

Query  491  LTHGDKR  511
             T+GDKR
Sbjct  150  QTNGDKR  156



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 118/154 (77%), Gaps = 2/154 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+     C ++ +L    +   +  + + Q++ D V  LPG  FNV+FAHYSG+VT N++
Sbjct  1    MAKTRRSCFVYAILAIAHLCNCE--AILSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNEK  58

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYW FEA EDP+ KPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +S
Sbjct  59   MGRALFYWLFEAAEDPAYKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHS  118

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            WN AAN+LF+D+P GVGYSYSNTSSD+LT+GDKR
Sbjct  119  WNQAANILFLDAPVGVGYSYSNTSSDLLTNGDKR  152



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 117/157 (75%), Gaps = 3/157 (2%)
 Frame = +2

Query  50   MSALSWGCL---LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  220
            M+   W C    LF + +          S + +++ + V  LPG  FNV+FAHYSG+VT 
Sbjct  1    MAKTRWSCFVNALFAIAVLAIAHFSNCESVLSEKEQNKVSKLPGQNFNVNFAHYSGFVTT  60

Query  221  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  400
            N++ GRALFYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  61   NEKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLN  120

Query  401  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             YSWN AAN+LF+D+P GVG+SYSNTSSD+LT+GDKR
Sbjct  121  QYSWNQAANILFLDAPVGVGFSYSNTSSDLLTNGDKR  157



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            + Q++ D V  LPG  FNV+FAHYSG+VT N++ GRALFYW FEA EDP+SKPLVLWLNG
Sbjct  63   LSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDPASKPLVLWLNG  122

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+ FG AEE+GPFH++ DGKTLY N +SWN AAN+LF+D+P GVGYSYSNTSSD 
Sbjct  123  GPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHSWNQAANILFLDAPVGVGYSYSNTSSDF  182

Query  491  LTHGDKR  511
            LT+GDKR
Sbjct  183  LTNGDKR  189



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 116/154 (75%), Gaps = 1/154 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+R
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQR  153



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 116/154 (75%), Gaps = 1/154 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+R
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQR  153



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
             L+ +  LAT+     G S   Q++ D V  LPG  F+VSFAHYSG+VT N++ GRALFY
Sbjct  32   ALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFDVSFAHYSGFVTTNEKLGRALFY  88

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            W FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  89   WLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  148

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+D+P GVGYSYSNTSSD+ T+GDKR
Sbjct  149  LFLDAPVGVGYSYSNTSSDLQTNGDKR  175



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 122/157 (78%), Gaps = 3/157 (2%)
 Frame = +2

Query  50   MSALSWGCLLFVL-LLATS-IDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  220
            MS  S   +L VL LLA S     +GSSS   +Q+ D V  +PG GFN SFAHY+GYVTV
Sbjct  1    MSGASRCAVLAVLFLLAVSGAAAAEGSSSWRGEQERDRVPRVPGQGFNASFAHYAGYVTV  60

Query  221  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  400
            ++E G ALFYWFFEA  +P+SKPLVLWLNGGPGCSSIAFGL EEVGPFH+  DGK ++ N
Sbjct  61   SEERGAALFYWFFEAAHEPASKPLVLWLNGGPGCSSIAFGLGEEVGPFHINADGKGVHMN  120

Query  401  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            PYSWN  AN+LF+DSP GVGYSYSNTS DIL++GD++
Sbjct  121  PYSWNRVANILFLDSPVGVGYSYSNTSGDILSNGDEK  157



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C + V+ L          + + Q++ D V  LPG  FNV FAHYSG+VT N++ GRALFY
Sbjct  9    CFVVVVALLAITHLCICEALLSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALFY  68

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  69   WFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  128

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+D+P GVGYSYSNTSSD+ ++GDKR
Sbjct  129  LFLDAPVGVGYSYSNTSSDLRSNGDKR  155



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  1    MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  58

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +++GR LFYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NP
Sbjct  59   EKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNP  118

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            YSWN  AN+LF+D+P GVG+SYSN  SD+L +GD+R
Sbjct  119  YSWNRVANILFLDTPVGVGFSYSNNKSDMLINGDER  154



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  15   MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  72

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +++GR LFYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NP
Sbjct  73   EKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNP  132

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            YSWN  AN+LF+D+P GVG+SYSN  SD+L +GD+R
Sbjct  133  YSWNRVANILFLDTPVGVGFSYSNNKSDMLINGDER  168



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 123/183 (67%), Gaps = 29/183 (16%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             SGRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  61   NSGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  120

Query  407  SWN----------------------------LAANLLFVDSPAGVGYSYSNTSSDILTHG  502
            SWN                              AN+LF+DSP GVG+SYSNTSSD+ T+G
Sbjct  121  SWNQDIDLQVKVYMFRRNNDVRFSIAERISITIANILFLDSPVGVGFSYSNTSSDVSTNG  180

Query  503  DKR  511
            D R
Sbjct  181  DIR  183



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 116/147 (79%), Gaps = 1/147 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C + V LLA +       + + Q++ D V  LPG  FNV FAHYSG+VT N++ GRALFY
Sbjct  9    CFVVVALLAIT-HLCICEALLSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALFY  67

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  68   WFFEAADDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  127

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+D+P GVGYSYSNTS+D+ ++GDKR
Sbjct  128  LFLDAPVGVGYSYSNTSTDLRSNGDKR  154



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   197 bits (502),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+V  N++ GRALFYW
Sbjct  14   LIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALFYW  70

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
             FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N YSWN AAN+L
Sbjct  71   LFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQYSWNQAANIL  130

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F+D+P GVGYSYSNTSSD+ ++GDKR
Sbjct  131  FLDAPVGVGYSYSNTSSDLKSNGDKR  156



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  304
            S + +++ D V  LPG  FNV+FAHYSG+VT N++ GRALFYW  EA EDP+SKPLVLWL
Sbjct  29   SVLSEKEQDKVSKLPGQNFNVNFAHYSGFVTTNEKLGRALFYWLIEAAEDPASKPLVLWL  88

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+ FG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVG+SYSNTSS
Sbjct  89   NGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQYSWNQAANILFLDAPVGVGFSYSNTSS  148

Query  485  DILTHGDKR  511
            D+LT+GDKR
Sbjct  149  DLLTNGDKR  157



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 116/147 (79%), Gaps = 1/147 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C + V LLA +      ++ + Q++ D V  LPG  FNV F HYSG+VT N++ GRALFY
Sbjct  9    CFVVVALLAIT-HLCICAALLSQKEQDKVSKLPGQNFNVDFTHYSGFVTTNEKLGRALFY  67

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  68   WFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  127

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+D+P GVGYSYSNTSSD+ ++GDKR
Sbjct  128  LFLDAPVGVGYSYSNTSSDLRSNGDKR  154



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+V  N++ GRALFYW
Sbjct  14   LIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALFYW  70

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
             FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N YSWN AAN+L
Sbjct  71   LFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQYSWNQAANIL  130

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F+D+P GVGYSYSNTSSD+ ++GDKR
Sbjct  131  FLDAPVGVGYSYSNTSSDLKSNGDKR  156



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 117/154 (76%), Gaps = 1/154 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W CL  + LLA +       + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWSCLA-IALLAIARFCNCEEAVLCQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYW FEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWLFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+R
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQR  153



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   196 bits (499),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
            + Q+  D V  LPG  FNV FAHYSG+VT N++ GRALFYW FEA ED  SKPLVLWLNG
Sbjct  31   LSQKAQDKVSILPGQNFNVDFAHYSGFVTTNEKLGRALFYWLFEATEDAESKPLVLWLNG  90

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVGYSYSNTSSD+
Sbjct  91   GPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYSWNQAANILFLDAPVGVGYSYSNTSSDL  150

Query  491  LTHGDKR  511
             ++GDKR
Sbjct  151  RSNGDKR  157



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 108/144 (75%), Gaps = 19/144 (13%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG-  313
            QQ+LD V  LPG  F VSF HYSGYV VN+ESGRALFYWFFEA EDP+SKP+VLWLNGG 
Sbjct  38   QQRLDRVEKLPGQNFIVSFEHYSGYVRVNEESGRALFYWFFEAAEDPASKPIVLWLNGGL  97

Query  314  ------------------PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  439
                              PGCSSIA+G AEE+GPFH++ D KTLY NPYSWN  AN+LF+
Sbjct  98   PALLVFHLLCLVTMKSLGPGCSSIAYGEAEEIGPFHIKPDAKTLYLNPYSWNQVANILFI  157

Query  440  DSPAGVGYSYSNTSSDILTHGDKR  511
            DSP GVG+SYSN SSD+L++GDKR
Sbjct  158  DSPVGVGFSYSNASSDLLSNGDKR  181



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIAFG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL+
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILS  147

Query  497  HGDKR  511
            +GD+R
Sbjct  148  NGDER  152



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIAFG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL+
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILS  147

Query  497  HGDKR  511
            +GD+R
Sbjct  148  NGDER  152



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 119/158 (75%), Gaps = 5/158 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDG----GKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            M+     C ++VL  A ++ G        + + +++ D V  LPG  FNV+FA YSG+VT
Sbjct  1    MAKTRGSCFVYVLF-AIAVLGIAHFCNCEAVLSEKEQDKVSKLPGQNFNVNFAQYSGFVT  59

Query  218  VNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  397
             N++ GRALFYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY 
Sbjct  60   TNEKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYL  119

Query  398  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N YSWN AAN+LF+D+P GVG+SYSNTSSD++T+GDKR
Sbjct  120  NQYSWNQAANILFLDAPVGVGFSYSNTSSDLVTNGDKR  157



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C   +LL +           + QQ  D V  LPG  FNVSFAHY+GY+TV + +GR LFY
Sbjct  10   CFATLLLCSAFATSFSTDPPLLQQHKDRVGRLPGQNFNVSFAHYAGYITVEENAGRTLFY  69

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            WF EA+EDP SKPLVLWLNGGPGCSSIAFG +EE+GPFH+  DGKTL+ NPYSWN  AN+
Sbjct  70   WFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEIGPFHINPDGKTLHPNPYSWNRVANI  129

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+D+P GVG+SYSN  S++L +GD R
Sbjct  130  LFLDTPVGVGFSYSNNGSELLNNGDNR  156



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSK  286
            DG   ++   +Q+ D V  +PG  F+V FA Y+GYVTV++E G ALFYWFFEA EDP+SK
Sbjct  33   DGEAAATWRAEQEWDRVARVPGQDFDVGFAQYAGYVTVSEERGAALFYWFFEAAEDPASK  92

Query  287  PLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYS  466
            PLVLWLNGGPGCSSIA+G+AEEVGPFHV  DG+ ++ NPYSWN  AN+LF+DSP GVGYS
Sbjct  93   PLVLWLNGGPGCSSIAYGVAEEVGPFHVNADGQGVHLNPYSWNQVANILFLDSPVGVGYS  152

Query  467  YSNTSSDILTHGDKR  511
            YSN S DIL +GD R
Sbjct  153  YSNVSDDILNNGDAR  167



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 118/163 (72%), Gaps = 8/163 (5%)
 Frame = +2

Query  47   EMSALSWGCLLF--VLLLAT----SIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYS  205
            EM+   W  +    +L+LAT    SI     +    QQ  D +   LPG  FN++F HYS
Sbjct  10   EMARFEWSQIWVTDILILATLFLCSISFAIATDPFVQQGKDRIGRALPGQNFNINFEHYS  69

Query  206  GYVTVNQESGRALFYWFFEAV-EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDG  382
            GY+TVN+++GR LFYWF EA  +DP+SKPL+LW NGGPGCSSIAFG AEE+GPFH+  DG
Sbjct  70   GYITVNEDTGRNLFYWFIEAEHQDPTSKPLLLWFNGGPGCSSIAFGEAEEIGPFHINPDG  129

Query  383  KTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             TLY NPYSWN  AN+LFVDSP GVG+SYSNTSS++L +GDKR
Sbjct  130  NTLYLNPYSWNQVANILFVDSPVGVGFSYSNTSSELLNNGDKR  172



>gb|ABK24285.1| unknown [Picea sitchensis]
Length=450

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL V L +T+    + S+  D   +Q  D +  LPG   NV+FA YSGY+TV+  +GRAL
Sbjct  18   LLLVALQSTATSTWEESNERDWRNEQAKDRITQLPGQPSNVNFAQYSGYITVDNNAGRAL  77

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYW  EA E+PSSKPLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+LY NPYSWN  A
Sbjct  78   FYWLIEATENPSSKPLVLWLNGGPGCSSVAYGEAEELGPFHINADGKSLYLNPYSWNKLA  137

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N+LF+DSPAGVG+SY+NTSSDI   GD+R
Sbjct  138  NILFLDSPAGVGFSYTNTSSDISQSGDRR  166



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            ++Q  D V  +PG  F+ S+AHY+GYVTV++  G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFDTSYAHYAGYVTVSEPRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSSIA+GL EEVGPFHV  DGK ++ NPYSWN  ANLLFVDSP GVGYSYSNTS DIL
Sbjct  92   PGCSSIAYGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFVDSPVGVGYSYSNTSDDIL  151

Query  494  THGDKR  511
             +GD R
Sbjct  152  RNGDAR  157



>gb|AFW85537.1| hypothetical protein ZEAMMB73_208131 [Zea mays]
Length=432

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSSIAFGL EEVGPFHV  DGK ++ NPYSWN  ANLLF+DSP GVGYSYSNTS D L
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFLDSPVGVGYSYSNTSDDAL  151

Query  494  THGDKR  511
             +GD R
Sbjct  152  KNGDAR  157



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            +  + +QKLD VL LPG  FN+SFAHYSGY+TVN  +G+A FYWF E+ EDPSSKPL LW
Sbjct  47   ADKIIEQKLDQVLKLPGQNFNLSFAHYSGYITVNASAGKAFFYWFVESAEDPSSKPLALW  106

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGP CSSIAFG AEE+GPF    DGK++Y NPY+WN  AN++FV+SPAG G+SYSNTS
Sbjct  107  LNGGPACSSIAFGEAEEIGPFRPTADGKSVYLNPYAWNQVANIIFVESPAGTGFSYSNTS  166

Query  482  SDILTHGDK  508
            SD+   GD+
Sbjct  167  SDLYNTGDR  175



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSSIAFGL EEVGPFHV  DGK ++ NPYSWN  ANLLF+DSP GVGYSYSNTS D L
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFLDSPVGVGYSYSNTSDDAL  151

Query  494  THGDKR  511
             +GD R
Sbjct  152  KNGDAR  157



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +2

Query  155  VLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIA  334
            V  +PG  F+ SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGPGCSSIA
Sbjct  1    VPRVPGQAFDASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIA  60

Query  335  FGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            FG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL++GD+R
Sbjct  61   FGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILSNGDER  119



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   188 bits (477),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = +2

Query  137  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  310
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LFYWF EA   DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G AEE+GPFH+  DG TL+ NPYSWN  AN+L +DSP GVG+SYSN SSDI
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNPYSWNQVANILLIDSPVGVGFSYSNASSDI  153

Query  491  LTHGDKR  511
            L +GDKR
Sbjct  154  LNNGDKR  160



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            +Q+ D V  +PG  F+V FA Y+GYV V++E G +LFYWFFEA +DP+SKPLVLWLNGGP
Sbjct  43   EQERDRVARVPGQDFDVGFAQYAGYVAVSEERGASLFYWFFEAADDPASKPLVLWLNGGP  102

Query  317  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  496
            GCSSIA+G+AEEVGPFHV  DG+ ++ NPYSWN  AN+LF+DSP GVGYSYSN S DIL 
Sbjct  103  GCSSIAYGVAEEVGPFHVNADGQGVHLNPYSWNQVANILFLDSPVGVGYSYSNASDDILN  162

Query  497  HGDKR  511
            +GD R
Sbjct  163  NGDAR  167



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 113/159 (71%), Gaps = 5/159 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAV-LDLPGLGFNVSFAHYSGYVT  217
            M+   W  +  + L    +     + + D   QQ+ D +   LPG  FN+SF HYSGY+T
Sbjct  1    MANSEWSQIFAITLATIFLCNNNFTFATDPFVQQEQDRIDRPLPGQNFNISFEHYSGYIT  60

Query  218  VNQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            VN+++GR LFYWF +A   DP+S PL+LWLNGGPGCSSIAFG AEE+GPFH+  D KTLY
Sbjct  61   VNEDAGRNLFYWFIQADHVDPTSMPLLLWLNGGPGCSSIAFGEAEEIGPFHINSDSKTLY  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             NPYSWN  AN+L++DSP GVG+SYS  SSDILT+GDKR
Sbjct  121  LNPYSWNQVANILYIDSPVGVGFSYSKNSSDILTNGDKR  159



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDAQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSDHPESKPLVLW  77

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+AFG AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAFGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  482  SDILTHGDKR  511
            SD+ T GD+R
Sbjct  138  SDLYTAGDQR  147



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 112/149 (75%), Gaps = 2/149 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALFY
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  251  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            W  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY+WN  A
Sbjct  63   WLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPYAWNNLA  122

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N+LF+DSPAGVG+SYSNT+SD+ T GD+R
Sbjct  123  NILFLDSPAGVGFSYSNTTSDLYTAGDQR  151



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDAQEKDRISRLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSQHPESKPLVLW  77

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  482  SDILTHGDKR  511
            SD+ T GD+R
Sbjct  138  SDLYTAGDQR  147



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDSQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSDHPESKPLVLW  77

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  482  SDILTHGDKR  511
            SD+ T GD+R
Sbjct  138  SDLYTAGDQR  147



>gb|KJB78940.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
 gb|KJB78941.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=375

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 109/148 (74%), Gaps = 6/148 (4%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             LF++SPAGVG+SY+NT+SD+ T GDKR
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKR  152



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  295
            SS +  Q+ D ++ LPG   NV F+ YSGYVTVNQ++GRALFYW  EA  +  P S+PLV
Sbjct  23   SSPLQDQERDRIIQLPGQPNNVGFSQYSGYVTVNQQAGRALFYWLVEAPANRRPESRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPFH+  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFHIRSDGKTLFLNPYAWNNLANLLFLESPAGVGFSYSN  142

Query  476  TSSDILTHGDKR  511
            TSSD+ T GD+R
Sbjct  143  TSSDLYTAGDQR  154



>ref|XP_002534550.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF27834.1| serine carboxypeptidase, putative [Ricinus communis]
Length=385

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 111/148 (75%), Gaps = 3/148 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L F  LL ++I   +  S+ ++Q+ D ++ LPG   NV F+ YSGYVTV+  +GRALFYW
Sbjct  16   LSFATLLLSTI-SARLISNKEEQERDRIIKLPGQPPNVYFSQYSGYVTVDPLAGRALFYW  74

Query  254  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTLY NPY+WN  AN
Sbjct  75   LIEAPKMARPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLYLNPYTWNKVAN  134

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LLF+DSPAGVG+SYSNTSSDI   GDKR
Sbjct  135  LLFLDSPAGVGFSYSNTSSDIYAVGDKR  162



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 112/149 (75%), Gaps = 3/149 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C + +L L + +  G   S++DQ++ D +  LPG   NV F  YSGY+TVNQ+SGRALFY
Sbjct  10   CAICILWLNSFVGIGYSLSNLDQER-DRITYLPGQPQNVGFNQYSGYITVNQQSGRALFY  68

Query  251  WFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            W  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  A
Sbjct  69   WLTEAPAYRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYLNPYSWNKLA  128

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            NLLF++SPAGVG+SYSNTSSD+ T GD+R
Sbjct  129  NLLFLESPAGVGFSYSNTSSDLYTVGDQR  157



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 6/148 (4%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             LF++SPAGVG+SY+NT+SD+ T GDKR
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKR  152



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 114/160 (71%), Gaps = 6/160 (4%)
 Frame = +2

Query  50   MSALSWGCLLFVLL--LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYSGYVTV  220
            M+   W  +LF+++  LA        +    QQ  D +   LPG  FN+SF HYSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  221  NQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  397
            N++ GR LFYWF +A   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DGK L++
Sbjct  61   NEDVGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHF  120

Query  398  NPYSWNLAANLLFVDSPAGVGYSYS--NTSSDILTHGDKR  511
            NPYSWN  AN+L++DSP GVG+SYS  N+S DIL +GDKR
Sbjct  121  NPYSWNQVANILYIDSPVGVGFSYSTKNSSDDILNNGDKR  160



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   183 bits (464),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = +2

Query  137  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  310
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LFYWF EA   DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSSIA+G AEE+GPFH+  DG TL+ NPYSWN  AN+L +DSP GVG+SYSN SSDI
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNPYSWNQVANILLIDSPVGVGFSYSNASSDI  153

Query  491  LTHGDKR  511
            L +GDKR
Sbjct  154  LNNGDKR  160



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   182 bits (463),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQ-QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            L FV++L   +  G   S ++Q Q+ D +  LPG   NV F  YSGYVTVN+++GRALFY
Sbjct  8    LFFVVVLPLFLLFGTCYSRINQDQERDRIKSLPGQPANVDFDQYSGYVTVNKKAGRALFY  67

Query  251  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            WF E  A   P S+PL+LWLNGGPGCSS+A+G  EE+GPF V+ DGKTL++NPYSWN  A
Sbjct  68   WFIESPASRAPESRPLLLWLNGGPGCSSVAYGATEEIGPFRVKPDGKTLFFNPYSWNKLA  127

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            NLLFV+SPAGVG+SYSNTSSD+ T GD+R
Sbjct  128  NLLFVESPAGVGFSYSNTSSDLYTAGDQR  156



>gb|KJB78942.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=422

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 109/148 (74%), Gaps = 6/148 (4%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             LF++SPAGVG+SY+NT+SD+ T GDKR
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKR  152



>gb|KJB78939.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=432

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 109/148 (74%), Gaps = 6/148 (4%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             LF++SPAGVG+SY+NT+SD+ T GDKR
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKR  152



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 114/160 (71%), Gaps = 6/160 (4%)
 Frame = +2

Query  50   MSALSWGCLLFVLL--LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYSGYVTV  220
            M+   W  +LF+++  LA        +    QQ  D +   LPG  FN+SF HYSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  221  NQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  397
            N++ GR LFYWF +A   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DGK L++
Sbjct  61   NEDVGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHF  120

Query  398  NPYSWNLAANLLFVDSPAGVGYSYS--NTSSDILTHGDKR  511
            NPYSWN  AN+L++DSP GVG+SYS  N+S DIL +GDKR
Sbjct  121  NPYSWNQVANILYIDSPVGVGFSYSTKNSSDDILNNGDKR  160



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 103/131 (79%), Gaps = 2/131 (2%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVL  298
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  EA     P S+PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPESRPLVL  82

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  ANLLF++SPAGVG+SYSNT
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLANLLFLESPAGVGFSYSNT  142

Query  479  SSDILTHGDKR  511
            SSD+ T GD+R
Sbjct  143  SSDLYTAGDQR  153



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 109/148 (74%), Gaps = 6/148 (4%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             LF++SPAGVG+SY+NT+SD+ T GDKR
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKR  152



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 103/131 (79%), Gaps = 2/131 (2%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVL  298
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  EA     P ++PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPEARPLVL  82

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  ANLLF++SPAGVG+SYSNT
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLANLLFLESPAGVGFSYSNT  142

Query  479  SSDILTHGDKR  511
            SSD+ T GD+R
Sbjct  143  SSDLYTAGDQR  153



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  292
             S S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   E+P SKPL
Sbjct  18   ASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSENPESKPL  77

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  78   VLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYS  137

Query  473  NTSSDILTHGDKR  511
            NT+SD+ T GD+R
Sbjct  138  NTTSDLYTAGDQR  150



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = +2

Query  80   FVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            F L+L  SI G    +S ++ QK D +  LPG   NV FA YSGYVTVN++S RALFYW 
Sbjct  8    FYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSERALFYWL  67

Query  257  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
             EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DG++LY NPY+WN  AN+
Sbjct  68   VEAPVSRGPRSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGRSLYLNPYAWNKLANI  127

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+DSPAGVG+SYSN ++D+ T GD+R
Sbjct  128  LFLDSPAGVGFSYSNKTADLYTFGDQR  154



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            SSS+  Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLV
Sbjct  18   SSSIYDQENDRITHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLV  77

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSN
Sbjct  78   LWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSN  137

Query  476  TSSDILTHGDKR  511
            T+SD+ T GDKR
Sbjct  138  TTSDLYTAGDKR  149



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 111/147 (76%), Gaps = 2/147 (1%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  8    LYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  67

Query  257  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
             EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  68   VEAPVKRGPKSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  127

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+DSPAGVG+SYSN S+D+ T GD++
Sbjct  128  LFLDSPAGVGFSYSNKSTDLYTFGDQK  154



>ref|XP_002315293.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
 gb|EEF01464.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
Length=469

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 111/151 (74%), Gaps = 5/151 (3%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLQGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  245  FYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  418
            FYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY+WN 
Sbjct  72   FYWLIEAPKIVKPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPYAWNK  131

Query  419  AANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             ANLLF+DSPAGVG+SYSNTSSD  T GDKR
Sbjct  132  VANLLFLDSPAGVGFSYSNTSSDTYTVGDKR  162



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 117/155 (75%), Gaps = 10/155 (6%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S  ++ C+L + L      GG  +S+ DQ + D +  LPG   NV FA YSGYVTVN+++
Sbjct  5    SPFAFLCILLLFL------GGCFASNQDQVR-DRITQLPGQP-NVGFAQYSGYVTVNRKA  56

Query  233  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+R
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQR  151



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 102/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYSN  142

Query  476  TSSDILTHGDKR  511
            TSSD+ T GD+R
Sbjct  143  TSSDLYTAGDQR  154



>gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            SS+++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  E  A   P S+PLV
Sbjct  21   SSTLEDQERDKITYLPGQPTNVEFNQYSGYVTVNQQAGRALFYWLIESPASRGPESRPLV  80

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF ++ DGKTL++NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIKPDGKTLFFNPYAWNKLANLLFLESPAGVGFSYSN  140

Query  476  TSSDILTHGDKR  511
            T+SD+ T GD+R
Sbjct  141  TTSDLYTAGDQR  152



>ref|XP_002312023.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
 gb|EEE89390.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
Length=466

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 112/160 (70%), Gaps = 6/160 (4%)
 Frame = +2

Query  50   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFAILLLSTPAVTTHDHLEEQRRDRIMKLPGQPPNVSFSQFSGYIT  60

Query  218  VNQESGRALFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  391
            V+   GRALFYW  EA +   P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLIEAPKTVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  392  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            + NPY+WN  ANLLF+DSPAGVG+SYSNTSSDI T GD+R
Sbjct  121  HLNPYAWNKVANLLFLDSPAGVGFSYSNTSSDIYTVGDER  160



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 105/128 (82%), Gaps = 2/128 (2%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWLN  307
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLWLN
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLWLN  81

Query  308  GGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSD  487
            GGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+SD
Sbjct  82   GGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSNTTSD  141

Query  488  ILTHGDKR  511
            + T GDKR
Sbjct  142  LYTAGDKR  149



>ref|XP_009141517.1| PREDICTED: serine carboxypeptidase-like 28 [Brassica rapa]
Length=469

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYW  EA +   +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+WNL A
Sbjct  76   FYWLTEAPKPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAWNLEA  135

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            NLLF+DSPAGVG+SY+NTSSD LT GDKR
Sbjct  136  NLLFLDSPAGVGFSYTNTSSDELTVGDKR  164



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L +V+ L+    G   S S  +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALFYW
Sbjct  5    LCYVIFLSFLFVGSCYSFSNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  254  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPSNRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNPYSWNNLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LLF++SPAGVG+SY+NTSSD+   GD+R
Sbjct  125  LLFLESPAGVGFSYTNTSSDLYDAGDQR  152



>ref|XP_010067291.1| PREDICTED: serine carboxypeptidase-like 28 [Eucalyptus grandis]
 gb|KCW65387.1| hypothetical protein EUGRSUZ_G02817 [Eucalyptus grandis]
Length=467

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLVLWLNG  310
            QQK D ++ LPG   NV+F+ Y+GYVTV+  +GRALFYW  E      P+SKPLVLWLNG
Sbjct  33   QQKKDKIVKLPGQPANVTFSQYAGYVTVDPSAGRALFYWLIEVPRHLRPASKPLVLWLNG  92

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+A+G +EEVGPF V  +GKTLY NPY+WN  ANLLF+DSPAGVG+SYSNTSSD+
Sbjct  93   GPGCSSVAYGASEEVGPFRVRPNGKTLYLNPYAWNREANLLFLDSPAGVGFSYSNTSSDV  152

Query  491  LTHGDKR  511
             T GDKR
Sbjct  153  YTPGDKR  159



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  292
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   + P SKPL
Sbjct  17   ASCCRDEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQHPESKPL  76

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSSIAFG AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYS
Sbjct  77   VLWLNGGPGCSSIAFGAAEEIGPFRINPDGKTLYHNPYAWNQLANLLFLESPAGVGFSYS  136

Query  473  NTSSDILTHGDKR  511
            NT+SD+ T GD+R
Sbjct  137  NTTSDLYTAGDQR  149



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAV-LDLPGLGFNVSFAHYSGYVT  217
            M+   W  +  + L    +     + + D   QQ+ D +   LPG  FN+SF HYSGY+T
Sbjct  1    MANSEWSQIFAITLATIFLCNNNFTFATDPFVQQEHDRIDRPLPGQNFNISFEHYSGYIT  60

Query  218  VNQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            VN+++GR LFYWF +A   DP+SKPL+LWLNGGPGCSSIA+G AEE+GPFH+  DGK L+
Sbjct  61   VNEDAGRNLFYWFIQADHVDPTSKPLLLWLNGGPGCSSIAYGEAEEIGPFHINSDGKNLH  120

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +NPY WN  AN L+++SP GVG+SYS  SSDIL +GDKR
Sbjct  121  FNPYYWNQVANFLYIESPVGVGFSYSKNSSDILNNGDKR  159



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALFY
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  251  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            W  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY+WN + 
Sbjct  63   WLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPYAWNNSV  122

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             ++F+DSPAGVG+SYSNT+SD+ T GD+R
Sbjct  123  VIVFLDSPAGVGFSYSNTTSDLYTAGDQR  151



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +2

Query  128  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLW  301
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLW
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLW  78

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+
Sbjct  79   LNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKVANLLFLESPAGVGFSYSNTT  138

Query  482  SDILTHGDKR  511
            SD+ T GDKR
Sbjct  139  SDLYTAGDKR  148



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPL  292
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPL
Sbjct  20   ASCCRDEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPESKPL  79

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  80   VLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYS  139

Query  473  NTSSDILTHGDKR  511
            NT+SD+ T GDKR
Sbjct  140  NTTSDLYTAGDKR  152



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +2

Query  128  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLW  301
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLW
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLW  78

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+
Sbjct  79   LNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKVANLLFLESPAGVGFSYSNTT  138

Query  482  SDILTHGDKR  511
            SD+ T GDKR
Sbjct  139  SDLYTAGDKR  148



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPL  292
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPL
Sbjct  19   ASCCRDEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPDSKPL  78

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  79   VLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYS  138

Query  473  NTSSDILTHGDKR  511
            NT+SD+ T GDKR
Sbjct  139  NTTSDLYTAGDKR  151



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 111/155 (72%), Gaps = 7/155 (5%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S LS  CLL  L + + I      + ++ Q  D +  LPG   +V F  YSGYVTVNQ+S
Sbjct  4    SLLSILCLLVSLFVYSCI-----CAPLEDQGRDKITYLPGQPGSVEFNQYSGYVTVNQQS  58

Query  233  GRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  59   GRALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  118

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+R
Sbjct  119  AWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQR  153



>emb|CDY40439.1| BnaA04g20780D [Brassica napus]
Length=469

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 110/149 (74%), Gaps = 2/149 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+WNL A
Sbjct  76   FYWLTEAPTPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAWNLDA  135

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            NLLF+DSPAGVG+SY+NTSSD LT GDKR
Sbjct  136  NLLFLDSPAGVGFSYTNTSSDELTVGDKR  164



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 105/132 (80%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            +S +  Q+ D + +LPG   NV FA YSGYVTV+Q++GRALFYW  EA     P S+PLV
Sbjct  23   TSPLQDQERDKITELPGQPTNVGFAQYSGYVTVDQQAGRALFYWLTEAPASRRPESRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTL++NPY+WN  AN+LF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFRIHPDGKTLFFNPYAWNNLANILFLESPAGVGFSYSN  142

Query  476  TSSDILTHGDKR  511
            TSSD+ T GD+R
Sbjct  143  TSSDLYTAGDQR  154



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPLVLWLN  307
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPLVLWLN
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPESKPLVLWLN  81

Query  308  GGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSD  487
            GGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+SD
Sbjct  82   GGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYSNTTSD  141

Query  488  ILTHGDKR  511
            + T GDKR
Sbjct  142  LYTAGDKR  149



>gb|KJB76564.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=333

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKR  511
            T+SD+ T GDKR
Sbjct  137  TTSDLYTTGDKR  148



>gb|AFK37459.1| unknown [Lotus japonicus]
Length=463

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            + M   + G LLF+  L  S      SS   +Q+LD +  LPG    V+FA +SGYVTVN
Sbjct  1    MSMVFQTKGLLLFLCALIFSFSCILASSVPKEQELDRISALPGQP-PVTFAQFSGYVTVN  59

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +E GRALFYWF EA   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +L+ N 
Sbjct  60   EEHGRALFYWFTEATTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLFLNK  119

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            Y+WN  AN+LF++SPAGVG+SY+NTSSD+ T GDKR
Sbjct  120  YAWNKEANILFLESPAGVGFSYTNTSSDLTTSGDKR  155



>gb|KJB76565.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=342

 Score =   175 bits (444),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKR  511
            T+SD+ T GDKR
Sbjct  137  TTSDLYTTGDKR  148



>gb|EYU39591.1| hypothetical protein MIMGU_mgv1a009171mg [Erythranthe guttata]
Length=350

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = +2

Query  62   SWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
            S  C + +L L   +  G    + DQ+  D +  LPG   N+ F  YSGYVTVNQ+SGRA
Sbjct  7    SISCSICLLWLNLFVGIGYSLYNADQEN-DRITYLPGQPENIGFDQYSGYVTVNQQSGRA  65

Query  242  LFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            LFYW  EA  +  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N YSWN
Sbjct  66   LFYWLTEAPTNRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYSNSYSWN  125

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
              ANLLF++SPAGVGYSYSNTSSD+ T GD+R
Sbjct  126  KLANLLFLESPAGVGYSYSNTSSDLYTVGDQR  157



>ref|XP_011040962.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=468

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 110/151 (73%), Gaps = 5/151 (3%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLHGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  245  FYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  418
            FYW  E   +  P SKPL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY+WN 
Sbjct  72   FYWLIEVPKIVKPKSKPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPYAWNK  131

Query  419  AANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             ANLLF+DSPAGVG+SYSNTSSD  T GDKR
Sbjct  132  VANLLFLDSPAGVGFSYSNTSSDTYTVGDKR  162



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 109/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L +V+ L+    G   S    +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALFYW
Sbjct  5    LCYVMFLSFLFVGSCYSFYNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  254  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPSTRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNPYSWNNLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LLF++SPAGVG+SY+NT+SD+   GD+R
Sbjct  125  LLFLESPAGVGFSYTNTTSDLYDAGDQR  152



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWL GGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF++SPAGVG+SY+N
Sbjct  83   LWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYTN  142

Query  476  TSSDILTHGDKR  511
            TSSD+ T GD+R
Sbjct  143  TSSDLYTAGDQR  154



>ref|XP_011031766.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=466

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 111/160 (69%), Gaps = 6/160 (4%)
 Frame = +2

Query  50   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFATLLLSTPAVTNHDHLEEQRRDRIIKLPGQPPNVSFSQFSGYIT  60

Query  218  VNQESGRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  391
            V+   GRALFYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLNEAPKIVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  392  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            + NPY+WN  ANLLF+DSPAGVG+SYSNTSSD+ T GD R
Sbjct  121  HLNPYAWNKVANLLFLDSPAGVGFSYSNTSSDVYTVGDGR  160



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S+PLV
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPESRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWL GGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF++SPAGVG+SY+N
Sbjct  83   LWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGFSYTN  142

Query  476  TSSDILTHGDKR  511
            TSSD+ T GD+R
Sbjct  143  TSSDLYTAGDQR  154



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 113/148 (76%), Gaps = 3/148 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
              ++ LL + +    GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALFYW
Sbjct  5    FFYLCLLLSLVAISYGSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFYW  63

Query  254  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E      P+S+PLVLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY NPY+WN  AN
Sbjct  64   LTETPTSRVPNSRPLVLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNPYAWNKLAN  123

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LLF++SPAGVG+SYSNT+SD+ T GD++
Sbjct  124  LLFLESPAGVGFSYSNTTSDLYTAGDQK  151



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 110/147 (75%), Gaps = 2/147 (1%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  7    LYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  66

Query  257  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
             EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  67   VEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  126

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+DSPAGVG+SYSN S+D+ T GD++
Sbjct  127  LFLDSPAGVGFSYSNKSTDLYTFGDQK  153



>gb|KDO48446.1| hypothetical protein CISIN_1g016137mg [Citrus sinensis]
Length=394

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            LL VL LA  +     S+   +Q+ D ++ LPG   NV+F+ YSGY+TV++++GRALFYW
Sbjct  12   LLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW  71

Query  254  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              EA  D  P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V +DGK L  NPY+WN  AN
Sbjct  72   LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEAN  131

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +LF+DSPAGVG+SY+ T  DI T GDKR
Sbjct  132  ILFLDSPAGVGFSYTKTREDIYTVGDKR  159



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            S+++  Q  D +  LPG   N +FA YSGYVTV++ +GR LFYW  E+  +P +KPLVLW
Sbjct  20   SAAIANQNNDRITWLPGQPENTNFAQYSGYVTVDKSAGRTLFYWLTESPSNPETKPLVLW  79

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSSIA+G AEE+GPFH++ DGKTL+ NPYSWN  ANLLF++SPAGVG+SYSN S
Sbjct  80   LNGGPGCSSIAYGAAEEIGPFHIQSDGKTLFLNPYSWNNEANLLFLESPAGVGFSYSNRS  139

Query  482  SDILTHGDKR  511
            SD+ T GD R
Sbjct  140  SDLYTVGDSR  149



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  295
            +S ++ QK D + +LPG   NVSF+ YSGYVTVN++ GRALFYW  E+  +  P ++PLV
Sbjct  21   ASYLEDQKRDRIRELPGQPRNVSFSQYSGYVTVNEQRGRALFYWLTESPVNRVPKARPLV  80

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGK+LY NPY+WN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKSLYLNPYAWNKLANLLFLESPAGVGFSYTN  140

Query  476  TSSDILTHGDKR  511
            T+SD+ T GD+R
Sbjct  141  TTSDLYTTGDER  152



>ref|XP_007009788.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
 gb|EOY18598.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
Length=423

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVL  298
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALFYW  E      P ++PLVL
Sbjct  22   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLIELPVSRSPETRPLVL  81

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y+WN  AN+LF++SPAGVG+SYSNT
Sbjct  82   WLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRYAWNNLANMLFLESPAGVGFSYSNT  141

Query  479  SSDILTHGDKR  511
            +SD+ T GD+R
Sbjct  142  TSDLYTAGDRR  152



>gb|KJB76572.1| hypothetical protein B456_012G095000 [Gossypium raimondii]
Length=441

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 107/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L++ L++ + +          +Q  D ++ LPG   NV F+ YSGY+TV  ++GRALFYW
Sbjct  15   LVYFLVIGSLVVWSAEGGHRKEQARDRIVKLPGQPRNVKFSQYSGYITVEAKAGRALFYW  74

Query  254  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              EA     P +KPLVLWLNGGPGCSSIA+G +EEVGPF V +DGK+L  NPY+WN  AN
Sbjct  75   LTEAPAKSRPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVREDGKSLRLNPYAWNQEAN  134

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LLF+DSPAGVG+SYSNTSSDI T GDKR
Sbjct  135  LLFLDSPAGVGFSYSNTSSDIYTAGDKR  162



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPL  292
             SS V++QK D + +LPG   NV F  YSGY+TVN+E GRALFYW  E  A  DP S+PL
Sbjct  19   ASSYVEEQKRDRISELPGQPSNVDFRQYSGYITVNEERGRALFYWLVESPATRDPKSRPL  78

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+
Sbjct  79   VLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYT  138

Query  473  NTSSDILTHGDKR  511
            NT+SD+ T GD+R
Sbjct  139  NTTSDLYTTGDQR  151



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 107/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L FV+ L+    G    S   +Q  D +  LPG   NV F  YSGYVTVN+++GRALFYW
Sbjct  5    LPFVICLSLLFLGSCYCSINVEQLRDKITYLPGQPANVEFNQYSGYVTVNEQAGRALFYW  64

Query  254  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPMSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHINSDGKTLYLNPYSWNNLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LLF++SPAGVG+SY+NTSSD+   GD+R
Sbjct  125  LLFLESPAGVGFSYTNTSSDLYNAGDQR  152



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 113/155 (73%), Gaps = 10/155 (6%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S  ++ C+L + L       G   +S+  Q  D +  LPG   NV FA YSGYVTVN+++
Sbjct  5    SPFAFLCILLLFL-------GGCFASIQDQVRDRITQLPGQP-NVGFAQYSGYVTVNRKA  56

Query  233  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+G FH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGAFHIRPDGKTLYLNPY  116

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+R
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQR  151



>ref|XP_002274699.1| PREDICTED: serine carboxypeptidase-like 28 [Vitis vinifera]
Length=472

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 114/156 (73%), Gaps = 5/156 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
             S+L +  L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  
Sbjct  10   FSSLFFCVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPR  66

Query  230  SGRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +GRALFYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NP
Sbjct  67   AGRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNP  126

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            Y+WN  ANLLF+DSPAGVG+SYSNTSSD+   GDKR
Sbjct  127  YAWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKR  162



>ref|XP_006436272.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
 ref|XP_006485877.1| PREDICTED: serine carboxypeptidase-like 28-like [Citrus sinensis]
 gb|ESR49512.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
Length=468

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            LL VL LA  +     S+   +Q+ D ++ LPG   NV+F+ YSGY+TV++++GRALFYW
Sbjct  12   LLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW  71

Query  254  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              EA  D  P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V +DGK L  NPY+WN  AN
Sbjct  72   LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNREAN  131

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +LF+DSPAGVG+SY+ T  DI T GDKR
Sbjct  132  ILFLDSPAGVGFSYTKTREDIYTVGDKR  159



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 2/147 (1%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  8    LYLVLLLSICGVVSLASPIEDQKKDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  67

Query  257  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
             EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  68   VEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  127

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+DSPAGVG+SYSN ++D+ T GD++
Sbjct  128  LFLDSPAGVGFSYSNKTTDLYTFGDQK  154



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 10/155 (6%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S  ++ C+L + L       G   +SV  Q  D +  LPG    V FA YSGYVTVN+++
Sbjct  5    SPFAFPCILLLFL-------GGCFASVQDQVRDRITQLPGQP-TVGFAQYSGYVTVNRKA  56

Query  233  GRALFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+R
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQR  151



>gb|KJB76571.1| hypothetical protein B456_012G095000 [Gossypium raimondii]
Length=472

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 107/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L++ L++ + +          +Q  D ++ LPG   NV F+ YSGY+TV  ++GRALFYW
Sbjct  15   LVYFLVIGSLVVWSAEGGHRKEQARDRIVKLPGQPRNVKFSQYSGYITVEAKAGRALFYW  74

Query  254  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              EA     P +KPLVLWLNGGPGCSSIA+G +EEVGPF V +DGK+L  NPY+WN  AN
Sbjct  75   LTEAPAKSRPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVREDGKSLRLNPYAWNQEAN  134

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LLF+DSPAGVG+SYSNTSSDI T GDKR
Sbjct  135  LLFLDSPAGVGFSYSNTSSDIYTAGDKR  162



>emb|CBI31484.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 114/156 (73%), Gaps = 5/156 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
             S+L +  L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  
Sbjct  21   FSSLFFCVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPR  77

Query  230  SGRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            +GRALFYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NP
Sbjct  78   AGRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNP  137

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            Y+WN  ANLLF+DSPAGVG+SYSNTSSD+   GDKR
Sbjct  138  YAWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKR  173



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 10/155 (6%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S  ++ C+L + L       G   +SV  Q  D +  LPG    V FA YSGYVTVN+++
Sbjct  5    SPFAFPCILLLFL-------GGCFASVQDQVRDRITQLPGQP-TVGFAQYSGYVTVNRKA  56

Query  233  GRALFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            GRALFYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+R
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQR  151



>ref|XP_010265560.1| PREDICTED: serine carboxypeptidase 24-like isoform X2 [Nelumbo 
nucifera]
Length=425

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 111/152 (73%), Gaps = 5/152 (3%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            A  W  +L +L ++     G G S+ +Q+ LD +  LPG    V+F+ YSGY+TV+   G
Sbjct  2    ASQWRTILMILFISLI---GVGESATEQE-LDRISALPGQP-QVTFSQYSGYITVDSTHG  56

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA  DP +KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSWN
Sbjct  57   RALFYWFTEATTDPQNKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNKYSWN  116

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
              AN+LF++SPAGVG+SY+NTSS++   GD+R
Sbjct  117  KEANILFLESPAGVGFSYTNTSSELKHSGDRR  148



>gb|AEX12786.1| hypothetical protein 2_8315_02, partial [Pinus radiata]
Length=128

 Score =   166 bits (420),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            ++Q  D +  LPG   NV+F  YSGY+TV+  +GRALFYW  EA E+PSSKPLVLWLNGG
Sbjct  17   NEQDRDRITQLPGQPSNVNFDQYSGYITVDSNAGRALFYWLVEAAENPSSKPLVLWLNGG  76

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSY  469
            PGCSS+A+G AEE+GPFH+  DGK+LY NPYSWN  AN+LF+DSPAGVG+SY
Sbjct  77   PGCSSVAYGEAEELGPFHIHADGKSLYLNPYSWNKLANILFLDSPAGVGFSY  128



>gb|AEX12772.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12773.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12774.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12777.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12778.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12780.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12781.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12784.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
Length=128

 Score =   166 bits (420),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            ++Q  D +  LPG   NV+F  YSGY+TV+  +GRALFYW  EA E+PSSKPLVLWLNGG
Sbjct  17   NEQDRDRITQLPGQPSNVNFDQYSGYITVDSNAGRALFYWLVEAAENPSSKPLVLWLNGG  76

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSY  469
            PGCSS+A+G AEE+GPFH+  DGK+LY NPYSWN  AN+LF+DSPAGVG+SY
Sbjct  77   PGCSSVAYGEAEELGPFHINADGKSLYLNPYSWNKLANILFLDSPAGVGFSY  128



>gb|AEX12770.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12771.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12775.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12776.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12779.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12782.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12783.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12785.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
Length=128

 Score =   166 bits (420),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            ++Q  D +  LPG   NV+F  YSGY+TV+  +GRALFYW  EA E+PSSKPLVLWLNGG
Sbjct  17   NEQDRDRITQLPGQPSNVNFDQYSGYITVDSNAGRALFYWLVEAAENPSSKPLVLWLNGG  76

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSY  469
            PGCSS+A+G AEE+GPFH+  DGK+LY NPYSWN  AN+LF+DSPAGVG+SY
Sbjct  77   PGCSSVAYGEAEELGPFHIHADGKSLYLNPYSWNKLANILFLDSPAGVGFSY  128



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPL  292
            GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALFYW  E      P+S+PL
Sbjct  22   GSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFYWLTETPTSRVPNSRPL  80

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY NPY+WN  ANLLF++SPAGVG+SYS
Sbjct  81   VLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNPYAWNKLANLLFLESPAGVGFSYS  140

Query  473  NTSSDILTHGDKR  511
            NT+SD+ T GD++
Sbjct  141  NTTSDLYTAGDQK  153



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 116/163 (71%), Gaps = 13/163 (8%)
 Frame = +2

Query  29   LTKIPLEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSG  208
            + KIP  +  LS   LLF+     SI+       V+Q + D +  LPG   NV F  YSG
Sbjct  1    MEKIPPFVICLS---LLFLSSCYCSIN-------VEQLR-DKITYLPGQPANVQFNQYSG  49

Query  209  YVTVNQESGRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDG  382
            YVTVN+++GRALFYW  E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH++ DG
Sbjct  50   YVTVNEQAGRALFYWLIESPVSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHIDSDG  109

Query  383  KTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            KTLY NPYSWN  ANLLF++SPAGVG+SY+NTSSD+   GD+R
Sbjct  110  KTLYLNPYSWNNLANLLFLESPAGVGFSYTNTSSDLYNAGDQR  152



>ref|XP_010265559.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 111/152 (73%), Gaps = 5/152 (3%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            A  W  +L +L ++     G G S+ +Q+ LD +  LPG    V+F+ YSGY+TV+   G
Sbjct  2    ASQWRTILMILFISLI---GVGESATEQE-LDRISALPGQP-QVTFSQYSGYITVDSTHG  56

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA  DP +KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSWN
Sbjct  57   RALFYWFTEATTDPQNKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNKYSWN  116

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
              AN+LF++SPAGVG+SY+NTSS++   GD+R
Sbjct  117  KEANILFLESPAGVGFSYTNTSSELKHSGDRR  148



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKR  511
            T+SD+ T GDKR
Sbjct  137  TTSDLYTTGDKR  148



>ref|XP_007009790.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
 gb|EOY18600.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
Length=464

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  292
            G +   +Q+ D ++ LPG    V+F+ YSGY+TV+ ++GRALFYW  +A     P+SKPL
Sbjct  22   GGNHRKEQERDRIVKLPGQPPKVNFSQYSGYITVDPKAGRALFYWLIKAPFKSQPASKPL  81

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G +EEVGPF V  DGKTL  NPY+WN  ANLLF+DSPAGVG+SYS
Sbjct  82   VLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLRLNPYAWNQEANLLFLDSPAGVGFSYS  141

Query  473  NTSSDILTHGDKR  511
            NTSSDI T GDKR
Sbjct  142  NTSSDIYTVGDKR  154



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKR  511
            T+SD+ T GDKR
Sbjct  137  TTSDLYTTGDKR  148



>gb|KJB76566.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=484

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKR  511
            T+SD+ T GDKR
Sbjct  137  TTSDLYTTGDKR  148



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 115/157 (73%), Gaps = 10/157 (6%)
 Frame = +2

Query  47   EMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            + S  ++ C+L +         G   +S+  Q  D + +LPG   NV FA +SGYVTVN+
Sbjct  3    DHSPFAFLCILLLFF-------GACFASIQDQVRDRITNLPGQP-NVGFAQFSGYVTVNK  54

Query  227  ESGRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  400
            ++GRALFYW  E+ ++  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  55   KAGRALFYWLIESPKNRGPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLN  114

Query  401  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            PY+WN  ANLLF++SPAGVG+SYSNT++D+ T+GD+R
Sbjct  115  PYTWNNLANLLFLESPAGVGFSYSNTTTDLYTNGDQR  151



>gb|EYU39590.1| hypothetical protein MIMGU_mgv1a0101821mg, partial [Erythranthe 
guttata]
Length=183

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 105/152 (69%), Gaps = 7/152 (5%)
 Frame = +2

Query  68   GCLLFVLLL----ATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            G L+F L L    ATSI          QQ LD +  LPG   +V F+ YSGY+ VN+   
Sbjct  3    GQLIFALFLLPIIATSIS--TTPPYPKQQALDKITKLPGQPSSVKFSQYSGYIKVNENPI  60

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA + P SKPLVLWLNGGPGCSSIA+G +EEVGPF V  DG+TL  +  SWN
Sbjct  61   RALFYWFIEATKKPESKPLVLWLNGGPGCSSIAYGASEEVGPFRVGADGRTLSLSHTSWN  120

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
              ANL+F+DSPAGVG+SYSN SSD+ T GD+R
Sbjct  121  KEANLVFLDSPAGVGFSYSNDSSDLKT-GDQR  151



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALFYW  E  A   P S+PL+
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLIESPASRKPESRPLI  80

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNPYSWNKLANLLFLESPAGVGFSYTN  140

Query  476  TSSDILTHGDKR  511
            T+SD+ T GD R
Sbjct  141  TTSDLYTAGDGR  152



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVL  298
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALFYW  E      P ++PLVL
Sbjct  85   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLIELPVSRSPETRPLVL  144

Query  299  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  478
            WLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y+WN  AN+LF++SPAGVG+SYSNT
Sbjct  145  WLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRYAWNNLANMLFLESPAGVGFSYSNT  204

Query  479  SSDILTHGDKR  511
            +SD+ T GD+R
Sbjct  205  TSDLYTAGDRR  215



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALFYW  E  A   P S+PL+
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLIESPASRKPESRPLI  80

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNPYSWNKLANLLFLESPAGVGFSYTN  140

Query  476  TSSDILTHGDKR  511
            T+SD+ T GD R
Sbjct  141  TTSDLYTAGDGR  152



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 104/132 (79%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  295
            SS ++ Q+ D + +LPG   N+ FA YSGYVTVN+++GRALFYW  +  A     S+PLV
Sbjct  21   SSYLEDQERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLVQSPASRGAESRPLV  80

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLFINPYAWNNLANLLFLESPAGVGFSYSN  140

Query  476  TSSDILTHGDKR  511
            T+SD+ T GD+R
Sbjct  141  TTSDLYTAGDQR  152



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 2/133 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  292
             S+ V++QK D +++LPG   N+ F  YSGY+TVNQE GRALFYW  E+     P S+PL
Sbjct  24   ASTYVEEQKRDRIIELPGQPSNIDFRQYSGYITVNQEHGRALFYWLVESPLTRVPKSRPL  83

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY+
Sbjct  84   VLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLYSKLYAWNKLANLLFLESPAGVGFSYT  143

Query  473  NTSSDILTHGDKR  511
            NT+SD+   GD+R
Sbjct  144  NTTSDLYITGDQR  156



>gb|ACA61622.1| hypothetical protein AP7_B10.2 [Arabidopsis lyrata subsp. petraea]
Length=200

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            +Q+  D ++ LPG   N++F+ +SGYVTV+  +GR LFYW  EA     +KPLVLWLNGG
Sbjct  16   EQKMKDKIISLPGQPPNLNFSQFSGYVTVDSAAGRNLFYWLTEAPRPSGTKPLVLWLNGG  75

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSSIA+G +EEVGPF +  DGKTL  N Y+WN  AN+LF+DSPAGVG+SY+NTSSD L
Sbjct  76   PGCSSIAYGASEEVGPFRINPDGKTLRLNLYAWNKVANVLFLDSPAGVGFSYTNTSSDKL  135

Query  494  THGDKR  511
            T GDKR
Sbjct  136  TVGDKR  141



>ref|XP_004288721.2| PREDICTED: serine carboxypeptidase 24 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +2

Query  65   WGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            +  L+F+L L T+      +++  +Q+LD +  LPG    VSF+ YSGYVTVN++ GRAL
Sbjct  17   YSILVFMLSLTTTTINV--AATAKEQELDRITALPGQP-PVSFSQYSGYVTVNKKHGRAL  73

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYWF EA   P +KPLVLW NGGPGCSS+A+G +EE+GPF + + G +LY N YSWN  A
Sbjct  74   FYWFTEATASPHNKPLVLWFNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSWNREA  133

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N+LF++SPAGVG+SY+NTS+D++  GDKR
Sbjct  134  NILFLESPAGVGFSYTNTSADLIDSGDKR  162



>gb|EPS66906.1| hypothetical protein M569_07869, partial [Genlisea aurea]
Length=410

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +2

Query  128  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLVLW  301
            SV  Q+ D +  LPG   N++F  YSGYVTVN  +GRALFYW  EA  D  P S+PL+LW
Sbjct  20   SVQDQESDRITYLPGQPENIAFNQYSGYVTVNHTAGRALFYWLTEASVDSVPDSRPLLLW  79

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSSIA+G AEE+GPF +  +GKTLY N YSWN   NLLF++SPAGVGYSYSNTS
Sbjct  80   LNGGPGCSSIAYGAAEEIGPFRINSNGKTLYLNSYSWNKLVNLLFLESPAGVGYSYSNTS  139

Query  482  SDILTHGDKR  511
            SD+ T GD+R
Sbjct  140  SDLYTAGDRR  149



>ref|XP_010505097.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=469

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 108/151 (72%), Gaps = 2/151 (1%)
 Frame = +2

Query  65   WGCLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVTV+  +GR
Sbjct  10   YQCMFLVCMMIALLDVVSSSDDADKEQKTKDKIISLPGQPPNLNFSQFSGYVTVDSTAGR  69

Query  239  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  418
            ALFYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF +  DGKTL +N Y+WN 
Sbjct  70   ALFYWLTEAPRPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRINPDGKTLRFNIYAWNK  129

Query  419  AANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             AN+LF+DSPAGVG+SY+NTSSD LT GDKR
Sbjct  130  VANVLFLDSPAGVGFSYTNTSSDELTVGDKR  160



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNV-SFAHYSGYVTVNQESGRALFY  250
            L+F+       +   G SS D Q+ D +++LPG   NV  F+ YSGYVTV+Q +GRALFY
Sbjct  10   LMFLGFCLLIWEAEAGISSSDDQERDRIIELPGEPANVVDFSQYSGYVTVDQNAGRALFY  69

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            W  E+   PS +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+L+ NPY+WN  AN+
Sbjct  70   WLTESPTRPSLRPLVLWLNGGPGCSSVAYGAAEELGPFHINPDGKSLFLNPYAWNKLANI  129

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+DSPAGVG+SYSN+SSD+   GD +
Sbjct  130  LFLDSPAGVGFSYSNSSSDLKHPGDNQ  156



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 107/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             L ++LL T       SS V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW
Sbjct  5    FLVIILLFTISSSWSASSYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYW  64

Query  254  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  AN
Sbjct  65   LVESPLTRDPKSRPLVLWLNGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLAN  124

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LLF+++PAGVG+SYSNTSSD+ T GD+R
Sbjct  125  LLFLEAPAGVGFSYSNTSSDLYTTGDQR  152



>ref|XP_009792407.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana sylvestris]
Length=468

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 106/146 (73%), Gaps = 2/146 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            LL +L L  +I+    +S   +Q+ D ++ LPG    V+F+ +SGYVTVN+  GRALFYW
Sbjct  16   LLIILSLTITINN-VAASLTKEQEFDRIISLPGQP-PVTFSQFSGYVTVNENHGRALFYW  73

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EA   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN  AN+L
Sbjct  74   LTEATTQPEKKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWNKVANIL  133

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F++SPAGVG+SY+NTSSD+   GDKR
Sbjct  134  FLESPAGVGFSYTNTSSDLKDSGDKR  159



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  239  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQK  153



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  239  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQK  153



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNG  310
            +++ D + +LPG   N  FA YSGYVTVN+++GRALFYW  E  A   P S+PLVLWLNG
Sbjct  37   ERERDRIGELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNG  96

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+A+GLAEE+GPF +  DGKTLY NPY+W+  ANLLF++SPAG+G+SY+NT+SD+
Sbjct  97   GPGCSSVAYGLAEEIGPFRIRPDGKTLYSNPYAWSKLANLLFLESPAGIGFSYTNTTSDL  156

Query  491  LTHGDKR  511
             T GD+R
Sbjct  157  YTTGDQR  163



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNG  310
            +++ D + +LPG   N  FA YSGYVTVN+++GRALFYW  E  A   P S+PLVLWLNG
Sbjct  98   ERERDRIGELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNG  157

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+A+GLAEE+GPF +  DGKTLY NPY+W+  ANLLF++SPAG+G+SY+NT+SD+
Sbjct  158  GPGCSSVAYGLAEEIGPFRIRPDGKTLYSNPYAWSKLANLLFLESPAGIGFSYTNTTSDL  217

Query  491  LTHGDKR  511
             T GD+R
Sbjct  218  YTTGDQR  224



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G  EEVGPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  485  DILTHGDKR  511
            D+ T GD+R
Sbjct  146  DLYTTGDQR  154



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G  EEVGPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  485  DILTHGDKR  511
            D+ T GD+R
Sbjct  146  DLYTTGDQR  154



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  239  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQK  153



>ref|NP_181120.2| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
 sp|Q8S8K6.2|SCP28_ARATH RecName: Full=Serine carboxypeptidase-like 28; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEC09159.1| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
Length=462

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 106/147 (72%), Gaps = 5/147 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  250
            C++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALFY
Sbjct  15   CMVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFY  69

Query  251  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
            W  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN+
Sbjct  70   WLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANV  129

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+DSPAGVG+SY+NTSSD LT GDKR
Sbjct  130  LFLDSPAGVGFSYTNTSSDELTVGDKR  156



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  239  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQK  153



>gb|KDP25724.1| hypothetical protein JCGZ_23945 [Jatropha curcas]
Length=467

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPLVLWL  304
            + +Q+ D ++ LPG   NV+F+ YSGY++V+  +GRALFYW  EA +   P  KPLVLWL
Sbjct  32   LKEQEKDRIIKLPGQPSNVNFSQYSGYISVDPVAGRALFYWLTEAPKTVQPKLKPLVLWL  91

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSSIA+G +EEVGPF V  DGKTL+ NPY+WN  ANLLF+DSPAGVG+SYSNTSS
Sbjct  92   NGGPGCSSIAYGASEEVGPFRVRPDGKTLHLNPYAWNKEANLLFLDSPAGVGFSYSNTSS  151

Query  485  DILTHGDKR  511
            DI   GDKR
Sbjct  152  DISNVGDKR  160



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEEVGPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGAAEEVGPFRVGSDGKTLHNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  485  DILTHGDKR  511
            D+ T GD+R
Sbjct  146  DLYTTGDQR  154



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 102/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            SS V++Q  D + +LPG   NV F  YSGYVTV++E GRALFYW  E+    DP S+PLV
Sbjct  23   SSYVEEQLRDRISNLPGQPSNVDFRQYSGYVTVHEERGRALFYWLVESPLARDPKSRPLV  82

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHSKLYAWNKLANLLFLESPAGVGFSYSN  142

Query  476  TSSDILTHGDKR  511
            T+SD+ T GD+R
Sbjct  143  TTSDLYTTGDQR  154



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEEVGPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGAAEEVGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  485  DILTHGDKR  511
            D+ T GD+R
Sbjct  146  DLYTTGDQR  154



>ref|XP_009399563.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=458

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  304
            ++ D+Q LD +  LPG    VSFA ++GYVTVNQE GRALFYW  EAV D + KPLVLWL
Sbjct  22   AAADRQALDRISALPGQP-RVSFAQFAGYVTVNQERGRALFYWLTEAVTDAAKKPLVLWL  80

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G +EE+GPF +++ G +LY N +SWN  ANLLF++SPAGVG+SY+N SS
Sbjct  81   NGGPGCSSVAYGASEEIGPFRIDRTGSSLYLNKFSWNREANLLFLESPAGVGFSYANVSS  140

Query  485  DILTHGDKR  511
            D+ + GD+R
Sbjct  141  DLQSVGDER  149



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q  D + +LPG   NV F  YSGYVT+NQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTSDKITELPGQPKNVGFNQYSGYVTLNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  476  TSSDILTHGDKR  511
            T+SD+ T GDKR
Sbjct  137  TTSDLYTTGDKR  148



>ref|XP_006294164.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
 gb|EOA27062.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
Length=464

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            + ++   + C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVT
Sbjct  1    MMITKKQYQCVFLVCMVIALLDQVSSSDDGDKVQKMKDKIISLPGQPPNLNFSQFSGYVT  60

Query  218  VNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  397
            V+  +GRALFYW  EA     +KPLVLWLNGGPGCSSIA+G +EE+GPF V  DGKTL  
Sbjct  61   VDSTAGRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEIGPFRVNPDGKTLRL  120

Query  398  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N Y+WN  AN+LF+DSPAGVG+SY+NTSSD LT GDKR
Sbjct  121  NIYAWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKR  158



>gb|KJB77374.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=452

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 109/158 (69%), Gaps = 7/158 (4%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+GYV
Sbjct  4    NAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYAGYV  62

Query  215  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            TVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +TL 
Sbjct  63   TVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQTLK  122

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDK  508
             NP+ WN AANLLF++SP GVG+SY+NTSSDI   GDK
Sbjct  123  LNPHRWNKAANLLFLESPVGVGFSYTNTSSDIHQLGDK  160



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 100/126 (79%), Gaps = 2/126 (2%)
 Frame = +2

Query  140  QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNGG  313
            Q+ D + +LPG   N+ FA YSGYVTVN+++GRALFYW  +  A     S+PLVLWLNGG
Sbjct  23   QERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLVQSPASRGAESRPLVLWLNGG  82

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSS+A+G AEE+GPF +  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSNT+SD+ 
Sbjct  83   PGCSSVAYGAAEEIGPFRIRPDGKTLFINPYAWNNLANLLFLESPAGVGFSYSNTTSDLY  142

Query  494  THGDKR  511
            T GD+R
Sbjct  143  TAGDQR  148



>ref|XP_010273635.1| PREDICTED: serine carboxypeptidase 24-like [Nelumbo nucifera]
Length=458

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 7/146 (5%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            ++F+ L+  +ID  K      +Q+LD +  LPG    V F  YSGYVTV+   GRALFYW
Sbjct  11   IIFISLVGITIDAAK------EQELDRIWALPGQP-QVEFLQYSGYVTVDPVRGRALFYW  63

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EA  +P  KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSWN  AN+L
Sbjct  64   LTEATAEPEKKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNEYSWNKEANIL  123

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F++SP GVG+SY+NTSSD+   GD+R
Sbjct  124  FLESPVGVGFSYTNTSSDLKHSGDRR  149



>gb|KJB76569.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=451

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 101/132 (77%), Gaps = 3/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  295
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  +N+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWN-NSNVLFLESPAGVGFSYTN  135

Query  476  TSSDILTHGDKR  511
            T+SD+ T GDKR
Sbjct  136  TTSDLYTTGDKR  147



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 107/153 (70%), Gaps = 7/153 (5%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            LS  CLL    + + I      +  + Q  D +  LPG   +  F  YSGYVTV ++SGR
Sbjct  6    LSILCLLVSPFVYSCI-----CAPFEDQGRDKITYLPGQPGSAEFNQYSGYVTVKKQSGR  60

Query  239  ALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF + +DGKTLY NPY+W
Sbjct  61   ALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRRDGKTLYSNPYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N  ANLLF++SPAGVG+SYSNTSSD+ T GD+R
Sbjct  121  NKLANLLFLESPAGVGFSYSNTSSDLYTAGDQR  153



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNTSS
Sbjct  86   NGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTSS  145

Query  485  DILTHGDKR  511
            D+ T GD+R
Sbjct  146  DLYTTGDQR  154



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWL  85

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNTSS
Sbjct  86   NGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTSS  145

Query  485  DILTHGDKR  511
            D+ T GD+R
Sbjct  146  DLYTTGDQR  154



>ref|XP_006410746.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
 gb|ESQ52199.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
Length=465

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKL-DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C+  + ++   +D    S    +QK+ D ++ LPG    ++F+ +SGYVTV+  +GRALF
Sbjct  15   CMCLLCMVIALLDVVTSSDDAKEQKMKDKIISLPGQPPQLNFSQFSGYVTVDSAAGRALF  74

Query  248  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
            YW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN
Sbjct  75   YWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNIYAWNKVAN  134

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +LF+DSPAGVG+SY+NTSSD LT GDKR
Sbjct  135  VLFLDSPAGVGFSYTNTSSDELTVGDKR  162



>gb|KJB77373.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=483

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 109/158 (69%), Gaps = 7/158 (4%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+GYV
Sbjct  4    NAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYAGYV  62

Query  215  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            TVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +TL 
Sbjct  63   TVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQTLK  122

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDK  508
             NP+ WN AANLLF++SP GVG+SY+NTSSDI   GDK
Sbjct  123  LNPHRWNKAANLLFLESPVGVGFSYTNTSSDIHQLGDK  160



>gb|KJB77375.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=509

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 109/158 (69%), Gaps = 7/158 (4%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+GYV
Sbjct  4    NAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYAGYV  62

Query  215  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  394
            TVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +TL 
Sbjct  63   TVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQTLK  122

Query  395  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDK  508
             NP+ WN AANLLF++SP GVG+SY+NTSSDI   GDK
Sbjct  123  LNPHRWNKAANLLFLESPVGVGFSYTNTSSDIHQLGDK  160



>ref|XP_010258045.1| PREDICTED: serine carboxypeptidase-like 25 [Nelumbo nucifera]
Length=471

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 107/146 (73%), Gaps = 3/146 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            +LF  LL  S+    G+ +  +++ D +  LPG    VSF  +SGYVTVNQ +GRALFYW
Sbjct  17   VLFAFLLLVSVGASHGAGA--EEEADRIKALPGQP-KVSFQQFSGYVTVNQVAGRALFYW  73

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EAV +P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N +SWN  ANLL
Sbjct  74   LTEAVHEPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRLNKSGSGLYLNKFSWNTVANLL  133

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F+++PAGVG+SYSN SSD+L  GD+R
Sbjct  134  FLETPAGVGFSYSNRSSDLLDTGDRR  159



>ref|XP_010260054.1| PREDICTED: serine carboxypeptidase-like 25 isoform X2 [Nelumbo 
nucifera]
Length=421

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            SSS ++++ D +  LPG   NVSF  +SGYVTV+Q +GRALFYW  EAV+DP SKPLV+W
Sbjct  22   SSSHEEEEADRITALPGQP-NVSFQQFSGYVTVDQVAGRALFYWLTEAVQDPVSKPLVVW  80

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G +EE+GPF + + G  LY N +SWN+ ANLLF+++PAGVG+SY+N S
Sbjct  81   LNGGPGCSSVAYGASEEIGPFRLNRSGSGLYINKFSWNILANLLFLETPAGVGFSYTNRS  140

Query  482  SDILTHGDKR  511
            SD+L  GD+R
Sbjct  141  SDLLDTGDQR  150



>ref|XP_002881413.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57672.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 106/149 (71%), Gaps = 0/149 (0%)
 Frame = +2

Query  65   WGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            + C+  + ++   +D      + +Q+  D ++ LPG   N++F+ +SGYVTV+  +GR L
Sbjct  8    YQCMCLLCMVIAILDVVSSDDAKEQKMKDKIISLPGQPPNLNFSQFSGYVTVDSAAGRNL  67

Query  245  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  424
            FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  A
Sbjct  68   FYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVA  127

Query  425  NLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N+LF+DSPAGVG+SY+NTSSD LT GDKR
Sbjct  128  NVLFLDSPAGVGFSYTNTSSDELTVGDKR  156



>dbj|BAK05698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   168 bits (425),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 106/152 (70%), Gaps = 6/152 (4%)
 Frame = +2

Query  68   GCLLFV--LLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            GC L +  LLL  ++ GG G+   +   QQ  D V  LPG    V FA Y+GYVTV++  
Sbjct  18   GCFLGLAFLLLCGAVRGGGGAPDAEAARQQAADRVGRLPGQP-AVKFAQYAGYVTVDEAH  76

Query  233  GRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            GRALFYWFFEA    + KPLVLWLNGGPGCSSI +G AEE+GPF V+K    L WNPYSW
Sbjct  77   GRALFYWFFEATAGAAKKPLVLWLNGGPGCSSIGYGEAEELGPFLVQKGKPELKWNPYSW  136

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDK  508
            N  ANL+F++SP GVG+SY+NTSSD+   GDK
Sbjct  137  NKEANLMFLESPVGVGFSYTNTSSDLGKLGDK  168



>ref|XP_004496293.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X2 [Cicer 
arietinum]
Length=419

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 103/132 (78%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  295
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALFYW  E+  +  P+ +PLV
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLIESPMNRGPNLRPLV  83

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+LF+DSPAGVG+SY N
Sbjct  84   LWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANILFLDSPAGVGFSYCN  143

Query  476  TSSDILTHGDKR  511
             ++D+ T GD++
Sbjct  144  KTTDLYTFGDQK  155



>emb|CBI21207.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 107/155 (69%), Gaps = 5/155 (3%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGG----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            +S   +L  LLL   +D G     G    ++++ D +  LPG    VSF  YSGYVTVN 
Sbjct  6    ISASMVLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNH  64

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             +GRALFYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +
Sbjct  65   VAGRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKF  124

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            SWN  ANLLF+++PAGVG+SYSN SSD+L  GD+R
Sbjct  125  SWNTLANLLFLETPAGVGFSYSNKSSDLLDTGDRR  159



>ref|XP_002280058.1| PREDICTED: serine carboxypeptidase-like 25 [Vitis vinifera]
Length=473

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 107/155 (69%), Gaps = 5/155 (3%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGG----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            +S   +L  LLL   +D G     G    ++++ D +  LPG    VSF  YSGYVTVN 
Sbjct  8    ISASMVLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNH  66

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
             +GRALFYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +
Sbjct  67   VAGRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKF  126

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            SWN  ANLLF+++PAGVG+SYSN SSD+L  GD+R
Sbjct  127  SWNTLANLLFLETPAGVGFSYSNKSSDLLDTGDRR  161



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   169 bits (429),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 2/153 (1%)
 Frame = +2

Query  59   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            +S      VL L     G   +SS+ +QK D +  LPG    V F  YSGYVTVN+ESGR
Sbjct  1    MSHSIFCVVLFLTIFCVGISLASSIKEQKRDKIKWLPGQPKIVGFEQYSGYVTVNEESGR  60

Query  239  ALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  412
            ALFYW  EA     P+SKPLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+LY NPY+W
Sbjct  61   ALFYWLTEAPLSHGPNSKPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLYLNPYAW  120

Query  413  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            N  AN+LF++SPAGVG+SY N ++D+   GD++
Sbjct  121  NNLANILFLESPAGVGFSYCNKTTDMQNFGDQK  153



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  304
            S  +QQ+ D V  LPG    V FA YSGYVTV   +GRALFYW  EA       PLVLWL
Sbjct  40   SPAEQQEQDRVARLPGQP-RVDFAQYSGYVTVEARAGRALFYWLVEAPPSAQPAPLVLWL  98

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSSIA+G +EE+GPF ++ DGKTLY NPY+WN  AN+LF+DSPAGVG+SY+NTSS
Sbjct  99   NGGPGCSSIAYGASEELGPFRIDSDGKTLYLNPYAWNTVANVLFLDSPAGVGFSYTNTSS  158

Query  485  DILTHGDKR  511
            D+ T GD R
Sbjct  159  DLHTSGDHR  167



>ref|XP_010260044.1| PREDICTED: serine carboxypeptidase-like 25 isoform X1 [Nelumbo 
nucifera]
Length=462

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  301
            SSS ++++ D +  LPG   NVSF  +SGYVTV+Q +GRALFYW  EAV+DP SKPLV+W
Sbjct  22   SSSHEEEEADRITALPGQP-NVSFQQFSGYVTVDQVAGRALFYWLTEAVQDPVSKPLVVW  80

Query  302  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  481
            LNGGPGCSS+A+G +EE+GPF + + G  LY N +SWN+ ANLLF+++PAGVG+SY+N S
Sbjct  81   LNGGPGCSSVAYGASEEIGPFRLNRSGSGLYINKFSWNILANLLFLETPAGVGFSYTNRS  140

Query  482  SDILTHGDKR  511
            SD+L  GD+R
Sbjct  141  SDLLDTGDQR  150



>gb|KJB07560.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=405

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 108/152 (71%), Gaps = 9/152 (6%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWN  146

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            + AN+LF++SPAGVG+SY+NTSSD+   GD R
Sbjct  147  MEANILFLESPAGVGFSYTNTSSDLKDSGDDR  178



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 103/132 (78%), Gaps = 2/132 (2%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  295
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALFYW  E+  +  P+ +PLV
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLIESPMNRGPNLRPLV  83

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+LF+DSPAGVG+SY N
Sbjct  84   LWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANILFLDSPAGVGFSYCN  143

Query  476  TSSDILTHGDKR  511
             ++D+ T GD++
Sbjct  144  KTTDLYTFGDQK  155



>emb|CDO99728.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L FV L   S      +     Q+ D ++ LPG   N++F+ YSGYVTV++ +GRALFYW
Sbjct  15   LCFVTLHLASPIFVANAKQGRHQESDRIIRLPGQPANITFSQYSGYVTVDKIAGRALFYW  74

Query  254  FFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  427
              E  A E P +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  +PY+WN  AN
Sbjct  75   LIESPASEKPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVSPDGKTLGLSPYAWNKVAN  134

Query  428  LLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LLF+DSPAGVG+SYSNTS D++T GDKR
Sbjct  135  LLFLDSPAGVGFSYSNTSFDMVT-GDKR  161



>ref|XP_010509563.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=467

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 109/151 (72%), Gaps = 2/151 (1%)
 Frame = +2

Query  65   WGCLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + C+L V ++   +D    +  ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GR
Sbjct  10   YQCMLVVCMVIALVDVVSSRDDANKEQKIKDKIIALPGQPPKLNFSQFSGYVTVDSTAGR  69

Query  239  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  418
            ALFYW  E      +KPLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL +N Y+WN 
Sbjct  70   ALFYWLTETPRPSDTKPLVLWLNGGPGCSSIAYGASEEIGPFRINPDGKTLRFNIYAWNK  129

Query  419  AANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             AN+LF+DSPAGVG+SY+NTSSD +T GDKR
Sbjct  130  VANVLFLDSPAGVGFSYTNTSSDEVTVGDKR  160



>gb|AAM15112.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=447

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 105/146 (72%), Gaps = 5/146 (3%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            ++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALFYW
Sbjct  1    MVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFYW  55

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN+L
Sbjct  56   LTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANVL  115

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F+DSPAGVG+SY+NTSSD LT GDKR
Sbjct  116  FLDSPAGVGFSYTNTSSDELTVGDKR  141



>ref|XP_006297634.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30532.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=434

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALFYW  E+     P S+PLVLWL
Sbjct  29   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLVESPLTRSPKSRPLVLWL  88

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNT+S
Sbjct  89   NGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTTS  148

Query  485  DILTHGDKR  511
            D+ T GD+R
Sbjct  149  DLYTTGDQR  157



>gb|KJB07562.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=448

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 108/152 (71%), Gaps = 9/152 (6%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWN  146

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            + AN+LF++SPAGVG+SY+NTSSD+   GD R
Sbjct  147  MEANILFLESPAGVGFSYTNTSSDLKDSGDDR  178



>ref|XP_009618061.1| PREDICTED: serine carboxypeptidase-like 34 [Nicotiana tomentosiformis]
Length=232

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            LL VL             ++ QQ+ D V  LPG    VSF  Y+GYVTVN+  GRALFYW
Sbjct  9    LLLVLNFGVLARSHISEKALAQQEADRVNRLPGQP-PVSFKQYAGYVTVNETHGRALFYW  67

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
            FFEA  +P  KPL+LWLNGGPGCSSI +G AEE+GPF  +K+   L +N +SWN AANLL
Sbjct  68   FFEATTNPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKNKPELKFNNFSWNKAANLL  127

Query  434  FVDSPAGVGYSYSNTSSDILTHGD  505
            F++SP GVG+SY+NTSSDI   GD
Sbjct  128  FLESPVGVGFSYTNTSSDITELGD  151



>ref|XP_010516781.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=465

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 108/151 (72%), Gaps = 2/151 (1%)
 Frame = +2

Query  65   WGCLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + C+L V ++   +D       ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GR
Sbjct  8    YQCMLLVCMVIALLDVVSSSDDANKEQKMKDKIISLPGQPPKLNFSQFSGYVTVDSTAGR  67

Query  239  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  418
            ALFYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  + Y+WN 
Sbjct  68   ALFYWLTEAPSPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNTDGKTLRLSIYAWNK  127

Query  419  AANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             AN+LF+DSPAGVG+SY+NTSSD LT GDKR
Sbjct  128  VANVLFLDSPAGVGFSYTNTSSDELTVGDKR  158



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            L F L LA  ++ G        +  D +  LPG    V F+ YSGYVTVN  +GRALFYW
Sbjct  29   LSFSLTLALVLNYGVVGGLAASRASDRIYRLPGQP-PVGFSQYSGYVTVNARAGRALFYW  87

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
            F EA       PLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL+ NPY+WN  ANLL
Sbjct  88   FIEAPPATQPAPLVLWLNGGPGCSSIAYGASEEIGPFRIHPDGKTLFLNPYAWNSEANLL  147

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F+DSPAGVG+SYSNTSSD+ T GD+R
Sbjct  148  FLDSPAGVGFSYSNTSSDLYTAGDQR  173



>ref|XP_006373363.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
 gb|ERP51160.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
Length=432

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNSVANLL  130

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F+++PAGVG+SYSN SSD+L  GD R
Sbjct  131  FLETPAGVGFSYSNRSSDVLDTGDVR  156



>emb|CDP10248.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  313
            +QQ++D +L+LPG    VSF+ +SGYV VN++ GRALFYW  EA   P  KPLVLWLNGG
Sbjct  24   EQQEMDRILELPGQP-PVSFSQFSGYVPVNEDHGRALFYWLTEATSSPEKKPLVLWLNGG  82

Query  314  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            PGCSS+A+G +EE+GPF + K   +LY N +SWN  AN+LF++SPAGVG+SY+NTSSD+ 
Sbjct  83   PGCSSVAYGASEEIGPFRISKTASSLYLNKHSWNREANILFLESPAGVGFSYTNTSSDLK  142

Query  494  THGDKR  511
              GDKR
Sbjct  143  DSGDKR  148



>gb|KJB07564.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=488

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 108/152 (71%), Gaps = 9/152 (6%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWN  146

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            + AN+LF++SPAGVG+SY+NTSSD+   GD R
Sbjct  147  MEANILFLESPAGVGFSYTNTSSDLKDSGDDR  178



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  304
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALFYW  E+     P S+PLVLWL
Sbjct  27   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLVESPLTRSPKSRPLVLWL  86

Query  305  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  484
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNT+S
Sbjct  87   NGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTTS  146

Query  485  DILTHGDKR  511
            D+ T GD+R
Sbjct  147  DLYTTGDQR  155



>ref|XP_009420309.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=464

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 97/127 (76%), Gaps = 1/127 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
             DQQ  D +  LPG    V+FA +SGYVTVN+E GRALFYW  EA  D + KPLVLWLNG
Sbjct  33   ADQQAHDRITALPGQP-PVTFAQFSGYVTVNKEQGRALFYWLTEAATDAAKKPLVLWLNG  91

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+A+G +EE+GPF + +   +LY N +SWN  ANLLF++SPAGVG+SY+NTSSD+
Sbjct  92   GPGCSSVAYGASEEIGPFRISRTCSSLYLNQFSWNREANLLFLESPAGVGFSYTNTSSDL  151

Query  491  LTHGDKR  511
             T GD+R
Sbjct  152  KTSGDER  158



>ref|XP_009631140.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana tomentosiformis]
Length=464

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  310
              +Q+ D ++ LPG    V+F+ +SGYVTVN+  GRALFYW  EA   P  KPLVLWLNG
Sbjct  34   TKEQEFDRIISLPGQP-PVTFSQFSGYVTVNENHGRALFYWLTEATTQPEKKPLVLWLNG  92

Query  311  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  490
            GPGCSS+A+G +EE+GPF + K G +LY N YSWN  AN+LF++SPAGVG+SY+NTSSD+
Sbjct  93   GPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWNKVANILFLESPAGVGFSYTNTSSDL  152

Query  491  LTHGDKR  511
               GDKR
Sbjct  153  KDSGDKR  159



>ref|XP_002529402.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF32998.1| serine carboxypeptidase, putative [Ricinus communis]
Length=469

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 107/151 (71%), Gaps = 6/151 (4%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVD-----QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            + F+ L+     G   ++ VD     +Q+LD +  LPG    V+F+ +SGYVTVN++ GR
Sbjct  9    VFFLSLILVVFSGMDTTTIVDALANKEQELDRISALPGQP-PVTFSQFSGYVTVNEKHGR  67

Query  239  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  418
            ALFYW  EA   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + + G +LY N YSWN 
Sbjct  68   ALFYWLTEATSSPHHKPLVLWLNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSWNT  127

Query  419  AANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
             AN+LF++SPAGVG+SY+NTSSD+   GDKR
Sbjct  128  EANILFLESPAGVGFSYTNTSSDLKDSGDKR  158



>gb|KJB07559.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=488

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 108/152 (71%), Gaps = 9/152 (6%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  415
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWN  146

Query  416  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            + AN+LF++SPAGVG+SY+NTSSD+   GD R
Sbjct  147  MEANILFLESPAGVGFSYTNTSSDLKDSGDDR  178



>ref|XP_002324116.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF04249.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=468

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNSVANLL  130

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F+++PAGVG+SYSN SSD+L  GD R
Sbjct  131  FLETPAGVGFSYSNRSSDVLDTGDVR  156



>ref|XP_006373364.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
 gb|ERP51161.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
Length=488

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNSVANLL  130

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F+++PAGVG+SYSN SSD+L  GD R
Sbjct  131  FLETPAGVGFSYSNRSSDVLDTGDVR  156



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 104/145 (72%), Gaps = 1/145 (1%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  256
            + +LLL  S+      +  +QQ+LD +  LPG    V FA YSGYVTV+  +GRALFYW 
Sbjct  25   MCLLLLVGSLAAAAACTPAEQQELDRIARLPGQP-PVDFAQYSGYVTVDARAGRALFYWL  83

Query  257  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  436
             EA       PLVLWLNGGPGCSS+A+G +EE+GPF +  DGKTLY NPY+WN  AN+LF
Sbjct  84   VEAAPAAQPAPLVLWLNGGPGCSSVAYGASEELGPFRIRSDGKTLYLNPYAWNTVANVLF  143

Query  437  VDSPAGVGYSYSNTSSDILTHGDKR  511
            ++SPAGVG+SYSNTSSD+ T GD R
Sbjct  144  LESPAGVGFSYSNTSSDLYTAGDNR  168



>gb|KDO75846.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
 gb|KDO75847.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
Length=318

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 105/154 (68%), Gaps = 10/154 (6%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSS---------VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            CL F LL A  +   K  ++         +  +  D V +LPG   NV F HY+GYVTVN
Sbjct  12   CLTFCLLNALDVVSAKPLATRWPRDDGLNLSSENEDLVTNLPGQP-NVDFRHYAGYVTVN  70

Query  224  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  403
            + +GRALFYWF+EA+  P  KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG+ L +NP
Sbjct  71   EHNGRALFYWFYEAMTRPQEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTDGRGLQFNP  130

Query  404  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  505
            Y+WN  AN+LF++SP GVG+SYSNT++D    GD
Sbjct  131  YAWNKEANMLFLESPIGVGFSYSNTTNDYEMLGD  164



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 107/146 (73%), Gaps = 1/146 (1%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
             L +L+ A S      ++   +Q+ D +  LPG    V+F+ +SGYVTVN++ GR+LFYW
Sbjct  12   FLCLLIFAFSSINILAAAVPKEQEQDRISALPGQP-RVAFSQFSGYVTVNEQHGRSLFYW  70

Query  254  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  433
            F E+   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y+WN  AN+L
Sbjct  71   FTESPTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYAWNREANVL  130

Query  434  FVDSPAGVGYSYSNTSSDILTHGDKR  511
            F++SPAGVG+SY+NTSSD+ T GDKR
Sbjct  131  FLESPAGVGFSYTNTSSDLKTSGDKR  156



>emb|CBI29056.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  101  SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPS  280
            S+DG      + +QK D V  LPG    V F  Y+GYVTVN+  GRALFYWFFEA ++P 
Sbjct  21   SVDGHLSHEILARQKADRVKKLPGQP-EVGFRQYAGYVTVNESHGRALFYWFFEATQNPH  79

Query  281  SKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVG  460
             KPL+LWLNGGPGCSSI FG  EE+GPF   +DGK L +NP++WN AANLLFV+SP GVG
Sbjct  80   QKPLLLWLNGGPGCSSIGFGATEELGPFFPRRDGK-LKFNPHTWNKAANLLFVESPVGVG  138

Query  461  YSYSNTSSDILTHGD  505
            +SY+NTSSDI   GD
Sbjct  139  FSYTNTSSDIDQLGD  153



>ref|XP_010655923.1| PREDICTED: serine carboxypeptidase-like 34 [Vitis vinifera]
Length=504

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  101  SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPS  280
            S+DG      + +QK D V  LPG    V F  Y+GYVTVN+  GRALFYWFFEA ++P 
Sbjct  44   SVDGHLSHEILARQKADRVKKLPGQP-EVGFRQYAGYVTVNESHGRALFYWFFEATQNPH  102

Query  281  SKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVG  460
             KPL+LWLNGGPGCSSI FG  EE+GPF   +DGK L +NP++WN AANLLFV+SP GVG
Sbjct  103  QKPLLLWLNGGPGCSSIGFGATEELGPFFPRRDGK-LKFNPHTWNKAANLLFVESPVGVG  161

Query  461  YSYSNTSSDILTHGD  505
            +SY+NTSSDI   GD
Sbjct  162  FSYTNTSSDIDQLGD  176



>ref|XP_004304228.1| PREDICTED: serine carboxypeptidase-like 25 [Fragaria vesca subsp. 
vesca]
Length=475

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 106/147 (72%), Gaps = 3/147 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  253
            ++ VLLL   I    GS + ++++ D ++ LPG    V+F  +SGYVTVN   GRALFYW
Sbjct  17   MVSVLLLGLFISASNGSVN-EEEEADRIVSLPGQP-KVTFQQFSGYVTVNHRVGRALFYW  74

Query  254  FFEA-VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  430
              EA V+DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LYWN +SWN  ANL
Sbjct  75   LTEAAVKDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTATGLYWNKFSWNTEANL  134

Query  431  LFVDSPAGVGYSYSNTSSDILTHGDKR  511
            LF+++PAGVG+SYSN S+D+   GD R
Sbjct  135  LFLETPAGVGFSYSNRSADLFDTGDAR  161



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 99/133 (74%), Gaps = 2/133 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  292
             +S V++Q  D +  LPG   NV F  YSGYVTVN+  GRALFYW  E+    DP  +PL
Sbjct  19   NASYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEVRGRALFYWLVESPSTRDPKFRPL  78

Query  293  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  472
            VLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYS
Sbjct  79   VLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNQLANLLFLESPAGVGFSYS  138

Query  473  NTSSDILTHGDKR  511
            NT+SD+ T GD+R
Sbjct  139  NTTSDLYTTGDQR  151



>gb|KFK36473.1| hypothetical protein AALP_AA4G129300 [Arabis alpina]
Length=439

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +2

Query  116  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLV  295
            + + + +Q+  D ++ LPG   +++F+ YSGYVTV+  +GRALFYW  EA     +KPLV
Sbjct  3    RNNDAKEQKMKDKIISLPGQPPHLNFSQYSGYVTVDSAAGRALFYWLTEAPSPSGTKPLV  62

Query  296  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  475
            LWLNGGPGCSSIA+G +EEVGPF V  DGK+L+ N Y+WN  ANLLF+DSPAGVG+SY+N
Sbjct  63   LWLNGGPGCSSIAYGASEEVGPFRVNPDGKSLHLNLYAWNKVANLLFLDSPAGVGFSYTN  122

Query  476  TSSDILTHGDKR  511
             SSD LT GDKR
Sbjct  123  ASSDELTVGDKR  134



>ref|XP_010112534.1| Serine carboxypeptidase-like 34 [Morus notabilis]
 gb|EXC33987.1| Serine carboxypeptidase-like 34 [Morus notabilis]
Length=491

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  316
            +Q+ D V+ LPG   +V F H++GYVTVN+  GRA FYWFFEAV+ P  KPLVLWLNGGP
Sbjct  39   EQEADRVVGLPGQPSSVKFKHFAGYVTVNETHGRAFFYWFFEAVDKPQDKPLVLWLNGGP  98

Query  317  GCSSIAFGLAEEVGPFHVEKDGK-TLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  493
            GCSSI FG AEE+GPF  +  GK  L +NPY+WN AANLLF++SP GVG+SY+NTSSDI 
Sbjct  99   GCSSIGFGAAEELGPFFPQNGGKPKLKFNPYTWNNAANLLFLESPVGVGFSYTNTSSDIT  158

Query  494  THGD  505
              GD
Sbjct  159  NLGD  162



>ref|XP_011079399.1| PREDICTED: serine carboxypeptidase 24 [Sesamum indicum]
Length=462

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 109/154 (71%), Gaps = 1/154 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M  L    +L +  L++S+     ++    Q+LD +  LPG    V+F+ +SGYVTVN++
Sbjct  1    MEVLLRPHVLLLCFLSSSVLTALLAALPADQELDRISALPGQP-PVNFSQFSGYVTVNEQ  59

Query  230  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  409
             GRALFYW  EA  +  +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N YS
Sbjct  60   QGRALFYWLTEATSNAHTKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYS  119

Query  410  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            WN  AN+LF++SPAGVG+SY+NTSS++   GDKR
Sbjct  120  WNRVANILFLESPAGVGFSYTNTSSNLKDSGDKR  153



>ref|XP_003549539.1| PREDICTED: serine carboxypeptidase 24-like [Glycine max]
 gb|KHN17498.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSV-DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            M+  S   + F+ LL  +      + +V  +Q+ D +L LPG    V+F+ +SGYVTVN+
Sbjct  2    MTFQSKAGIFFLCLLIIAFSSINLAVAVPKEQEQDRILALPGQP-RVAFSQFSGYVTVNE  60

Query  227  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  406
            + GRALFYW  E+   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y
Sbjct  61   QHGRALFYWLTESPTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKY  120

Query  407  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKR  511
            +WN  A++LF++SPAGVG+SY+NTSSD+ T GDKR
Sbjct  121  AWNKEASILFLESPAGVGFSYTNTSSDLKTSGDKR  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115