BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G21

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011100603.1|  PREDICTED: tryptophan aminotransferase-relat...    140   4e-36   Sesamum indicum [beniseed]
ref|XP_009612270.1|  PREDICTED: tryptophan aminotransferase-relat...    130   2e-34   
ref|XP_007019616.1|  Pyridoxal phosphate (PLP)-dependent transfer...    135   2e-34   
ref|XP_007019615.1|  Pyridoxal phosphate (PLP)-dependent transfer...    135   3e-34   
ref|XP_009336501.1|  PREDICTED: tryptophan aminotransferase-relat...    133   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_009767595.1|  PREDICTED: tryptophan aminotransferase-relat...    132   3e-33   Nicotiana sylvestris
ref|XP_011100608.1|  PREDICTED: tryptophan aminotransferase-relat...    132   3e-33   Sesamum indicum [beniseed]
ref|XP_008237471.1|  PREDICTED: tryptophan aminotransferase-relat...    132   4e-33   Prunus mume [ume]
ref|XP_008237470.1|  PREDICTED: tryptophan aminotransferase-relat...    132   6e-33   
gb|KDP36550.1|  hypothetical protein JCGZ_08317                         131   1e-32   Jatropha curcas
ref|XP_006434530.1|  hypothetical protein CICLE_v10003681mg             130   2e-32   Citrus clementina [clementine]
ref|XP_011100906.1|  PREDICTED: tryptophan aminotransferase-relat...    130   2e-32   Sesamum indicum [beniseed]
ref|XP_009336503.1|  PREDICTED: tryptophan aminotransferase-relat...    130   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_008237472.1|  PREDICTED: tryptophan aminotransferase-relat...    130   3e-32   Prunus mume [ume]
ref|XP_011100930.1|  PREDICTED: tryptophan aminotransferase-relat...    130   3e-32   Sesamum indicum [beniseed]
ref|XP_011100941.1|  PREDICTED: tryptophan aminotransferase-relat...    130   3e-32   Sesamum indicum [beniseed]
ref|XP_009336502.1|  PREDICTED: tryptophan aminotransferase-relat...    129   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_007201022.1|  hypothetical protein PRUPE_ppa005405mg             129   7e-32   Prunus persica
ref|XP_006361618.1|  PREDICTED: tryptophan aminotransferase-relat...    129   8e-32   Solanum tuberosum [potatoes]
gb|EYU24350.1|  hypothetical protein MIMGU_mgv1a020894mg                128   9e-32   Erythranthe guttata [common monkey flower]
emb|CBI22765.3|  unnamed protein product                                128   1e-31   Vitis vinifera
ref|XP_011042900.1|  PREDICTED: tryptophan aminotransferase-relat...    128   1e-31   Populus euphratica
ref|XP_010665066.1|  PREDICTED: tryptophan aminotransferase-relat...    128   1e-31   Vitis vinifera
ref|XP_002300900.2|  alliinase family protein                           127   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008237546.1|  PREDICTED: tryptophan aminotransferase-relat...    127   4e-31   Prunus mume [ume]
ref|XP_008348777.1|  PREDICTED: LOW QUALITY PROTEIN: tryptophan a...    127   4e-31   
ref|XP_007201016.1|  hypothetical protein PRUPE_ppa005490mg             126   5e-31   
emb|CDP11449.1|  unnamed protein product                                127   5e-31   Coffea canephora [robusta coffee]
ref|XP_010063821.1|  PREDICTED: tryptophan aminotransferase-relat...    126   6e-31   Eucalyptus grandis [rose gum]
ref|XP_007201013.1|  hypothetical protein PRUPE_ppa005058mg             126   9e-31   Prunus persica
ref|XP_009759807.1|  PREDICTED: tryptophan aminotransferase-relat...    125   1e-30   Nicotiana sylvestris
ref|XP_006473123.1|  PREDICTED: tryptophan aminotransferase-relat...    125   1e-30   Citrus sinensis [apfelsine]
ref|XP_010665067.1|  PREDICTED: tryptophan aminotransferase-relat...    125   2e-30   Vitis vinifera
emb|CBI22766.3|  unnamed protein product                                124   2e-30   Vitis vinifera
emb|CDP11450.1|  unnamed protein product                                124   4e-30   Coffea canephora [robusta coffee]
ref|XP_009335145.1|  PREDICTED: tryptophan aminotransferase-relat...    124   5e-30   Pyrus x bretschneideri [bai li]
gb|KJB07710.1|  hypothetical protein B456_001G040000                    124   5e-30   Gossypium raimondii
ref|XP_008381905.1|  PREDICTED: tryptophan aminotransferase-relat...    123   5e-30   
ref|XP_004290481.1|  PREDICTED: tryptophan aminotransferase-relat...    124   5e-30   Fragaria vesca subsp. vesca
emb|CDY15309.1|  BnaC06g07950D                                          123   7e-30   Brassica napus [oilseed rape]
gb|KHG07342.1|  Tryptophan aminotransferase-related 4 -like protein     122   1e-29   Gossypium arboreum [tree cotton]
ref|XP_002524354.1|  Alliin lyase 1 precursor, putative                 122   2e-29   
ref|XP_002891072.1|  alliinase family protein                           121   3e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_006415044.1|  hypothetical protein EUTSA_v10007588mg             121   3e-29   Eutrema salsugineum [saltwater cress]
gb|KJB10098.1|  hypothetical protein B456_001G183500                    121   5e-29   Gossypium raimondii
ref|XP_010478827.1|  PREDICTED: LOW QUALITY PROTEIN: tryptophan a...    121   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_007019613.1|  Pyridoxal phosphate (PLP)-dependent transfer...    120   5e-29   
ref|XP_008386375.1|  PREDICTED: tryptophan aminotransferase-relat...    120   6e-29   Malus domestica [apple tree]
emb|CDX93734.1|  BnaA09g23340D                                          120   8e-29   
ref|XP_002524350.1|  Alliin lyase precursor, putative                   120   8e-29   
ref|XP_002524351.1|  Alliin lyase precursor, putative                   120   9e-29   Ricinus communis
emb|CDP11445.1|  unnamed protein product                                120   9e-29   Coffea canephora [robusta coffee]
ref|XP_010041603.1|  PREDICTED: tryptophan aminotransferase-relat...    120   1e-28   Eucalyptus grandis [rose gum]
ref|XP_006303527.1|  hypothetical protein CARUB_v10010953mg             120   1e-28   Capsella rubella
ref|XP_009114765.1|  PREDICTED: tryptophan aminotransferase-relat...    119   2e-28   Brassica rapa
ref|XP_006415038.1|  hypothetical protein EUTSA_v10010020mg             119   2e-28   
ref|XP_002893807.1|  alliinase family protein                           119   2e-28   
emb|CBI22772.3|  unnamed protein product                                119   2e-28   Vitis vinifera
ref|XP_002266138.1|  PREDICTED: tryptophan aminotransferase-relat...    119   2e-28   Vitis vinifera
ref|XP_003519988.1|  PREDICTED: tryptophan aminotransferase-relat...    119   4e-28   Glycine max [soybeans]
gb|KHN15434.1|  Tryptophan aminotransferase-related protein 4           118   4e-28   Glycine soja [wild soybean]
gb|KDP41082.1|  hypothetical protein JCGZ_03751                         117   5e-28   Jatropha curcas
gb|KCW71088.1|  hypothetical protein EUGRSUZ_F04186                     118   5e-28   Eucalyptus grandis [rose gum]
ref|XP_010063823.1|  PREDICTED: tryptophan aminotransferase-relat...    118   7e-28   
ref|XP_010478823.1|  PREDICTED: tryptophan aminotransferase-relat...    117   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010461224.1|  PREDICTED: tryptophan aminotransferase-relat...    117   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009600008.1|  PREDICTED: tryptophan aminotransferase-relat...    117   9e-28   Nicotiana tomentosiformis
ref|NP_564435.1|  tryptophan aminotransferase-related protein 4         117   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266053.1|  PREDICTED: tryptophan aminotransferase-relat...    117   1e-27   Vitis vinifera
ref|XP_008778097.1|  PREDICTED: tryptophan aminotransferase-relat...    116   2e-27   Phoenix dactylifera
ref|XP_006361959.1|  PREDICTED: tryptophan aminotransferase-relat...    116   2e-27   Solanum tuberosum [potatoes]
ref|NP_174666.1|  Pyridoxal phosphate-dependent transferases supe...    116   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302159.2|  hypothetical protein POPTR_0002s06430g             115   4e-27   
ref|XP_002524352.1|  nucleotide binding protein, putative               118   5e-27   
ref|XP_007019618.1|  Pyridoxal phosphate-dependent transferases s...    115   6e-27   
ref|XP_010665087.1|  PREDICTED: tryptophan aminotransferase-relat...    114   9e-27   Vitis vinifera
emb|CDX91788.1|  BnaC08g07070D                                          114   1e-26   
emb|CDY46456.1|  BnaA08g06520D                                          114   1e-26   Brassica napus [oilseed rape]
ref|XP_004233981.1|  PREDICTED: tryptophan aminotransferase-relat...    114   2e-26   Solanum lycopersicum
gb|AAL25576.1|  At1g34060/F12G12_150                                    114   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010928309.1|  PREDICTED: tryptophan aminotransferase-relat...    114   2e-26   Elaeis guineensis
ref|XP_010109327.1|  Tryptophan aminotransferase-related protein 4      114   2e-26   Morus notabilis
ref|XP_006307464.1|  hypothetical protein CARUB_v10009091mg             112   4e-26   Capsella rubella
ref|XP_003533758.2|  PREDICTED: tryptophan aminotransferase-relat...    112   7e-26   Glycine max [soybeans]
dbj|BAJ93510.1|  predicted protein                                      112   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009395075.1|  PREDICTED: tryptophan aminotransferase-relat...    111   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW44237.1|  hypothetical protein EUGRSUZ_L023401                    111   1e-25   Eucalyptus grandis [rose gum]
ref|XP_011042901.1|  PREDICTED: tryptophan aminotransferase-relat...    111   1e-25   Populus euphratica
ref|XP_009107936.1|  PREDICTED: LOW QUALITY PROTEIN: tryptophan a...    111   1e-25   Brassica rapa
tpg|DAA57866.1|  TPA: hypothetical protein ZEAMMB73_021845              108   2e-25   
emb|CDM83618.1|  unnamed protein product                                111   2e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003548085.1|  PREDICTED: tryptophan aminotransferase-relat...    109   7e-25   Glycine max [soybeans]
tpg|DAA57867.1|  TPA: alliin lyase                                      108   1e-24   
ref|NP_001149758.1|  alliin lyase                                       108   1e-24   
ref|XP_003533757.1|  PREDICTED: tryptophan aminotransferase-relat...    107   2e-24   Glycine max [soybeans]
gb|KHN32839.1|  Tryptophan aminotransferase-related protein 4           107   2e-24   Glycine soja [wild soybean]
ref|XP_003534921.1|  PREDICTED: tryptophan aminotransferase-relat...    107   3e-24   
ref|XP_010261034.1|  PREDICTED: tryptophan aminotransferase-relat...    107   4e-24   Nelumbo nucifera [Indian lotus]
ref|XP_004969757.1|  PREDICTED: tryptophan aminotransferase-relat...    107   8e-24   Setaria italica
ref|XP_004969760.1|  PREDICTED: tryptophan aminotransferase-relat...    106   8e-24   Setaria italica
ref|XP_003569691.1|  PREDICTED: alliin lyase-like                       106   9e-24   Brachypodium distachyon [annual false brome]
ref|NP_001169706.1|  uncharacterized protein LOC100383587               104   1e-23   
gb|EMS62345.1|  Alliin lyase 1                                          105   2e-23   Triticum urartu
ref|XP_010675473.1|  PREDICTED: tryptophan aminotransferase-relat...    105   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008673216.1|  PREDICTED: uncharacterized protein LOC100383...    105   2e-23   
gb|EAY75618.1|  hypothetical protein OsI_03523                          105   2e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_001044075.1|  Os01g0717700                                       105   2e-23   
gb|AAF36437.1|AF126049_1  cysteine-sulphoxide lyase                     105   2e-23   Allium cepa
ref|XP_010915068.1|  PREDICTED: tryptophan aminotransferase-relat...    104   5e-23   Elaeis guineensis
ref|XP_006644625.1|  PREDICTED: alliin lyase-like                       103   7e-23   Oryza brachyantha
ref|XP_008381915.1|  PREDICTED: tryptophan aminotransferase-relat...    100   9e-23   
gb|KHN32840.1|  Tryptophan aminotransferase-related protein 4           103   1e-22   Glycine soja [wild soybean]
ref|XP_004969758.1|  PREDICTED: alliin lyase-like                       103   1e-22   Setaria italica
ref|XP_004969756.1|  PREDICTED: tryptophan aminotransferase-relat...    103   2e-22   Setaria italica
ref|XP_007151936.1|  hypothetical protein PHAVU_004G088400g             101   4e-22   Phaseolus vulgaris [French bean]
ref|XP_003519973.2|  PREDICTED: tryptophan aminotransferase-relat...    101   5e-22   Glycine max [soybeans]
ref|XP_006574777.1|  PREDICTED: tryptophan aminotransferase-relat...    101   5e-22   Glycine max [soybeans]
gb|AEX55243.1|  unknown                                                 100   5e-22   Allium sativum
gb|ACN78838.1|  alliinase                                               101   7e-22   Allium sativum
gb|ACL31074.1|  alliinase                                             99.8    1e-21   Allium sativum
gb|ACL31113.1|  alliinase                                             99.8    2e-21   Allium sativum
gb|ACL31057.1|  alliinase                                             99.8    2e-21   Allium sativum
gb|ACL31110.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31079.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31076.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31038.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31120.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31061.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31088.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31115.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31067.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31036.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31077.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31127.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31109.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31060.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31096.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31117.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31075.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31124.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31037.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31080.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|ACL31102.1|  alliinase                                             99.4    2e-21   Allium sativum
ref|NP_001044074.1|  Os01g0717400                                       100   2e-21   
gb|ACL31086.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|EAY75616.1|  hypothetical protein OsI_03520                          100   2e-21   Oryza sativa Indica Group [Indian rice]
pdb|2HOR|A  Chain A, Crystal Structure Of Alliinase From Garlic- ...  99.4    2e-21   Allium sativum
gb|ACL31065.1|  alliinase                                             99.4    2e-21   Allium sativum
gb|EEE55303.1|  hypothetical protein OsJ_03258                          100   2e-21   Oryza sativa Japonica Group [Japonica rice]
pdb|1LK9|A  Chain A, The Three-Dimensional Structure Of Alliinase...  99.4    3e-21   Allium sativum
gb|ACL31099.1|  alliinase                                             99.0    3e-21   Allium sativum
sp|Q41233.1|ALLN2_ALLSA  RecName: Full=Alliin lyase 2; Short=Alli...  99.8    3e-21   Allium sativum
sp|Q01594.1|ALLN1_ALLSA  RecName: Full=Alliin lyase 1; Short=Alli...  99.8    3e-21   Allium sativum
dbj|BAD06448.1|  alliinase-like                                       99.4    4e-21   Allium cepa
gb|AAA32639.1|  alliinase                                             99.0    5e-21   Allium cepa
emb|CAA78267.1|  precursor alliinase                                  99.0    6e-21   Allium cepa
gb|AAD26853.1|AF124405_1  alliinase precursor                         99.0    6e-21   Allium cepa
sp|P31757.2|ALLN_ALLCE  RecName: Full=Alliin lyase; Short=Alliina...  99.0    6e-21   Allium cepa
gb|ACL31111.1|  alliinase                                             97.8    7e-21   Allium sativum
gb|ACL31042.1|  alliinase                                             97.4    9e-21   Allium sativum
gb|ACL31118.1|  alliinase                                             97.4    9e-21   Allium sativum
ref|XP_010665065.1|  PREDICTED: tryptophan aminotransferase-relat...  97.8    2e-20   
sp|P31756.1|ALLN_ALLCG  RecName: Full=Alliin lyase; Short=Alliina...  96.7    3e-20   Allium cepa var. aggregatum
dbj|BAA20358.1|  alliinase                                            97.1    3e-20   Allium tuberosum
gb|ACL31100.1|  alliinase                                             95.5    5e-20   Allium sativum
gb|ACL31048.1|  alliinase                                             95.1    6e-20   Allium sativum
ref|XP_009407278.1|  PREDICTED: tryptophan aminotransferase-relat...  91.3    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002960756.1|  hypothetical protein SELMODRAFT_75581            90.9    5e-18   Selaginella moellendorffii
ref|XP_002983914.1|  hypothetical protein SELMODRAFT_423204           88.6    3e-17   
ref|XP_001756693.1|  predicted protein                                88.6    4e-17   
ref|XP_002965434.1|  hypothetical protein SELMODRAFT_406798           85.1    5e-16   
ref|XP_002994169.1|  hypothetical protein SELMODRAFT_163364           84.7    5e-16   
emb|CDP11448.1|  unnamed protein product                              78.6    1e-14   Coffea canephora [robusta coffee]
ref|XP_001766876.1|  predicted protein                                77.4    1e-13   
gb|KHG26661.1|  Tryptophan aminotransferase-related 4 -like protein   73.6    2e-13   Gossypium arboreum [tree cotton]
ref|XP_009778185.1|  PREDICTED: alliin lyase 1-like                   71.6    7e-13   Nicotiana sylvestris
gb|KJB14639.1|  hypothetical protein B456_002G135400                  68.2    2e-11   Gossypium raimondii
emb|CAN81399.1|  hypothetical protein VITISV_018728                   66.2    8e-11   Vitis vinifera
gb|KHN41290.1|  Tryptophan aminotransferase-related protein 4         65.5    7e-10   Glycine soja [wild soybean]
ref|XP_006644626.1|  PREDICTED: LOW QUALITY PROTEIN: tryptophan a...  65.9    2e-09   Oryza brachyantha
tpg|DAA57865.1|  TPA: hypothetical protein ZEAMMB73_021845            62.8    2e-09   
gb|ACG45500.1|  hypothetical protein                                  62.8    2e-09   Zea mays [maize]
gb|EYU24346.1|  hypothetical protein MIMGU_mgv1a008741mg              64.7    3e-09   Erythranthe guttata [common monkey flower]
emb|CAN81398.1|  hypothetical protein VITISV_018727                   65.5    3e-09   Vitis vinifera
ref|XP_001773769.1|  predicted protein                                62.4    2e-08   
ref|XP_007200062.1|  hypothetical protein PRUPE_ppa022549mg           62.0    3e-08   
gb|KJB10099.1|  hypothetical protein B456_001G183500                  60.1    1e-07   Gossypium raimondii
gb|KCW71085.1|  hypothetical protein EUGRSUZ_F041842                  56.2    2e-07   Eucalyptus grandis [rose gum]
ref|XP_010063822.1|  PREDICTED: tryptophan aminotransferase-relat...  58.2    5e-07   
gb|KCW71086.1|  hypothetical protein EUGRSUZ_F041841                  53.9    1e-05   Eucalyptus grandis [rose gum]
ref|XP_004969761.1|  PREDICTED: alliin lyase-like                     50.1    3e-05   
ref|XP_010501768.1|  PREDICTED: tryptophan aminotransferase-relat...  49.3    2e-04   



>ref|XP_011100603.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Sesamum indicum]
Length=452

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 100/132 (76%), Gaps = 9/132 (7%)
 Frame = +1

Query  133  YGGDGEWRLRELK-WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSG  309
            Y GD EW+ + L  W+++AAA AE VA + CSGHGRAY+DG + D    PVCEC+ CY G
Sbjct  25   YVGD-EWKKQRLSSWAEEAAAEAEAVALISCSGHGRAYLDGVVVDG--KPVCECNTCYGG  81

Query  310  PDCSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQ  489
            P CSL  PDC ADAD GDPLFLEPFW+QN A SAV++S WHRMSY+FPGSS     + SQ
Sbjct  82   PHCSLFSPDCAADADGGDPLFLEPFWMQNPAGSAVLISGWHRMSYAFPGSS-----FISQ  136

Query  490  ELENHIRKVHAV  525
            ELENHIR+VH++
Sbjct  137  ELENHIRRVHSI  148



>ref|XP_009612270.1| PREDICTED: tryptophan aminotransferase-related protein 4-like, 
partial [Nicotiana tomentosiformis]
Length=167

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 92/122 (75%), Gaps = 7/122 (6%)
 Frame = +1

Query  160  RELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDC  339
             +L WSQ AA  AE VAA+ CSG+GR Y+DG + D    P+CEC++CY G DCSLLLP+C
Sbjct  1    EKLSWSQRAAEEAEAVAAISCSGNGRVYVDGIVVDG--KPICECYSCYGGRDCSLLLPNC  58

Query  340  FADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
             AD + GDPLFLEPFW+QNAA+SAVVV+ WHRMSY FP  S     Y S+ELE +IRK+H
Sbjct  59   PADVEGGDPLFLEPFWIQNAANSAVVVAGWHRMSYFFPNQS-----YISKELEKNIRKIH  113

Query  520  AV  525
            A+
Sbjct  114  AI  115



>ref|XP_007019616.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein, putative isoform 2 [Theobroma cacao]
 gb|EOY16841.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein, putative isoform 2 [Theobroma cacao]
Length=395

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 113/160 (71%), Gaps = 10/160 (6%)
 Frame = +1

Query  46   MAKGMQGFGYAFClllsvllnillvanilYGGDGEWRLRELKWSQDaaaaaetvaaLQCS  225
            M K    F +A CL+ S++LN+L + NI  GG  +W    L WS  AAA AE VAA  CS
Sbjct  1    MVKSRLSFKFAGCLVSSLILNLLFIINIYVGG--QW---NLSWSSRAAAEAEAVAATSCS  55

Query  226  GHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNaas  405
            GHGRAY+DG + D    PVCEC+ CY+GPDCS  +P C A+AD GDPLFLEPFW+Q+AAS
Sbjct  56   GHGRAYLDGLVVDGNTEPVCECNACYTGPDCSQYIPHCMANADGGDPLFLEPFWLQHAAS  115

Query  406  savvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            SA+VV+ WHRMSYSF GS+     Y S+ELE  IRKVHA+
Sbjct  116  SALVVAGWHRMSYSFDGST-----YISKELERLIRKVHAL  150



>ref|XP_007019615.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY16840.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=458

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 113/160 (71%), Gaps = 10/160 (6%)
 Frame = +1

Query  46   MAKGMQGFGYAFClllsvllnillvanilYGGDGEWRLRELKWSQDaaaaaetvaaLQCS  225
            M K    F +A CL+ S++LN+L + NI  GG  +W    L WS  AAA AE VAA  CS
Sbjct  1    MVKSRLSFKFAGCLVSSLILNLLFIINIYVGG--QW---NLSWSSRAAAEAEAVAATSCS  55

Query  226  GHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNaas  405
            GHGRAY+DG + D    PVCEC+ CY+GPDCS  +P C A+AD GDPLFLEPFW+Q+AAS
Sbjct  56   GHGRAYLDGLVVDGNTEPVCECNACYTGPDCSQYIPHCMANADGGDPLFLEPFWLQHAAS  115

Query  406  savvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            SA+VV+ WHRMSYSF GS+     Y S+ELE  IRKVHA+
Sbjct  116  SALVVAGWHRMSYSFDGST-----YISKELERLIRKVHAL  150



>ref|XP_009336501.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Pyrus x bretschneideri]
Length=470

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 94/128 (73%), Gaps = 9/128 (7%)
 Frame = +1

Query  142  DGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCS  321
            +GEW+L    WS+ AA  AE VAA+ CSGHGRAY+DG I D G  PVCEC++CY GPDCS
Sbjct  31   EGEWKL---SWSRRAAEEAEHVAAIPCSGHGRAYLDGLILD-GKEPVCECNSCYGGPDCS  86

Query  322  LLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELEN  501
            L +  C A+AD GDP FLEPFW+Q+AA SA+ V+ WHRMSYS+P  S+      S ELEN
Sbjct  87   LFVTGCAANADGGDPFFLEPFWMQHAAKSAIAVAGWHRMSYSYPDKSS-----MSAELEN  141

Query  502  HIRKVHAV  525
            HIR VHA+
Sbjct  142  HIRTVHAI  149



>ref|XP_009767595.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Nicotiana sylvestris]
Length=464

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 110/160 (69%), Gaps = 13/160 (8%)
 Frame = +1

Query  46   MAKGMQGFGYAFClllsvllnillvanilYGGDGEWRLRELKWSQDaaaaaetvaaLQCS  225
            MAK +Q F Y  CLL+S+L+NI     + Y  D      +L WSQ AA  AE VAA+ CS
Sbjct  1    MAKNIQRFSYVVCLLVSILVNIFFFRKMYYEKD------KLSWSQRAAEEAEAVAAISCS  54

Query  226  GHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNaas  405
            G+GR ++DG + D    P+CEC++CY G DCSLLL  C AD + GDPLFLEPFW+QNAAS
Sbjct  55   GNGRVFVDGIVVDG--KPICECYSCYGGNDCSLLLATCPADVEGGDPLFLEPFWMQNAAS  112

Query  406  savvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            SAVVV+ WHRMSY FP  S     Y S+ELE +IRK+HA+
Sbjct  113  SAVVVAGWHRMSYFFPNQS-----YISKELEKNIRKIHAI  147



>ref|XP_011100608.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Sesamum indicum]
Length=458

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 98/132 (74%), Gaps = 9/132 (7%)
 Frame = +1

Query  133  YGGDGEWRLRELK-WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSG  309
            Y GD EW+ ++L  W+++AAA AE VA + CSGHGRAY+DG + D    PVCEC+ CY G
Sbjct  30   YLGD-EWKKQKLSNWAEEAAAEAEAVALISCSGHGRAYLDGAVVDG--KPVCECNTCYGG  86

Query  310  PDCSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQ  489
            PDCSL  PDC ADA  GDPLFLEPFW+Q+AASSAVVV+ WHRMSY+F   S     Y SQ
Sbjct  87   PDCSLFSPDCAADALRGDPLFLEPFWMQHAASSAVVVAGWHRMSYTFSDDS-----YISQ  141

Query  490  ELENHIRKVHAV  525
            ELE HIR+ HAV
Sbjct  142  ELETHIRRAHAV  153



>ref|XP_008237471.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
isoform X2 [Prunus mume]
Length=479

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 93/128 (73%), Gaps = 9/128 (7%)
 Frame = +1

Query  142  DGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCS  321
            DGEWRL    WS+ AA  AE VAA+ CSGHGRAY+DG + D G  PVCEC++CY GPDCS
Sbjct  30   DGEWRL---TWSKGAAEEAERVAAISCSGHGRAYLDGLVLD-GKEPVCECNSCYEGPDCS  85

Query  322  LLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELEN  501
              +  C A+ADSGDP FLEPFW+Q+AA SA++V+ WHRM YSFP  S     Y S ELE 
Sbjct  86   EFVTGCAANADSGDPYFLEPFWMQHAAQSALLVAGWHRMGYSFPDGS-----YISAELEG  140

Query  502  HIRKVHAV  525
            HIRK+HA 
Sbjct  141  HIRKLHAT  148



>ref|XP_008237470.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
isoform X1 [Prunus mume]
Length=490

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 93/128 (73%), Gaps = 9/128 (7%)
 Frame = +1

Query  142  DGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCS  321
            DGEWRL    WS+ AA  AE VAA+ CSGHGRAY+DG + D G  PVCEC++CY GPDCS
Sbjct  41   DGEWRL---TWSKGAAEEAERVAAISCSGHGRAYLDGLVLD-GKEPVCECNSCYEGPDCS  96

Query  322  LLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELEN  501
              +  C A+ADSGDP FLEPFW+Q+AA SA++V+ WHRM YSFP  S     Y S ELE 
Sbjct  97   EFVTGCAANADSGDPYFLEPFWMQHAAQSALLVAGWHRMGYSFPDGS-----YISAELEG  151

Query  502  HIRKVHAV  525
            HIRK+HA 
Sbjct  152  HIRKLHAT  159



>gb|KDP36550.1| hypothetical protein JCGZ_08317 [Jatropha curcas]
Length=459

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 94/131 (72%), Gaps = 10/131 (8%)
 Frame = +1

Query  133  YGGDGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGP  312
            Y G+G+     L W++ AA  AE VAA+ CSGHGRAY+DG I D    P+CEC +CY GP
Sbjct  31   YVGEGD-----LTWTKRAATEAEAVAAISCSGHGRAYLDGLILDGKQEPICECSDCYGGP  85

Query  313  DCSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQE  492
            DCS L P+C  +A+SGDPLFLEPFWV++A SSA +V+ WHRMSY +   S     Y SQE
Sbjct  86   DCSQLFPNCTVNANSGDPLFLEPFWVKHAGSSAFLVAGWHRMSYMYSDGS-----YISQE  140

Query  493  LENHIRKVHAV  525
            LE+HIRKVHA+
Sbjct  141  LESHIRKVHAI  151



>ref|XP_006434530.1| hypothetical protein CICLE_v10003681mg [Citrus clementina]
 gb|ESR47770.1| hypothetical protein CICLE_v10003681mg [Citrus clementina]
Length=456

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 93/120 (78%), Gaps = 5/120 (4%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L WS  AA  AE  AA+ CSGHGRAY+DG++ D G  PVCEC++C+SGPDCSL LP C A
Sbjct  39   LSWSSKAAIEAEAAAAISCSGHGRAYLDGQVFD-GNQPVCECNSCFSGPDCSLFLPGCAA  97

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            DA+SGDPLFLEPFW+++AASSA++++ WHRMSY F       S++ SQELE  IRK+H++
Sbjct  98   DAESGDPLFLEPFWMKHAASSAILIAGWHRMSYRF----TRASSFISQELEKKIRKLHSI  153



>ref|XP_011100906.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Sesamum indicum]
Length=459

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 90/122 (74%), Gaps = 7/122 (6%)
 Frame = +1

Query  160  RELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDC  339
            + L WS  AAA AE VA++ CSGHGRA++DG I +    PVCEC+ CY GPDCS LLP+C
Sbjct  33   KPLSWSTTAAAEAEAVASISCSGHGRAFLDGLIENG--KPVCECNACYGGPDCSQLLPNC  90

Query  340  FADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
             ADADSGDPLFLEPFW++N+  S VV+  WHRMSY +  +S     Y SQELE +IRK+H
Sbjct  91   VADADSGDPLFLEPFWLKNSGRSTVVIPGWHRMSYDYSDNS-----YISQELEKNIRKLH  145

Query  520  AV  525
            A+
Sbjct  146  AI  147



>ref|XP_009336503.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Pyrus x bretschneideri]
Length=444

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 92/128 (72%), Gaps = 9/128 (7%)
 Frame = +1

Query  142  DGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCS  321
            DGE   REL WS+ AA  AE VAA+ CSGHGRAY+DG +   GI PVCEC+ CY GPDCS
Sbjct  25   DGE---RELSWSKRAAQEAEQVAAISCSGHGRAYLDGLVLY-GIKPVCECNPCYGGPDCS  80

Query  322  LLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELEN  501
            + L DC A+A SGDP FLEPFW+Q AA SA++V+ WHRM Y+FP SS     Y S +LE 
Sbjct  81   MFLTDCAANAGSGDPYFLEPFWMQRAAKSAILVAGWHRMGYTFPDSS-----YISTQLEA  135

Query  502  HIRKVHAV  525
             I KVHA+
Sbjct  136  SIHKVHAI  143



>ref|XP_008237472.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Prunus mume]
Length=463

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 93/127 (73%), Gaps = 9/127 (7%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW   EL WS+ AA  AE VAA+ CSGHGRAY+DG + D G  PVCEC++CY GPDCS 
Sbjct  30   GEW---ELSWSRGAAEEAEHVAAVSCSGHGRAYLDGLVLD-GKEPVCECNSCYGGPDCSQ  85

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
             L  C A+ADSGDPLFLEPFW+Q+AA SAVVV+ WHRMSY+F   S       S ELE H
Sbjct  86   FLTACTANADSGDPLFLEPFWMQHAAKSAVVVAGWHRMSYTFADQSR-----ISAELERH  140

Query  505  IRKVHAV  525
            IRK+HA+
Sbjct  141  IRKLHAI  147



>ref|XP_011100930.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Sesamum indicum]
Length=459

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 90/122 (74%), Gaps = 7/122 (6%)
 Frame = +1

Query  160  RELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDC  339
            + L WS  AAA AE VA++ CSGHGRA++DG I +    PVCEC+ CY GPDCS LLP+C
Sbjct  33   KPLSWSTRAAAEAEAVASISCSGHGRAFLDGLIENG--KPVCECNACYGGPDCSQLLPNC  90

Query  340  FADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
             ADADSGDPLFLEPFW++N+  S VV+  WHRMSY +  +S     Y SQELE +IRK+H
Sbjct  91   VADADSGDPLFLEPFWLKNSGRSTVVIPGWHRMSYDYSDNS-----YISQELEKNIRKLH  145

Query  520  AV  525
            A+
Sbjct  146  AI  147



>ref|XP_011100941.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Sesamum indicum]
Length=461

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 8/126 (6%)
 Frame = +1

Query  151  WRLRELK-WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLL  327
            W+ ++L  W+++AAA AE VA + CSGHGRAY+DG + D    PVCEC+ CY GP CSL 
Sbjct  31   WKKQKLSSWAEEAAAEAEAVALISCSGHGRAYLDGAVVDG--KPVCECNTCYGGPHCSLF  88

Query  328  LPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHI  507
             PDC AD +SGDPLFLEPFW+Q+AASSAVV++ WHRMSY+F   S     Y S+ELENHI
Sbjct  89   SPDCAADVNSGDPLFLEPFWMQHAASSAVVIAGWHRMSYTFSDHS-----YISRELENHI  143

Query  508  RKVHAV  525
            R+VHAV
Sbjct  144  RRVHAV  149



>ref|XP_009336502.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Pyrus x bretschneideri]
Length=471

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 106/160 (66%), Gaps = 11/160 (7%)
 Frame = +1

Query  46   MAKGMQGFGYAFClllsvllnillvanilYGGDGEWRLRELKWSQDaaaaaetvaaLQCS  225
            MAK  Q F YA CL  S++ N+LL   +     G W   EL WS+ AA  AE VA + CS
Sbjct  1    MAKA-QSF-YAVCLAFSLVFNLLLSFRLYVDVGGNW---ELSWSKRAAEEAEHVATISCS  55

Query  226  GHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNaas  405
            GHGRAY+DG I D G  PVCEC++CY GPDCSL L  C A+ADSGDP FLEPFW ++A+ 
Sbjct  56   GHGRAYLDGLILD-GKEPVCECNSCYGGPDCSLFLTGCAANADSGDPYFLEPFWTKHASK  114

Query  406  savvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            SAV+V+ WHRMSY FP  S       S ELE HIR++H +
Sbjct  115  SAVLVAGWHRMSYVFPDQSR-----VSAELERHIREIHTI  149



>ref|XP_007201022.1| hypothetical protein PRUPE_ppa005405mg [Prunus persica]
 gb|EMJ02221.1| hypothetical protein PRUPE_ppa005405mg [Prunus persica]
Length=463

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 93/127 (73%), Gaps = 9/127 (7%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW   EL WS+ AA  AE VAA+ CSGHGRAY+DG I D G  PVCEC++CY GPDCS 
Sbjct  30   GEW---ELSWSRGAAEEAEHVAAVSCSGHGRAYLDGLILD-GKEPVCECNSCYGGPDCSQ  85

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
             L  C A+ADSGDPLFLEPFW+Q+AA SAVVV+ WHRMSY+F   S       S +LE H
Sbjct  86   FLTACAANADSGDPLFLEPFWMQHAAKSAVVVAGWHRMSYTFADQSR-----ISAKLERH  140

Query  505  IRKVHAV  525
            IRK+HA+
Sbjct  141  IRKLHAI  147



>ref|XP_006361618.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Solanum tuberosum]
Length=462

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 91/121 (75%), Gaps = 5/121 (4%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            +L WSQ AA  AE VA++ CSGHGRAYIDG +  DG  P+CEC++CY G DCSL   +C 
Sbjct  34   KLSWSQRAAQEAEKVASISCSGHGRAYIDGYVNVDG-NPICECYSCYGGIDCSLFSSNCS  92

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            A+ + GDPLFLEPFW+QNAASSAVVV+ WHRMSY FP +     ++ S+ELE  IRK+HA
Sbjct  93   ANVEGGDPLFLEPFWMQNAASSAVVVAGWHRMSYVFPNN----LSFISKELEKSIRKIHA  148

Query  523  V  525
            +
Sbjct  149  I  149



>gb|EYU24350.1| hypothetical protein MIMGU_mgv1a020894mg [Erythranthe guttata]
Length=412

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%), Gaps = 7/129 (5%)
 Frame = +1

Query  133  YGGDGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGP  312
            Y G  + + ++L WS  AAA AE VA++ CSGHGRA++DG I D    P+CEC+ CY G 
Sbjct  25   YLGTDQLKSQKLSWSLKAAAEAEAVASISCSGHGRAFLDGLIVDG--KPICECNTCYGGS  82

Query  313  DCSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQE  492
            DCSL  PDC ADA+SGDPLFLEPFW+++AASSAV++S WHRMSY+F   S     + SQ+
Sbjct  83   DCSLFSPDCSADANSGDPLFLEPFWMEHAASSAVLISGWHRMSYTFYDKS-----FISQQ  137

Query  493  LENHIRKVH  519
            LENH+R+VH
Sbjct  138  LENHVRRVH  146



>emb|CBI22765.3| unnamed protein product [Vitis vinifera]
Length=473

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 90/121 (74%), Gaps = 7/121 (6%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            EL WS+ AA  AE VAA+ CSGHGR Y+DG + D   +PVCEC++C+ GPDCS   PDC 
Sbjct  51   ELSWSRRAAEEAEAVAAVSCSGHGRGYLDGLVVDG--SPVCECNSCFGGPDCSQFAPDCV  108

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            ADADSGDPLFLEPFW+QNAASSA++V+ WHRMSY+F   S       S+ LE+HIRK+H 
Sbjct  109  ADADSGDPLFLEPFWIQNAASSAMLVAGWHRMSYTFTNQS-----LISRLLEDHIRKLHT  163

Query  523  V  525
             
Sbjct  164  T  164



>ref|XP_011042900.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Populus euphratica]
Length=455

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 90/127 (71%), Gaps = 8/127 (6%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW    L WS+ AA  AE VAA+ CSGHGRAY+DG + D    PVCEC+ CY GPDCS 
Sbjct  29   GEW---NLSWSKRAATEAEAVAAISCSGHGRAYLDGLVLDGNKGPVCECNTCYGGPDCSQ  85

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
              PDC ADA+ GDPLFLEPFW+Q+AASSA++V+ WHRMSYS+   S       S ELE H
Sbjct  86   FFPDCSADANGGDPLFLEPFWMQHAASSALLVAGWHRMSYSYADRST-----ISIELERH  140

Query  505  IRKVHAV  525
            IRK+H +
Sbjct  141  IRKLHDI  147



>ref|XP_010665066.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Vitis vinifera]
Length=457

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 90/121 (74%), Gaps = 7/121 (6%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            EL WS+ AA  AE VAA+ CSGHGR Y+DG + D   +PVCEC++C+ GPDCS   PDC 
Sbjct  35   ELSWSRRAAEEAEAVAAVSCSGHGRGYLDGLVVDG--SPVCECNSCFGGPDCSQFAPDCV  92

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            ADADSGDPLFLEPFW+QNAASSA++V+ WHRMSY+F   S       S+ LE+HIRK+H 
Sbjct  93   ADADSGDPLFLEPFWIQNAASSAMLVAGWHRMSYTFTNQS-----LISRLLEDHIRKLHT  147

Query  523  V  525
             
Sbjct  148  T  148



>ref|XP_002300900.2| alliinase family protein [Populus trichocarpa]
 gb|EEE80173.2| alliinase family protein [Populus trichocarpa]
Length=456

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 91/127 (72%), Gaps = 8/127 (6%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW    L WS+ AA  AE VAA+ CSGHGRAY+DG + D    PVCEC+ CY GPDCS 
Sbjct  29   GEW---NLSWSKTAATEAEAVAAIPCSGHGRAYLDGLVLDGNKGPVCECNTCYGGPDCSQ  85

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
              PDC A+A+ GDPLFLEPFW+Q+AASSA++V+ WHRMSYS+   S       S+ELE H
Sbjct  86   FFPDCSANANGGDPLFLEPFWMQHAASSALLVAGWHRMSYSYDDQST-----ISKELERH  140

Query  505  IRKVHAV  525
            IRK+H +
Sbjct  141  IRKLHDI  147



>ref|XP_008237546.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Prunus mume]
Length=466

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 9/126 (7%)
 Frame = +1

Query  148  EWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLL  327
            EW   EL WS+ AA  AE V  + CSGHGRAY+DG +  DG  PVCEC++CY GP CS  
Sbjct  31   EW---ELSWSRRAAEEAEYVVDISCSGHGRAYLDG-LTLDGKEPVCECNSCYGGPHCSEF  86

Query  328  LPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHI  507
            L  C A+ADSGDP FLEPFW+Q+A+ SA+VV+ WHRMSY+F   S     Y S ELE HI
Sbjct  87   LTGCAANADSGDPYFLEPFWMQHASKSALVVAGWHRMSYTFADQS-----YISAELERHI  141

Query  508  RKVHAV  525
            RK+HA+
Sbjct  142  RKLHAI  147



>ref|XP_008348777.1| PREDICTED: LOW QUALITY PROTEIN: tryptophan aminotransferase-related 
protein 3-like [Malus domestica]
Length=471

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 106/160 (66%), Gaps = 11/160 (7%)
 Frame = +1

Query  46   MAKGMQGFGYAFClllsvllnillvanilYGGDGEWRLRELKWSQDaaaaaetvaaLQCS  225
            MAK  Q F YA CL  S++ N+LL   +     G+W   EL WS+ AA  AE VA + CS
Sbjct  1    MAKA-QSF-YAVCLAFSLVFNLLLSFRLYVDVGGDW---ELSWSKRAAEEAEHVATISCS  55

Query  226  GHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNaas  405
            GHGRAY+DG I D G  PVCEC++CY G DCSL L  C A+ADSGDP FLEPFW ++A+ 
Sbjct  56   GHGRAYLDGLILD-GKEPVCECNSCYGGHDCSLFLTGCAANADSGDPYFLEPFWTKHASK  114

Query  406  savvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            SAV+V+ WHRMSY FP  S       S ELE HIR++H +
Sbjct  115  SAVLVAGWHRMSYVFPDQSR-----ISAELERHIREIHTI  149



>ref|XP_007201016.1| hypothetical protein PRUPE_ppa005490mg [Prunus persica]
 gb|EMJ02215.1| hypothetical protein PRUPE_ppa005490mg [Prunus persica]
Length=458

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 91/126 (72%), Gaps = 9/126 (7%)
 Frame = +1

Query  148  EWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLL  327
            EW   EL WS+ AA  AE VAA+ CSGHGRAY+DG +  DG  PVCEC++CY GP CS  
Sbjct  31   EW---ELSWSRRAAEEAEYVAAISCSGHGRAYLDG-LTLDGKEPVCECNSCYGGPQCSEF  86

Query  328  LPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHI  507
            L  C A+ADSGDP FLEPFW+Q+A+ SA+VV+ WHRMSY+F   S     Y S ELE HI
Sbjct  87   LTGCAANADSGDPYFLEPFWMQHASKSALVVAGWHRMSYTFADQS-----YISAELERHI  141

Query  508  RKVHAV  525
            RK+HA+
Sbjct  142  RKLHAI  147



>emb|CDP11449.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 88/121 (73%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            EL WS+ A+  AE VA+L CSGHGRAY+DG + D G  P+CEC++CY+G DCS L+PDC 
Sbjct  35   ELGWSRKASEEAEAVASLSCSGHGRAYLDGFVLDGG-KPICECNSCYTGLDCSQLVPDCV  93

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
             D DSG+P+FLEPFW QNAASSA++++ WHRM Y F   S       S+ELE  IRK+HA
Sbjct  94   VDVDSGNPIFLEPFWRQNAASSAIMMAGWHRMGYEFEDGS-----LISKELEKKIRKLHA  148

Query  523  V  525
             
Sbjct  149  T  149



>ref|XP_010063821.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Eucalyptus grandis]
 gb|KCW71089.1| hypothetical protein EUGRSUZ_F04187 [Eucalyptus grandis]
Length=469

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 92/126 (73%), Gaps = 7/126 (6%)
 Frame = +1

Query  148  EWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLL  327
            E  ++ L WS  AAA AE+ AA +CSGHGRAY+DG + D    P CEC+NCY GPDCSL 
Sbjct  43   EVSIQGLSWSGRAAAEAESAAARECSGHGRAYLDGVVVDG--RPACECNNCYGGPDCSLF  100

Query  328  LPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHI  507
            LP CFADAD GDPLFLEPFW Q+A SSAV+V+ WHRMSYSF   +       SQELE+ +
Sbjct  101  LPSCFADADEGDPLFLEPFWKQHAESSAVMVAGWHRMSYSFSDQTT-----LSQELESLL  155

Query  508  RKVHAV  525
            RK+H++
Sbjct  156  RKLHSL  161



>ref|XP_007201013.1| hypothetical protein PRUPE_ppa005058mg [Prunus persica]
 gb|EMJ02212.1| hypothetical protein PRUPE_ppa005058mg [Prunus persica]
Length=479

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 93/128 (73%), Gaps = 9/128 (7%)
 Frame = +1

Query  142  DGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCS  321
            DGEWRL    WS+ AA  AE VAA+ CSGHG AY+DG + D G  PVCEC++CY GPDCS
Sbjct  30   DGEWRL---TWSKRAAEEAERVAAIPCSGHGTAYLDGLVLD-GKEPVCECNSCYEGPDCS  85

Query  322  LLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELEN  501
              + +C A+ADSGDP FL+PFW+Q+AA SAV+V+ WHRM YS+P  S     Y S ELE 
Sbjct  86   EFVTECAANADSGDPYFLQPFWMQHAAQSAVLVAGWHRMGYSYPDGS-----YISAELEG  140

Query  502  HIRKVHAV  525
            HIR++H+ 
Sbjct  141  HIRELHST  148



>ref|XP_009759807.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Nicotiana sylvestris]
Length=477

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 6/127 (5%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
             E   R+L WSQ AA  AE VA++ CSGHG+AY+DG + D GI P CEC+ CY+GPDCSL
Sbjct  37   SEQEKRKLSWSQRAAEEAEAVASISCSGHGKAYLDGLVVD-GI-PTCECYTCYAGPDCSL  94

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
            L+P+C A+A   DPLF EPFW++NA SSAVV++ WHRM+YSFP      +++ SQELE  
Sbjct  95   LIPNCSANAFGWDPLFYEPFWMENAESSAVVIAGWHRMAYSFPDP----TSHLSQELEKT  150

Query  505  IRKVHAV  525
            IRK+H+V
Sbjct  151  IRKLHSV  157



>ref|XP_006473123.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Citrus sinensis]
Length=455

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 92/120 (77%), Gaps = 6/120 (5%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L WS  AA  AE VAA+ CSGHGRAY+D ++   G  PVCEC++C+SGPDCSL LP C A
Sbjct  39   LSWSSKAAREAEAVAAISCSGHGRAYLDSQVFY-GNQPVCECNSCFSGPDCSLFLPGCAA  97

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            DA+SGDPLFLEPFW+++AASSA++++ WHRMSY F  +S     + SQELE  IRK+H++
Sbjct  98   DAESGDPLFLEPFWMKHAASSAILIAGWHRMSYRFTHAS-----FISQELEKKIRKLHSI  152



>ref|XP_010665067.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Vitis vinifera]
Length=459

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 88/126 (70%), Gaps = 10/126 (8%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            G+W   EL WS+ AA   E  AA+ CSGHGRAY+DG + D   +PVCEC++C+ GPDCS 
Sbjct  32   GKW---ELSWSRKAAEEGEAAAAVACSGHGRAYLDGLVVDG--SPVCECNSCFEGPDCSQ  86

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
              PDC A+ D GDPLFLEPFW+QNAA SA++V+ WHRMSY+F   S       SQ LEN 
Sbjct  87   FSPDCIANVDGGDPLFLEPFWMQNAARSAMLVAGWHRMSYAFNNQS-----LMSQVLENQ  141

Query  505  IRKVHA  522
            IRK+H 
Sbjct  142  IRKLHT  147



>emb|CBI22766.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 88/126 (70%), Gaps = 10/126 (8%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            G+W   EL WS+ AA   E  AA+ CSGHGRAY+DG + D   +PVCEC++C+ GPDCS 
Sbjct  5    GKW---ELSWSRKAAEEGEAAAAVACSGHGRAYLDGLVVDG--SPVCECNSCFEGPDCSQ  59

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
              PDC A+ D GDPLFLEPFW+QNAA SA++V+ WHRMSY+F   S       SQ LEN 
Sbjct  60   FSPDCIANVDGGDPLFLEPFWMQNAARSAMLVAGWHRMSYAFNNQS-----LMSQVLENQ  114

Query  505  IRKVHA  522
            IRK+H 
Sbjct  115  IRKLHT  120



>emb|CDP11450.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 89/124 (72%), Gaps = 6/124 (5%)
 Frame = +1

Query  154  RLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLP  333
            R  EL WS+ AAA AE  A++ CSGHGRAYIDG + D G  PVCEC+ CY+G DCS ++P
Sbjct  31   RNSELSWSKKAAAEAEAAASVSCSGHGRAYIDGFVLDGG-KPVCECNGCYAGHDCSEVIP  89

Query  334  DCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRK  513
            DC ADADSG+P FLEPFW +NAASSA++V+ WHRM Y F   S       S+ELE  IRK
Sbjct  90   DCIADADSGNPTFLEPFWRKNAASSAIMVAGWHRMGYEFEDGS-----LTSKELEKQIRK  144

Query  514  VHAV  525
            +HA 
Sbjct  145  LHAT  148



>ref|XP_009335145.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Pyrus x bretschneideri]
Length=478

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 92/128 (72%), Gaps = 9/128 (7%)
 Frame = +1

Query  142  DGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCS  321
            DGEW    L W++ AA  AE VAA+ CSGHGRAY+DG + D G  PVCEC++CY GPDCS
Sbjct  30   DGEW---ALSWTKRAAEQAEQVAAICCSGHGRAYLDGLVLD-GKEPVCECNSCYGGPDCS  85

Query  322  LLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELEN  501
                DC A+ADSG+P FLEPFW+Q+AA SA++V+ WHRM YS+P  S     Y S +LE 
Sbjct  86   EFTTDCAANADSGNPYFLEPFWMQHAAKSAILVAGWHRMGYSYPDES-----YISAQLEA  140

Query  502  HIRKVHAV  525
             IRK+HAV
Sbjct  141  SIRKLHAV  148



>gb|KJB07710.1| hypothetical protein B456_001G040000 [Gossypium raimondii]
Length=465

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 90/127 (71%), Gaps = 10/127 (8%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            G+W   E  W++ A A AE VA++ CSGHGRA++DG I D    PVCEC+ CY GP CS+
Sbjct  26   GQW---EQSWTKSATAEAEFVASISCSGHGRAFLDGSILDG--KPVCECNACYGGPHCSV  80

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
             LP+C ADADSGDP+FLEPFW+++AASS +VV  WHRMSY F   S       S+EL+  
Sbjct  81   FLPECIADADSGDPMFLEPFWLKHAASSTIVVPGWHRMSYEFNDDS-----LISKELDAQ  135

Query  505  IRKVHAV  525
            IRK+HAV
Sbjct  136  IRKLHAV  142



>ref|XP_008381905.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Malus domestica]
Length=444

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 89/128 (70%), Gaps = 9/128 (7%)
 Frame = +1

Query  142  DGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCS  321
            DGE   REL WS+ AA  AE VAA+ CSGHGRAY+DG +   GI PVCEC+ CY GPDCS
Sbjct  25   DGE---RELSWSKRAAQEAEQVAAISCSGHGRAYLDGLVLY-GIKPVCECNPCYGGPDCS  80

Query  322  LLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELEN  501
                +C A+A +GDP FLEPFW+Q AA SA++V+ WHRM YSFP  S     Y S +LE 
Sbjct  81   XFXXBCAANAXNGDPYFLEPFWMQRAAKSAILVAGWHRMGYSFPDGS-----YISTQLEA  135

Query  502  HIRKVHAV  525
             I KVHAV
Sbjct  136  SIHKVHAV  143



>ref|XP_004290481.1| PREDICTED: tryptophan aminotransferase-related protein 4 [Fragaria 
vesca subsp. vesca]
Length=485

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 8/131 (6%)
 Frame = +1

Query  133  YGGDGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGP  312
            +G  G+W   EL WS+ AA  AE VAA+ CSGHGRAY+DG + DDG  P CEC++C+ G 
Sbjct  30   HGAGGQW---ELSWSRRAAEEAEHVAAVPCSGHGRAYLDGLVLDDGKQPGCECNSCFGGS  86

Query  313  DCSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQE  492
            DCS  L DC ++AD GDP FLEPFW+++A+ SA++V+ WHRM YSF   S     Y SQE
Sbjct  87   DCSQFLTDCESNADGGDPYFLEPFWMEHASESAILVAGWHRMGYSFSDKS-----YISQE  141

Query  493  LENHIRKVHAV  525
            LE  IRKVH V
Sbjct  142  LERLIRKVHDV  152



>emb|CDY15309.1| BnaC06g07950D [Brassica napus]
Length=475

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 83/118 (70%), Gaps = 4/118 (3%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+  AA  AE VA++ CSGHGRAY+DG    DG  P CEC+NCY+G DCS LLPDC A A
Sbjct  35   WTNRAAKEAEDVASVSCSGHGRAYLDGLGILDGNKPPCECNNCYTGKDCSFLLPDCHAAA  94

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPLFLEPFW+QNA  SAVV S WHRMSY F        +Y S ELE  IRK+H V
Sbjct  95   NSGDPLFLEPFWMQNAEGSAVVESGWHRMSYHF----YEDGSYVSAELERIIRKLHNV  148



>gb|KHG07342.1| Tryptophan aminotransferase-related 4 -like protein [Gossypium 
arboreum]
Length=457

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (74%), Gaps = 9/126 (7%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            G+W+L    WS  AA  AETVAA+ CSGHGRAY+DG +   G  PVC+C+ C++GPDCS 
Sbjct  32   GQWKL---SWSSRAAIEAETVAAIYCSGHGRAYLDGLVVV-GNKPVCDCNTCFTGPDCSQ  87

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
             +P C A+AD GDPLFLEPFW+Q+ ASSA+VV+ WH+MSY++ G S     +FS+EL   
Sbjct  88   FIPHCTANADGGDPLFLEPFWMQHLASSALVVAGWHQMSYTYSGKS-----FFSEELAKV  142

Query  505  IRKVHA  522
            +RKVHA
Sbjct  143  VRKVHA  148



>ref|XP_002524354.1| Alliin lyase 1 precursor, putative [Ricinus communis]
 gb|EEF38094.1| Alliin lyase 1 precursor, putative [Ricinus communis]
Length=495

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 88/121 (73%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            E  W++ AA  AE VA++ CSGHGRA++DG  G DG  PVCEC+ C+ GPDCS  +PDC 
Sbjct  37   EQSWTKTAAEEAEAVASISCSGHGRAFLDGSSGVDG-KPVCECYACFKGPDCSEAIPDCE  95

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
             DADSGDP+FLEPFW+++ ASSA++V  WHRMSY F    N GS   S+ELE  IRK+H 
Sbjct  96   VDADSGDPIFLEPFWLKHPASSAILVPGWHRMSYEF----NDGS-LISKELETQIRKLHT  150

Query  523  V  525
            V
Sbjct  151  V  151



>ref|XP_002891072.1| alliinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67331.1| alliinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=460

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 74/104 (71%), Gaps = 4/104 (4%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            + CSGHGRAY+DG    DG  P CEC+NCY+G DCS  +PDC  DADSGDPLFLEPFW++
Sbjct  48   VSCSGHGRAYVDGLGVLDGHKPPCECNNCYTGKDCSFFVPDCPVDADSGDPLFLEPFWIR  107

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            NA  SAVV S WHRMSYS+ G       + S ELE  IRK+H V
Sbjct  108  NAEGSAVVESGWHRMSYSYHGY----GLFVSAELERIIRKLHNV  147



>ref|XP_006415044.1| hypothetical protein EUTSA_v10007588mg [Eutrema salsugineum]
 gb|ESQ33397.1| hypothetical protein EUTSA_v10007588mg [Eutrema salsugineum]
Length=459

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 82/118 (69%), Gaps = 4/118 (3%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+  AA  AE  A++ CSGHGRAY+DG    DG  P CEC+NCY+G DCS+L+ DC  DA
Sbjct  35   WTNRAALEAEDAASVSCSGHGRAYVDGLGALDGNKPPCECNNCYTGTDCSILVADCLVDA  94

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPLFLEPFW+Q +  SAVV S WH MSYS+        ++ SQELE  IRK+H V
Sbjct  95   NSGDPLFLEPFWMQKSEGSAVVESGWHMMSYSYYAY----GSFVSQELEKVIRKLHNV  148



>gb|KJB10098.1| hypothetical protein B456_001G183500 [Gossypium raimondii]
Length=457

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (74%), Gaps = 9/126 (7%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            G+W+L    WS  AA  AETVAA+ CSGHGRAY+DG +   G  PVC+C+ C++GPDCS 
Sbjct  32   GQWKL---SWSLGAAIEAETVAAIYCSGHGRAYLDGLVVV-GNKPVCDCNTCFTGPDCSQ  87

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
             +P C A+AD GDPLFLEPFW+Q+ ASSA+VV+ WH+MSY++ G S     +FS+EL   
Sbjct  88   FIPHCTANADGGDPLFLEPFWMQHLASSALVVAGWHQMSYTYGGKS-----FFSKELAKV  142

Query  505  IRKVHA  522
            +RKVHA
Sbjct  143  VRKVHA  148



>ref|XP_010478827.1| PREDICTED: LOW QUALITY PROTEIN: tryptophan aminotransferase-related 
protein 4-like [Camelina sativa]
Length=462

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 87/118 (74%), Gaps = 5/118 (4%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+  AA  AET A++ CSGHGRAY+DG    DG  P CEC+NCY+G DCS+LL DC  DA
Sbjct  34   WTNKAAVEAETAASVSCSGHGRAYVDGLGVLDGQKPPCECNNCYTGKDCSVLLKDCPVDA  93

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            DSGDPLFLEPFW++ A SSAV+VS WHRMSY++   +     + S+ELE  IRK+H+V
Sbjct  94   DSGDPLFLEPFWMRQAESSAVLVSGWHRMSYNYQDGT-----HVSRELEKVIRKLHSV  146



>ref|XP_007019613.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein, putative [Theobroma cacao]
 gb|EOY16838.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein, putative [Theobroma cacao]
Length=457

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 93/129 (72%), Gaps = 9/129 (7%)
 Frame = +1

Query  139  GDGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDC  318
              G W    L W+  AA  AE VAA+ CSGHGRAY+DG + D G  P+CEC++CY+G DC
Sbjct  30   ASGNW---NLSWTFQAATEAEAVAAISCSGHGRAYLDGLVLD-GKEPLCECNSCYAGSDC  85

Query  319  SLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELE  498
            S+ +P C A+AD G+PLFLEPFWVQ+AASSA++++ WHRMSY+F   +     + SQELE
Sbjct  86   SVFIPGCSANADGGNPLFLEPFWVQHAASSALLIAGWHRMSYTFNDHT-----FISQELE  140

Query  499  NHIRKVHAV  525
              IRK+HAV
Sbjct  141  RLIRKLHAV  149



>ref|XP_008386375.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Malus domestica]
Length=476

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 91/128 (71%), Gaps = 9/128 (7%)
 Frame = +1

Query  142  DGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCS  321
            DGEW    L W++ AA  AE VAA+ CSGHGRAY+DG + D G  PVCEC++CY GPDCS
Sbjct  30   DGEW---ALSWTKRAAEQAEQVAAISCSGHGRAYLDGLVLD-GKEPVCECNSCYGGPDCS  85

Query  322  LLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELEN  501
                DC A+ADSG+P FLEPFW+Q+AA SA++V+ WHRM Y++P  S     + S +LE 
Sbjct  86   EFTTDCAANADSGNPYFLEPFWMQHAAKSAILVAGWHRMGYTYPDDS-----FISTQLEA  140

Query  502  HIRKVHAV  525
             I K+HAV
Sbjct  141  SIHKLHAV  148



>emb|CDX93734.1| BnaA09g23340D [Brassica napus]
Length=459

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 81/118 (69%), Gaps = 4/118 (3%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+  AA  AE VA++ CSGHGR Y+DG    DG  P CEC+NCY+G DCS LLPDC A A
Sbjct  35   WTNRAAKEAEDVASVSCSGHGRTYVDGLGVLDGNKPPCECNNCYTGKDCSFLLPDCHAAA  94

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPLFLEPFW+Q A  SAVV S WHRMSY F        +Y S ELE  IRK+H V
Sbjct  95   NSGDPLFLEPFWMQKAEGSAVVESGWHRMSYHF----YEDGSYVSAELERIIRKLHNV  148



>ref|XP_002524350.1| Alliin lyase precursor, putative [Ricinus communis]
 gb|EEF38090.1| Alliin lyase precursor, putative [Ricinus communis]
Length=440

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 85/130 (65%), Gaps = 7/130 (5%)
 Frame = +1

Query  136  GGDGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPD  315
            G D  W    L WS+ AA  AE V A+ CSGHGR ++D  I D    PVCEC++CY GP 
Sbjct  11   GDDDVWN--NLSWSRKAAKEAEAVGAISCSGHGRVFLDSMIVDGKKEPVCECNSCYGGPY  68

Query  316  CSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQEL  495
            CS   P C A+ADSGDPLFLEPFW+QNAA SAVVV+ WHRMSY +   S       S EL
Sbjct  69   CSQFDPSCPANADSGDPLFLEPFWMQNAAGSAVVVAGWHRMSYVYSDQS-----LISLEL  123

Query  496  ENHIRKVHAV  525
            E HIRK+HA 
Sbjct  124  ERHIRKLHAT  133



>ref|XP_002524351.1| Alliin lyase precursor, putative [Ricinus communis]
 gb|EEF38091.1| Alliin lyase precursor, putative [Ricinus communis]
Length=467

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 86/129 (67%), Gaps = 7/129 (5%)
 Frame = +1

Query  136  GGDGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPD  315
            G D  W    L WS+ AA  AE V A+ CSGHGR ++D  I D    PVCEC++CY G D
Sbjct  37   GDDDVWN--NLSWSRKAAKEAEAVGAISCSGHGRVFLDSMIVDGKKEPVCECNSCYGGVD  94

Query  316  CSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQEL  495
            CS   P C A+ADSGDPLFLEPFW+QNAASSAVVV+ WHRMSY +   +       S EL
Sbjct  95   CSQFDPSCPANADSGDPLFLEPFWMQNAASSAVVVAGWHRMSYVYSDQT-----LISSEL  149

Query  496  ENHIRKVHA  522
            E HIRK+HA
Sbjct  150  ERHIRKLHA  158



>emb|CDP11445.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 99/126 (79%), Gaps = 8/126 (6%)
 Frame = +1

Query  148  EWRLR-ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            ++++R +L WSQ+AAA AE+VA++ CSG+GRAY+DG + D    PVCEC++C+ GPDCS 
Sbjct  27   QYKVRNQLTWSQNAAAEAESVASISCSGNGRAYVDGLVVDG--KPVCECNSCFQGPDCSQ  84

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
             + DC ADADSGDPLFLEP+W+++AASSA++V+ WHRMSY+F  +++      SQ L+ H
Sbjct  85   FITDCPADADSGDPLFLEPYWMRHAASSALLVAGWHRMSYTFSDNTS-----ISQVLDQH  139

Query  505  IRKVHA  522
            IR +HA
Sbjct  140  IRTLHA  145



>ref|XP_010041603.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Eucalyptus grandis]
 gb|KCW44234.1| hypothetical protein EUGRSUZ_L02339 [Eucalyptus grandis]
 gb|KCW44235.1| hypothetical protein EUGRSUZ_L02339 [Eucalyptus grandis]
Length=469

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +1

Query  148  EWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLL  327
            E  ++ L WS  AAA AE+ AA +CSGHGRA++DG + D    P CEC+ CY GPDCSL 
Sbjct  43   EVNVQGLSWSGRAAAEAESAAARECSGHGRAFLDGAVADG--RPACECNTCYGGPDCSLF  100

Query  328  LPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHI  507
            LP C A+AD GDPLFLEPFW Q+A SSAVVV+ WHRMSYSF   +     + SQELE+ +
Sbjct  101  LPSCSANADGGDPLFLEPFWKQHAESSAVVVAGWHRMSYSFSDQT-----FLSQELESLL  155

Query  508  RKVHA  522
            RK+H+
Sbjct  156  RKLHS  160



>ref|XP_006303527.1| hypothetical protein CARUB_v10010953mg [Capsella rubella]
 gb|EOA36425.1| hypothetical protein CARUB_v10010953mg [Capsella rubella]
Length=462

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = +1

Query  133  YGGDGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGP  312
            Y   G W   +  W+  AAA AET A++ CSGHGRAY+DG    DG  P CEC+NCY+G 
Sbjct  24   YYSSGTW---DPTWTNKAAAEAETAASVSCSGHGRAYVDGLGVLDGQEPPCECNNCYTGK  80

Query  313  DCSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQE  492
            DCS+LL DC  DA+SGDPLFLEPFW++ A SSAV+VS WHRMSYS+   +     + S+E
Sbjct  81   DCSVLLKDCPVDANSGDPLFLEPFWMREAESSAVLVSGWHRMSYSYQDKT-----FLSRE  135

Query  493  LENHIRKVHAV  525
            LE  IRK+H V
Sbjct  136  LEKVIRKLHIV  146



>ref|XP_009114765.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Brassica rapa]
Length=459

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 81/118 (69%), Gaps = 4/118 (3%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+  AA  AE VA++ CSGHGRAY+DG    DG  P CEC+NCY+G DCS LLPDC A A
Sbjct  35   WTNRAAKEAEDVASVSCSGHGRAYVDGLGILDGNKPPCECNNCYTGKDCSFLLPDCHAAA  94

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPLFLEPFW+Q A  SAVV S WHRMSY F        +Y S ELE   RK+H V
Sbjct  95   NSGDPLFLEPFWMQKAEGSAVVESGWHRMSYHF----YEDGSYVSAELERITRKLHNV  148



>ref|XP_006415038.1| hypothetical protein EUTSA_v10010020mg [Eutrema salsugineum]
 gb|ESQ33391.1| hypothetical protein EUTSA_v10010020mg [Eutrema salsugineum]
Length=450

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 84/118 (71%), Gaps = 5/118 (4%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W++ A   AET A++ CSGHGRAY+DG    DG  P CEC+NCY+G DCSLLL DC  DA
Sbjct  33   WTKRATVEAETAASVSCSGHGRAYVDGLGSLDGNKPPCECNNCYTGNDCSLLLQDCPVDA  92

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPLFLEPFW++ A  SAV+VS WHRMSY +   ++      S+ELE  IRK+H V
Sbjct  93   NSGDPLFLEPFWMRQAERSAVLVSGWHRMSYIYQDGTS-----VSKELEKVIRKLHGV  145



>ref|XP_002893807.1| alliinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70066.1| alliinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=458

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 87/118 (74%), Gaps = 5/118 (4%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+  AAA AETVA+  CSGHGRA++DG    DG  P CEC+NCY+G DCS+LL DC  DA
Sbjct  33   WTTRAAAEAETVASFSCSGHGRAFVDGLGVLDGQKPSCECNNCYTGKDCSVLLKDCPVDA  92

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPLFLEPFW++ A SSAV+VS WHRMSY +   +     Y S+ELE  IRK+H+V
Sbjct  93   NSGDPLFLEPFWMRQAESSAVLVSGWHRMSYIYQDGT-----YVSRELEKVIRKLHSV  145



>emb|CBI22772.3| unnamed protein product [Vitis vinifera]
Length=458

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 91/127 (72%), Gaps = 10/127 (8%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            G+W   E+ WS+ AA  AE VAA+ CSGHGRAY+DG + D   +PVCEC+ C+ GPDCS 
Sbjct  25   GKW---EVGWSRRAAEEAEAVAAVSCSGHGRAYLDGLVVDG--SPVCECNTCFGGPDCSQ  79

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
                C AD DSGDPLFLEPFW+Q+AASSA++V+ WHRMSYSF   S       S+ELE  
Sbjct  80   FSASCVADVDSGDPLFLEPFWMQHAASSALLVAGWHRMSYSFHDHS-----LISKELEEL  134

Query  505  IRKVHAV  525
            IRK+HA+
Sbjct  135  IRKLHAI  141



>ref|XP_002266138.1| PREDICTED: tryptophan aminotransferase-related protein 3 [Vitis 
vinifera]
Length=465

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 91/127 (72%), Gaps = 10/127 (8%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            G+W   E+ WS+ AA  AE VAA+ CSGHGRAY+DG + D   +PVCEC+ C+ GPDCS 
Sbjct  32   GKW---EVGWSRRAAEEAEAVAAVSCSGHGRAYLDGLVVDG--SPVCECNTCFGGPDCSQ  86

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
                C AD DSGDPLFLEPFW+Q+AASSA++V+ WHRMSYSF   S       S+ELE  
Sbjct  87   FSASCVADVDSGDPLFLEPFWMQHAASSALLVAGWHRMSYSFHDHS-----LISKELEEL  141

Query  505  IRKVHAV  525
            IRK+HA+
Sbjct  142  IRKLHAI  148



>ref|XP_003519988.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Glycine max]
Length=512

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (71%), Gaps = 7/117 (6%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+Q+A   AE V+++ CSGHG+A++DG +      PVCEC+ CY G DCS L PDC  DA
Sbjct  36   WTQEAMTEAEAVSSISCSGHGKAFLDGLLLHGK--PVCECNMCYGGSDCSQLQPDCMVDA  93

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            DSGDP FLEPFWV+NAASSA+V++ WHRMSY +   S       S+EL+ HIR VHA
Sbjct  94   DSGDPTFLEPFWVKNAASSAIVIAGWHRMSYEYSDGS-----LISEELKAHIRNVHA  145



>gb|KHN15434.1| Tryptophan aminotransferase-related protein 4 [Glycine soja]
Length=487

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (72%), Gaps = 7/117 (6%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+Q+A A AE V+++ CSGHG+A++DG +      PVCEC+ CY G DCS L PDC  DA
Sbjct  11   WTQEAMAEAEAVSSISCSGHGKAFLDGLLLHGK--PVCECNMCYGGSDCSQLQPDCMVDA  68

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            DSGDP FLEPFWV+NAASSA+V++ WHRMSY +   S       S+EL+ HIR VHA
Sbjct  69   DSGDPTFLEPFWVKNAASSAIVIAGWHRMSYEYSDGS-----LISEELKAHIRNVHA  120



>gb|KDP41082.1| hypothetical protein JCGZ_03751 [Jatropha curcas]
Length=401

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W++ A   AE VA++ CSGHGRA++DG +G DG  P+CEC+ C+ GPDCS L+P+C  DA
Sbjct  7    WTKRAVEEAEAVASISCSGHGRAFLDGLLGVDG-KPICECNACFQGPDCSHLIPNCELDA  65

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            DSGDP+FLEPFW+++AASS+V+V  WHRMSY F    N GS   S+EL++ I K+H+
Sbjct  66   DSGDPMFLEPFWLKHAASSSVMVPGWHRMSYEF----NDGS-LISKELKSQILKLHS  117



>gb|KCW71088.1| hypothetical protein EUGRSUZ_F04186, partial [Eucalyptus grandis]
Length=459

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 89/126 (71%), Gaps = 7/126 (6%)
 Frame = +1

Query  148  EWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLL  327
            E  ++ L WS  AAA AE  AA +CSGHGRAY+DG + D    P CEC+ CY GP+CSL 
Sbjct  43   EVSIQGLSWSGRAAAEAELAAARECSGHGRAYLDGVVVDG--RPACECNTCYGGPECSLF  100

Query  328  LPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHI  507
            LP C ADAD GDPLFLEPFW Q+A SSAVVV+ WHRMSYSF   +       S+ELE+ +
Sbjct  101  LPSCSADADDGDPLFLEPFWKQHAESSAVVVAGWHRMSYSFSDQTT-----LSKELESLL  155

Query  508  RKVHAV  525
            RK+H++
Sbjct  156  RKLHSL  161



>ref|XP_010063823.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Eucalyptus grandis]
Length=486

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 89/126 (71%), Gaps = 7/126 (6%)
 Frame = +1

Query  148  EWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLL  327
            E  ++ L WS  AAA AE  AA +CSGHGRAY+DG + D    P CEC+ CY GP+CSL 
Sbjct  43   EVSIQGLSWSGRAAAEAELAAARECSGHGRAYLDGVVVDG--RPACECNTCYGGPECSLF  100

Query  328  LPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHI  507
            LP C ADAD GDPLFLEPFW Q+A SSAVVV+ WHRMSYSF   +       S+ELE+ +
Sbjct  101  LPSCSADADDGDPLFLEPFWKQHAESSAVVVAGWHRMSYSFSDQTT-----LSKELESLL  155

Query  508  RKVHAV  525
            RK+H++
Sbjct  156  RKLHSL  161



>ref|XP_010478823.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Camelina sativa]
Length=460

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 75/104 (72%), Gaps = 4/104 (4%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            L CSGHGRAY+DG    DG  P CEC+NCY+G DCS  +PDC  DADSG+PLFLEPFW++
Sbjct  48   LSCSGHGRAYVDGLGVLDGHKPPCECNNCYTGKDCSFFVPDCPVDADSGNPLFLEPFWMR  107

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            NA  SAVV S WHRMSY +   S  GS + S ELE  IR++H V
Sbjct  108  NAEGSAVVESGWHRMSYHY---SEVGS-FVSAELEKIIRELHNV  147



>ref|XP_010461224.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Camelina sativa]
Length=460

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 75/104 (72%), Gaps = 4/104 (4%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            L CSGHGRAY+DG    DG  P CEC+NCY+G DCS  +PDC  DADSG+PLFLEPFW++
Sbjct  48   LSCSGHGRAYVDGLGVLDGHKPPCECNNCYTGKDCSFFVPDCPVDADSGNPLFLEPFWMR  107

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            NA  SAVV S WHRMSY +   S  GS + S ELE  IR++H V
Sbjct  108  NAEGSAVVESGWHRMSYRY---SEIGS-FVSAELEKIIRELHNV  147



>ref|XP_009600008.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Nicotiana tomentosiformis]
 ref|XP_009600014.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Nicotiana tomentosiformis]
 ref|XP_009600022.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Nicotiana tomentosiformis]
Length=477

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 92/125 (74%), Gaps = 6/125 (5%)
 Frame = +1

Query  148  EWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLL  327
            E   ++L WSQ AA  AE VA++ CSGHG+AY+D  I D GI P CEC+ C +GPDCSLL
Sbjct  38   EQEKKKLSWSQRAAEEAEAVASISCSGHGKAYLDSLIVD-GI-PTCECYTCCTGPDCSLL  95

Query  328  LPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHI  507
            +P+C A+A   DPLF EPFW++NA SSAVV++ WHRM+YSFP      +++ SQELE  I
Sbjct  96   IPNCSANAFGWDPLFYEPFWMENAESSAVVIAGWHRMAYSFPDP----TSHLSQELEKTI  151

Query  508  RKVHA  522
            RK+H+
Sbjct  152  RKLHS  156



>ref|NP_564435.1| tryptophan aminotransferase-related protein 4 [Arabidopsis thaliana]
 sp|Q93Z38.2|TAR4_ARATH RecName: Full=Tryptophan aminotransferase-related protein 4 [Arabidopsis 
thaliana]
 gb|AAG12531.1|AC015446_12 Similar to Allinase [Arabidopsis thaliana]
 gb|AEE31667.1| tryptophan aminotransferase-related protein 4 [Arabidopsis thaliana]
Length=463

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 85/118 (72%), Gaps = 5/118 (4%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+  AAA AETVA+  CSGHGRA++DG    DG  P CEC+NCY G DCS+LL DC  DA
Sbjct  34   WTNRAAAEAETVASFSCSGHGRAFVDGLGVLDGQKPPCECNNCYIGKDCSVLLKDCPVDA  93

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPLFLEPFW++ A  SA++VS WHRMSY +   +     Y S+ELE  IRK+H+V
Sbjct  94   NSGDPLFLEPFWMRQAERSAILVSGWHRMSYIYEDGT-----YVSRELEKVIRKLHSV  146



>ref|XP_002266053.1| PREDICTED: tryptophan aminotransferase-related protein 3 [Vitis 
vinifera]
 emb|CBI22770.3| unnamed protein product [Vitis vinifera]
Length=458

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 91/127 (72%), Gaps = 10/127 (8%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            G+W   E+ WS+ AA  AE VAA+ CSGHGRA++DG + D   +PVCEC+ C+ GPDCS 
Sbjct  32   GKW---EVGWSRRAAEEAEAVAAVSCSGHGRAFLDGLVVDG--SPVCECNTCFGGPDCSQ  86

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
                C AD DSGDPLFLEPFW+Q+AASSAV+V+ WHRMSYSF   S+      SQEL   
Sbjct  87   FSASCVADVDSGDPLFLEPFWMQHAASSAVLVAGWHRMSYSFNDHSS-----ISQELVKL  141

Query  505  IRKVHAV  525
            IRK+HA+
Sbjct  142  IRKLHAI  148



>ref|XP_008778097.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Phoenix dactylifera]
Length=447

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 74/100 (74%), Gaps = 7/100 (7%)
 Frame = +1

Query  220  CSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNa  399
            CSGHGRAY+DG I  DG+ P CEC+ CY+G DCS LLPDC ADADSGDPLFLEP+W Q+A
Sbjct  45   CSGHGRAYLDG-ILVDGV-PTCECNTCYAGADCSQLLPDCPADADSGDPLFLEPYWQQHA  102

Query  400  assavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            ASSAVV S WHRMSY        G  + S ELE HIR +H
Sbjct  103  ASSAVVFSGWHRMSY-----RTTGDYFISVELEKHIRLLH  137



>ref|XP_006361959.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Solanum tuberosum]
Length=462

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 84/119 (71%), Gaps = 5/119 (4%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
             L W+++AA  AE VA++ CSGHGRAY+DG +  +  TP+CEC+ C++GPDCSL  P+C 
Sbjct  33   RLSWTREAAIEAENVASISCSGHGRAYLDGLVLREDGTPICECNACFTGPDCSLFKPNCA  92

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
             D DSG+P+FLEPFW QNA SS V+V+ WHRM Y F   +       S++L+N I K+H
Sbjct  93   VDVDSGNPMFLEPFWKQNAGSSGVMVAGWHRMGYEFEDGT-----LISKQLKNVIHKLH  146



>ref|NP_174666.1| Pyridoxal phosphate-dependent transferases superfamily protein 
[Arabidopsis thaliana]
 sp|Q9FE98.1|TAR3_ARATH RecName: Full=Tryptophan aminotransferase-related protein 3 [Arabidopsis 
thaliana]
 gb|AAG12533.1|AC015446_14 Similar to alliin lyase [Arabidopsis thaliana]
 gb|AAG12844.1|AC079286_1 alliinase precursor, putative; 28821-30567 [Arabidopsis thaliana]
 gb|AEE31660.1| Pyridoxal phosphate-dependent transferases superfamily protein 
[Arabidopsis thaliana]
Length=457

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 74/104 (71%), Gaps = 5/104 (5%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            + CSGHGR+Y+DG    DG  P CECH+CY+G DCS+LL DC  DA+SGDPLFLEPFW++
Sbjct  48   VSCSGHGRSYVDGLGVLDGHKP-CECHDCYTGKDCSVLLKDCPVDANSGDPLFLEPFWIR  106

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
             A  SAVV S WHRMSY+F G       + S ELE  IRK+H V
Sbjct  107  KAEESAVVESGWHRMSYTFNGY----GLFMSAELEKIIRKLHNV  146



>ref|XP_002302159.2| hypothetical protein POPTR_0002s06430g, partial [Populus trichocarpa]
 gb|EEE81432.2| hypothetical protein POPTR_0002s06430g, partial [Populus trichocarpa]
Length=419

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = +1

Query  169  KWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFAD  348
            +W++ AA  AE VA++ CSGHGRA++D  +G     P+CEC+ C+ GPDC+  +PDC  D
Sbjct  2    RWTKLAAEEAEKVASISCSGHGRAFLDS-LGAGIGKPICECNACFKGPDCAEFVPDCVVD  60

Query  349  ADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            ADSGDP+FLEPFW+++AASSAVVV  WHRMSY F   S       S+EL+ HIRK+HA 
Sbjct  61   ADSGDPMFLEPFWLKHAASSAVVVPGWHRMSYEFSDCS-----LISKELKMHIRKLHAT  114



>ref|XP_002524352.1| nucleotide binding protein, putative [Ricinus communis]
 gb|EEF38092.1| nucleotide binding protein, putative [Ricinus communis]
Length=1176

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 73/104 (70%), Gaps = 5/104 (5%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            + CSGHGR ++DG I D    PVCEC +CY GPDCS   P C  +AD GDPLFLEPFW+Q
Sbjct  769  ISCSGHGRVFLDGLILDGKQNPVCECSSCYGGPDCSQFFPSCSVNADGGDPLFLEPFWMQ  828

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            NAASSAVVV+ WHRMSY++   S       SQELE  IRK+HA 
Sbjct  829  NAASSAVVVAGWHRMSYTYDDHS-----AISQELERLIRKLHAT  867



>ref|XP_007019618.1| Pyridoxal phosphate-dependent transferases superfamily protein 
[Theobroma cacao]
 gb|EOY16843.1| Pyridoxal phosphate-dependent transferases superfamily protein 
[Theobroma cacao]
Length=502

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 74/104 (71%), Gaps = 7/104 (7%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            + CSGHGRA++DG I       VCEC  CY GPDCS  LPDC ADADSGDP+FLEPFW +
Sbjct  50   ISCSGHGRAFLDGSILHGK--HVCECDACYGGPDCSDFLPDCIADADSGDPMFLEPFWRK  107

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +AASS +V+  WHRMSY F    N GS   S+ELE  IRK+HAV
Sbjct  108  HAASSTIVLPGWHRMSYEF----NDGS-LISKELETQIRKLHAV  146



>ref|XP_010665087.1| PREDICTED: tryptophan aminotransferase-related protein 3 [Vitis 
vinifera]
 emb|CBI22769.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 85/118 (72%), Gaps = 7/118 (6%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            WS+ AA  AE VAA+ CSGHGRAY DG + D   +PVCEC+ C+ GPDCS   P C AD 
Sbjct  38   WSKSAAKEAEAVAAVTCSGHGRAYSDGLVVDG--SPVCECNTCFEGPDCSQFSPHCAADV  95

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPLFLEPFW+Q+AASSAVV+  WHRMSYS+   S       SQEL+  IRK+HA+
Sbjct  96   ESGDPLFLEPFWMQHAASSAVVIMGWHRMSYSYSDRST-----ISQELDKLIRKLHAL  148



>emb|CDX91788.1| BnaC08g07070D [Brassica napus]
Length=458

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+  AA  AE  A++ CSGHGRAY+DG     G  P CEC+NCY+G DCS+LL DC  +A
Sbjct  33   WTSRAAIEAEDAASVSCSGHGRAYVDGIGVLGGKQPSCECNNCYTGKDCSILLSDCPVNA  92

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPLFLEPFW++ A SSA +VS WHRMSY +   +     Y S+ LE  IRK+H+V
Sbjct  93   NSGDPLFLEPFWMRQAESSAALVSGWHRMSYIYQDGT-----YMSEALETVIRKLHSV  145



>emb|CDY46456.1| BnaA08g06520D [Brassica napus]
Length=459

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+  AA  AE  A++ CSGHGRAY+DG     G  P CEC+NCY+G DCS+LL DC  +A
Sbjct  34   WTSRAAIEAEDAASVSCSGHGRAYVDGIGVLGGKQPSCECNNCYTGKDCSILLSDCPVNA  93

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPLFLEPFW++ A SSA +VS WHRMSY +   +     Y S+ LE  IRK+H+V
Sbjct  94   NSGDPLFLEPFWMRQAESSAALVSGWHRMSYIYQDGT-----YMSEALETVIRKLHSV  146



>ref|XP_004233981.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Solanum lycopersicum]
Length=463

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 80/118 (68%), Gaps = 5/118 (4%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L W++  A  AE VA++ CSGHGRAY+DG +  +   P+CEC+ C++GPDCSL  P C  
Sbjct  35   LSWTRKTATEAEKVASISCSGHGRAYLDGLVLREDGKPICECNACFTGPDCSLFKPSCAV  94

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            D DSG+P+FLEPFW QNA SS V+V+ WHRM Y F   S       S++LE+ I K+H
Sbjct  95   DVDSGNPMFLEPFWKQNAGSSGVMVAGWHRMGYEFEDGS-----LISKQLESVIHKLH  147



>gb|AAL25576.1| At1g34060/F12G12_150 [Arabidopsis thaliana]
Length=463

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 84/118 (71%), Gaps = 5/118 (4%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+  AAA AETVA+  CSGHGRA++DG    DG  P CEC+NCY G DCS+LL DC  DA
Sbjct  34   WTNRAAAEAETVASFSCSGHGRAFVDGLGVLDGQKPPCECNNCYIGKDCSVLLKDCPVDA  93

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPL LEPFW++ A  SA++VS WHRMSY +   +     Y S+ELE  IRK+H+V
Sbjct  94   NSGDPLSLEPFWMRQAERSAILVSGWHRMSYIYEDGT-----YVSRELEKVIRKLHSV  146



>ref|XP_010928309.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Elaeis guineensis]
Length=463

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 85/118 (72%), Gaps = 7/118 (6%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L WS+ AAA AE VAA+ CSGHGRAY+DG I  DG+ P CEC+ CY+G +CS LLPDC A
Sbjct  43   LDWSRAAAAEAELVAAIFCSGHGRAYLDG-ILVDGV-PTCECNTCYAGANCSQLLPDCPA  100

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            DADSGDPLFLEP+W  +A SSAVV S WHRMSY        G  + S ELE HIR +H
Sbjct  101  DADSGDPLFLEPYWQHHAGSSAVVFSGWHRMSY-----RTTGDNFISLELEKHIRLLH  153



>ref|XP_010109327.1| Tryptophan aminotransferase-related protein 4 [Morus notabilis]
 gb|EXC21824.1| Tryptophan aminotransferase-related protein 4 [Morus notabilis]
Length=479

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 87/130 (67%), Gaps = 12/130 (9%)
 Frame = +1

Query  142  DGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGK--IGDDGITPVCECHNCYSGPD  315
            DG W   +L WS+ AA  AE VAA+ CSGHG+AY+DG   + D   +P CEC+ C+ GPD
Sbjct  40   DGRW---QLSWSRRAAVEAEYVAAISCSGHGKAYLDGSPSLLDGNKSPPCECNTCFGGPD  96

Query  316  CSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQEL  495
            CS +LP C  D DSG+P FLEPFW +NA SSAV++S WHRM Y+        S   ++EL
Sbjct  97   CSQILPGCVVDVDSGNPYFLEPFWTENAESSAVLLSGWHRMGYA-------SSTMVTEEL  149

Query  496  ENHIRKVHAV  525
            E HIR++H +
Sbjct  150  EKHIRELHEI  159



>ref|XP_006307464.1| hypothetical protein CARUB_v10009091mg [Capsella rubella]
 gb|EOA40362.1| hypothetical protein CARUB_v10009091mg [Capsella rubella]
Length=456

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = +1

Query  220  CSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNa  399
            CSGHGRAY+DG    D   P CEC+NCY+G DCS+LL DC  DADSGDPLFLEPFW++ A
Sbjct  50   CSGHGRAYVDGLGVLDSHKPPCECNNCYTGQDCSVLLKDCPVDADSGDPLFLEPFWMRKA  109

Query  400  assavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
              SAVV S WHRMSY +        A+ S ELE  IR++H++
Sbjct  110  EESAVVESGWHRMSYRY----YKLGAFVSVELEMIIRELHSI  147



>ref|XP_003533758.2| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Glycine max]
 gb|KHN32838.1| Tryptophan aminotransferase-related protein 4 [Glycine soja]
Length=454

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 88/127 (69%), Gaps = 9/127 (7%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW   E  WS  AA  AE VAA+ CSGHGRAY+DG I   G  PVCEC+ CY G DCS 
Sbjct  27   GEW---ESTWSTRAAEEAEAVAAIPCSGHGRAYLDGLILK-GHEPVCECNPCYGGSDCSN  82

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
            LL DC A+A SGDP FLEPFW+Q+AASSA++VS WHRM YS+   S     Y SQ L  +
Sbjct  83   LLSDCAANAGSGDPYFLEPFWMQHAASSAILVSGWHRMGYSYSDES-----YISQLLVEY  137

Query  505  IRKVHAV  525
            I+K+HA+
Sbjct  138  IKKLHAI  144



>dbj|BAJ93510.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 85/118 (72%), Gaps = 6/118 (5%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L W+  AA  AE+VAA+ CSGHGR ++DG +G+DG  P CEC+ C+ GPDCS+  PDC A
Sbjct  55   LSWALRAARDAESVAAVGCSGHGRVFVDGIVGEDG-RPGCECNTCFEGPDCSVRTPDCTA  113

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            DADSGDP+FLEP+W+++A +SAVV+S WHRMSY           + S ELE  IR++H
Sbjct  114  DADSGDPMFLEPYWMRHAEASAVVLSGWHRMSY-----RTTDGLFQSVELERCIRRLH  166



>ref|XP_009395075.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=457

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 83/120 (69%), Gaps = 6/120 (5%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L W+  AA  AE VAA+ CSGHGRA++DG +   G+ PVCEC+ CY G DCS LL DC A
Sbjct  35   LGWTGSAATEAEAVAAINCSGHGRAFLDGVLAGGGL-PVCECNKCYYGSDCSQLLHDCPA  93

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            D DSGDP+FLE +W Q AASSAVV+S WHRMSY     S  G  Y S ELE HIR +H V
Sbjct  94   DVDSGDPMFLEAYWQQQAASSAVVISGWHRMSY-----STDGKDYLSIELEKHIRILHQV  148



>gb|KCW44237.1| hypothetical protein EUGRSUZ_L023401, partial [Eucalyptus grandis]
Length=415

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 7/98 (7%)
 Frame = +1

Query  229  HGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNaass  408
            HGRA++DG + D    P CEC+ CY GPDCSL LP C A+AD GDPLFLEPFW Q+A SS
Sbjct  16   HGRAFLDGAVADG--RPACECNTCYGGPDCSLFLPSCSANADGGDPLFLEPFWKQHAESS  73

Query  409  avvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AVVV+ WHRMSYSF   +       SQELE+ +RK+H+
Sbjct  74   AVVVAGWHRMSYSFSDQTT-----LSQELESLLRKLHS  106



>ref|XP_011042901.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Populus euphratica]
Length=452

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 85/121 (70%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            E +W++ AA  AE VA++ CSGHGR ++D  +G     P+CEC+ C+ G DC+  +PDC 
Sbjct  33   EKRWTKLAAEEAENVASISCSGHGRVFLDS-LGAGIGKPICECNACFKGSDCAEFVPDCV  91

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
             DADSGDP+FLEPFW+++A+SSAVVV  WHRMSY F   S       S+EL+ HIRK+HA
Sbjct  92   VDADSGDPMFLEPFWLKHASSSAVVVPGWHRMSYEFNDCS-----LISKELKMHIRKLHA  146

Query  523  V  525
             
Sbjct  147  T  147



>ref|XP_009107936.1| PREDICTED: LOW QUALITY PROTEIN: tryptophan aminotransferase-related 
protein 4-like [Brassica rapa]
Length=459

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 80/118 (68%), Gaps = 5/118 (4%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W+  AA  AE  A++ CSGHGRAY+DG     G  P CEC+NCY+G DCS+LL DC  +A
Sbjct  34   WTSRAAIEAEDAASVSCSGHGRAYVDGIGVLGGKQPSCECNNCYTGKDCSILLSDCPVNA  93

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +SGDPLFLEPFW++ A SSA +VS WHRMSY +   +     Y S   E  IRK+H+V
Sbjct  94   NSGDPLFLEPFWMRQAESSAALVSGWHRMSYIYQDGT-----YMSXSAETVIRKLHSV  146



>tpg|DAA57866.1| TPA: hypothetical protein ZEAMMB73_021845 [Zea mays]
Length=242

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 7/118 (6%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L WS  AA  AE VAA++CSGHG+ ++DG  G+DG  P CEC++C+ GPDCSL  P+C A
Sbjct  57   LTWSLQAAREAEAVAAVECSGHGQVFVDGVAGEDG-RPGCECNSCFGGPDCSLRTPNCTA  115

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            DADSG+PLFLEP+W ++AA+SAVV S WHRMSY+  G       + S ELE  IR++H
Sbjct  116  DADSGNPLFLEPYWRRHAAASAVVFSGWHRMSYTTTG------GFQSVELERQIRRLH  167



>emb|CDM83618.1| unnamed protein product [Triticum aestivum]
Length=483

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 83/129 (64%), Gaps = 13/129 (10%)
 Frame = +1

Query  136  GGDGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPD  315
            GG   W LR  + ++  AAA        CSGHGR ++DG +G DG  P CEC+ C+ GPD
Sbjct  52   GGALSWALRAARDAESVAAAG-------CSGHGRVFLDGIVGQDG-RPGCECNTCFEGPD  103

Query  316  CSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQEL  495
            CS+  PDC  DADSGDP+FLEP+W+Q+A +SAVVVS WHRMSY           + S EL
Sbjct  104  CSVRTPDCTVDADSGDPMFLEPYWMQHAEASAVVVSGWHRMSY-----RTTDGLFQSVEL  158

Query  496  ENHIRKVHA  522
            E  IR++HA
Sbjct  159  ERCIRRLHA  167



>ref|XP_003548085.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
isoform X1 [Glycine max]
 ref|XP_006599460.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
isoform X2 [Glycine max]
Length=448

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 86/127 (68%), Gaps = 8/127 (6%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW   E  WS  AA  AE VAA+ CSGHGRAY+DG I  D     CEC++CY+G DCS 
Sbjct  20   GEW---EPTWSTRAAEEAEAVAAIPCSGHGRAYLDGLILKDMNKSRCECNSCYAGSDCSQ  76

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
             L DC A+AD GDP F+EPFW+Q+AASSA++VS WHRMSYS+   S       SQ L  +
Sbjct  77   FLSDCPANADGGDPYFMEPFWMQHAASSAILVSGWHRMSYSYSDGS-----VISQLLVEY  131

Query  505  IRKVHAV  525
            I+KVH +
Sbjct  132  IKKVHGI  138



>tpg|DAA57867.1| TPA: alliin lyase [Zea mays]
Length=488

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 7/118 (6%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L WS  AA  AE VAA++CSGHG+ ++DG  G+DG  P CEC++C+ GPDCSL  P+C A
Sbjct  57   LTWSLQAAREAEAVAAVECSGHGQVFVDGVAGEDG-RPGCECNSCFGGPDCSLRTPNCTA  115

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            DADSG+PLFLEP+W ++AA+SAVV S WHRMSY+  G       + S ELE  IR++H
Sbjct  116  DADSGNPLFLEPYWRRHAAASAVVFSGWHRMSYTTTG------GFQSVELERQIRRLH  167



>ref|NP_001149758.1| alliin lyase [Zea mays]
 gb|ACG36687.1| alliin lyase precursor [Zea mays]
Length=486

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 7/118 (6%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L WS  AA  AE VAA++CSGHG+ ++DG  G+DG  P CEC++C+ GPDCSL  P+C A
Sbjct  55   LTWSLQAAREAEAVAAVECSGHGQVFVDGVAGEDG-RPGCECNSCFGGPDCSLRTPNCTA  113

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            DADSG+PLFLEP+W ++AA+SAVV S WHRMSY+  G       + S ELE  IR++H
Sbjct  114  DADSGNPLFLEPYWRRHAAASAVVFSGWHRMSYTTTG------GFQSVELERQIRRLH  165



>ref|XP_003533757.1| PREDICTED: tryptophan aminotransferase-related protein 4 [Glycine 
max]
Length=446

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 86/127 (68%), Gaps = 9/127 (7%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW   E  WS  AA  AE VAA+ CSGHGRAY+DG I   G  PVCEC+ CY G DCS 
Sbjct  27   GEW---EPTWSSRAAEEAEAVAAIPCSGHGRAYLDGLILK-GHEPVCECNPCYGGSDCSK  82

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
            LL DC A+A SGDP F+EPFW+++AA SA++VS WHRM YS+   S     Y SQ L  +
Sbjct  83   LLSDCAANAGSGDPYFMEPFWMRHAAGSAILVSGWHRMGYSYSDGS-----YISQLLVEY  137

Query  505  IRKVHAV  525
            I+K+H +
Sbjct  138  IKKLHGI  144



>gb|KHN32839.1| Tryptophan aminotransferase-related protein 4 [Glycine soja]
Length=446

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 86/127 (68%), Gaps = 9/127 (7%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW   E  WS  AA  AE VAA+ CSGHGRAY+DG I   G  PVCEC+ CY G DCS 
Sbjct  27   GEW---EPTWSTRAAEEAEAVAAIPCSGHGRAYLDGLILK-GHEPVCECNPCYGGSDCSK  82

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
            LL DC A+A SGDP F+EPFW+++AA SA++VS WHRM YS+   S     Y SQ L  +
Sbjct  83   LLSDCAANAGSGDPYFMEPFWMRHAAGSAILVSGWHRMGYSYSDGS-----YISQLLVEY  137

Query  505  IRKVHAV  525
            I+K+H +
Sbjct  138  IKKLHGI  144



>ref|XP_003534921.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Glycine max]
Length=439

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 86/127 (68%), Gaps = 9/127 (7%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW   E  WS  AA  AE VAA+ CSGHGR Y+DG I   G  PVCEC+ CY G DCS 
Sbjct  20   GEW---EPTWSSRAAEEAEAVAAIPCSGHGRVYLDGLILK-GHEPVCECNPCYGGSDCSK  75

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
            LL DC A+A  GDP F+EPFW+++AASSA++VS WHRM YS+   S     Y SQ L  +
Sbjct  76   LLSDCAANAAGGDPYFMEPFWMRHAASSAILVSGWHRMGYSYSDKS-----YISQLLVEY  130

Query  505  IRKVHAV  525
            I+K+HA+
Sbjct  131  IKKLHAI  137



>ref|XP_010261034.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Nelumbo nucifera]
Length=453

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 84/121 (69%), Gaps = 8/121 (7%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
             L WS++AA  AE +A+L CSGHGRAY+DG +      PVC CH CY GPDCS   P C 
Sbjct  33   RLTWSREAAREAEAIASLSCSGHGRAYLDGLVSQG--KPVCLCHTCYEGPDCSDFSPGCP  90

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD DSGDPLFLEP+W+++AASSA++V+ +HRMSY +  S+       S EL+  I ++HA
Sbjct  91   ADVDSGDPLFLEPYWMRHAASSAILVAGYHRMSYRYNDST------ISTELQKQILQLHA  144

Query  523  V  525
            V
Sbjct  145  V  145



>ref|XP_004969757.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Setaria italica]
Length=490

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 78/103 (76%), Gaps = 4/103 (4%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            + CSGHG+ ++DG  G+DG  P CEC+ C++GPDCSL  PDC ADA+SG+PLFLEP+W +
Sbjct  75   VDCSGHGQVFLDGVAGEDG-RPGCECNACFAGPDCSLRTPDCTADANSGNPLFLEPYWRR  133

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            +A++ AVVVS WHRMSY+   +++    + S ELE  IR++H+
Sbjct  134  HASAGAVVVSGWHRMSYT---TTDGHGLFQSVELERQIRRLHS  173



>ref|XP_004969760.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Setaria italica]
Length=490

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 78/104 (75%), Gaps = 4/104 (4%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            + CSGHG+ ++DG  G+DG  P CEC+ C++GPDCSL  PDC ADA+SG+PLFLEP+W +
Sbjct  75   VDCSGHGQVFLDGVAGEDG-RPGCECNACFAGPDCSLRTPDCTADANSGNPLFLEPYWRR  133

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +A++ AVVVS WHRMSY+   +++    + S ELE  IR++H+ 
Sbjct  134  HASAGAVVVSGWHRMSYT---TTDGHGLFQSVELERQIRRLHSA  174



>ref|XP_003569691.1| PREDICTED: alliin lyase-like [Brachypodium distachyon]
Length=485

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 6/100 (6%)
 Frame = +1

Query  220  CSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNa  399
            CSGHGR ++DG +G+DG  P CEC+ C+ GP+CS+  PDC  DADSGDP+FLEP+W+++A
Sbjct  70   CSGHGRVFLDGIVGEDG-RPGCECNTCFEGPECSVRTPDCTVDADSGDPVFLEPYWMRHA  128

Query  400  assavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            A+SAVV S WHRMSY           + S ELE  I+++H
Sbjct  129  AASAVVYSGWHRMSY-----RTTNGVFQSVELERAIKQLH  163



>ref|NP_001169706.1| uncharacterized protein LOC100383587 [Zea mays]
 gb|ACN34607.1| unknown [Zea mays]
Length=319

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 73/101 (72%), Gaps = 6/101 (6%)
 Frame = +1

Query  217  QCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQN  396
             CSGHG+ ++DG +G+DG  P CEC+ C+ GP CS+  P+C ADA SGDPLFLEP+W ++
Sbjct  70   SCSGHGQVFLDGVVGEDG-RPGCECNRCFDGPHCSIRTPNCTADATSGDPLFLEPYWKRH  128

Query  397  aassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            AA+SAV+V  WHR+SY     +     + S ELENHIR++H
Sbjct  129  AAASAVLVPGWHRLSY-----ATTDGLFQSVELENHIRRLH  164



>gb|EMS62345.1| Alliin lyase 1 [Triticum urartu]
Length=404

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 70/100 (70%), Gaps = 6/100 (6%)
 Frame = +1

Query  220  CSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNa  399
            CSGHGR  +DG +G+DG  P CEC+ C+ GPDCS   PDC  DADSGDP+FLEP+W+++A
Sbjct  20   CSGHGRVLLDGIVGEDG-RPGCECNTCFEGPDCSARTPDCTVDADSGDPMFLEPYWMRHA  78

Query  400  assavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
             +SAVVVS WHRMSY           + S ELE  IR++H
Sbjct  79   EASAVVVSGWHRMSY-----RATDGLFQSVELERCIRRLH  113



>ref|XP_010675473.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Beta vulgaris subsp. vulgaris]
Length=463

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 7/120 (6%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            ++W +  A     V ++ CSGHG+A++DG +  DG  PVCEC+ C++GPDCSL    C A
Sbjct  40   VQWIEKVAKEVGEVESISCSGHGKAFLDGFVDRDG-KPVCECYACFAGPDCSLSTHPCVA  98

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            DADSG+P+F+EPFW  +   S ++V  WHRM Y++     P     S ELE +IRK+H +
Sbjct  99   DADSGNPMFMEPFWT-SKEISGMLVPGWHRMGYTY-----PNELAMSLELEKYIRKLHEL  152



>ref|XP_008673216.1| PREDICTED: uncharacterized protein LOC100383587 isoform X1 [Zea 
mays]
 gb|ACR36391.1| unknown [Zea mays]
 tpg|DAA57868.1| TPA: hypothetical protein ZEAMMB73_270338 [Zea mays]
Length=486

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 73/100 (73%), Gaps = 6/100 (6%)
 Frame = +1

Query  220  CSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNa  399
            CSGHG+ ++DG +G+DG  P CEC+ C+ GP CS+  P+C ADA SGDPLFLEP+W ++A
Sbjct  71   CSGHGQVFLDGVVGEDG-RPGCECNRCFDGPHCSIRTPNCTADATSGDPLFLEPYWKRHA  129

Query  400  assavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            A+SAV+V  WHR+SY     +     + S ELENHIR++H
Sbjct  130  AASAVLVPGWHRLSY-----ATTDGLFQSVELENHIRRLH  164



>gb|EAY75618.1| hypothetical protein OsI_03523 [Oryza sativa Indica Group]
Length=484

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 6/118 (5%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L W+  AA  AE VAA  CSGHG  ++DG  G+DG  P CEC+ C+SGPDCS+  P+C A
Sbjct  53   LSWALQAAREAEAVAAADCSGHGNVFLDGVTGEDG-RPGCECNRCFSGPDCSVRTPNCTA  111

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            DADSG+PLFLEP+W ++AA+SAVV S WHR+SY        G  + S EL+ HIR +H
Sbjct  112  DADSGNPLFLEPYWRRHAAASAVVFSGWHRLSY-----ITTGGRFHSVELDRHIRLLH  164



>ref|NP_001044075.1| Os01g0717700 [Oryza sativa Japonica Group]
 dbj|BAB68045.1| Alliin lyase precursor-like [Oryza sativa Japonica Group]
 dbj|BAB89835.1| Alliin lyase precursor-like [Oryza sativa Japonica Group]
 dbj|BAF05989.1| Os01g0717700 [Oryza sativa Japonica Group]
 dbj|BAG89285.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55304.1| hypothetical protein OsJ_03260 [Oryza sativa Japonica Group]
Length=484

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 82/118 (69%), Gaps = 6/118 (5%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L W+  AA  AE VAA  CSGHG  ++DG  G+DG  P CEC+ C+SGPDCS+  P+C A
Sbjct  53   LSWALQAAREAEAVAAADCSGHGNVFLDGVTGEDG-RPGCECNRCFSGPDCSVRTPNCTA  111

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            DADSG+PLFLEP+W ++AA+SAVV S WHR+SY        G  + S EL+ HIR +H
Sbjct  112  DADSGNPLFLEPYWRRHAAASAVVFSGWHRLSY-----ITTGGRFHSVELDRHIRLLH  164



>gb|AAF36437.1|AF126049_1 cysteine-sulphoxide lyase [Allium cepa]
Length=497

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 8/119 (7%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
             L W+  AA  AE VAA+ CS HGRAY+DG I  +G+ P+CECHNCYSGP CS+L  +C 
Sbjct  44   RLTWTTKAATEAEKVAAIYCSDHGRAYLDG-IPVNGV-PICECHNCYSGPTCSVLASNCT  101

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            ADA +GD +FLE +W+ +  ++A++ S WHRMSY        G  + S EL+ HIR +H
Sbjct  102  ADATTGDAMFLEKYWLHHRVNTAMLESGWHRMSYFI------GHNFMSDELDRHIRLLH  154



>ref|XP_010915068.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Elaeis guineensis]
Length=510

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 83/124 (67%), Gaps = 7/124 (6%)
 Frame = +1

Query  151  WRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLL  330
            +R  E  WS  AA  AE VAA  CSGHG A++DG + D     VCEC+ CY GPDCS  +
Sbjct  83   FRSPEPSWSSRAATEAEAVAARSCSGHGSAFVDGILVDG--KHVCECNACYRGPDCSEFV  140

Query  331  PDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIR  510
              C ADA+SGDPLFLEP+W Q+AASSAVVV+ WHRMSY        G  + S ELE HIR
Sbjct  141  QGCAADAESGDPLFLEPYWRQHAASSAVVVAGWHRMSY-----QTDGDYFISIELERHIR  195

Query  511  KVHA  522
            K+H+
Sbjct  196  KLHS  199



>ref|XP_006644625.1| PREDICTED: alliin lyase-like [Oryza brachyantha]
Length=481

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 7/118 (6%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L W+  AA  AE VAA+ CSGHG  ++DG  G+DG  P CEC+ C+SGPDCS+  P+C A
Sbjct  51   LSWALQAAREAEAVAAVDCSGHGSVFLDGVTGEDG-KPGCECNTCFSGPDCSVRTPNCTA  109

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            DADSG+PLFLEP+W ++AA+SAVV S WHR+SY+          + S EL  HIR++H
Sbjct  110  DADSGNPLFLEPYWRRHAAASAVVFSGWHRLSYT------TTDLFQSVELVRHIRQLH  161



>ref|XP_008381915.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Malus domestica]
Length=217

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 73/98 (74%), Gaps = 4/98 (4%)
 Frame = +1

Query  142  DGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCS  321
            +GEW+L    WS+ AA  AE VAA+ CSGHGRAY DG I  DG  PVCEC++CY GPDCS
Sbjct  31   ZGEWKL---SWSRRAAEEAEHVAAIPCSGHGRAYSDGLI-LDGKEPVCECNSCYGGPDCS  86

Query  322  LLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHR  435
            L L  C A+AD GDP FLEPFW+Q+AA SA+ V+ WHR
Sbjct  87   LFLTGCAANADGGDPFFLEPFWMQHAAKSAIAVAGWHR  124



>gb|KHN32840.1| Tryptophan aminotransferase-related protein 4 [Glycine soja]
Length=518

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 73/104 (70%), Gaps = 6/104 (6%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            + CSGHGR Y+DG I   G  PVCEC+ CY G DCS LL DC A+A  GDP F+EPFW++
Sbjct  119  IPCSGHGRVYLDGLILK-GHEPVCECNPCYGGSDCSKLLSDCAANAAGGDPYFMEPFWMR  177

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            +AASSA++VS WHRM YS+   S     Y SQ L  +I+K+HA+
Sbjct  178  HAASSAILVSGWHRMGYSYSDKS-----YISQLLVEYIKKLHAI  216



>ref|XP_004969758.1| PREDICTED: alliin lyase-like [Setaria italica]
Length=491

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 84/118 (71%), Gaps = 4/118 (3%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L W+  AA  AE VAA+ CSGHG+ ++DG  G+DG  P CEC+ C++G DCSL  P+C A
Sbjct  56   LSWTLQAAREAEAVAAVDCSGHGQVFLDGVAGEDG-RPGCECNACFAGRDCSLHTPNCTA  114

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            DADSG+PLFLEP+W ++AA+SAVV+S WHRMSY   G       + S ELE  IR++H
Sbjct  115  DADSGNPLFLEPYWRRHAAASAVVISGWHRMSYIATGIEK---MFQSVELERQIRRLH  169



>ref|XP_004969756.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Setaria italica]
Length=491

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (73%), Gaps = 4/118 (3%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L W+  AA  AE VAA+ CSGHG+ ++DG  G+DG  P CEC+ C++G DCSL  P+C A
Sbjct  56   LSWTLQAAREAEAVAAVDCSGHGQVFLDGVAGEDG-RPGCECNACFAGRDCSLHTPNCTA  114

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            DADSG+PLFLEP+W ++AA+SAVV+S WHRMSY    +++    + S ELE  IR++H
Sbjct  115  DADSGNPLFLEPYWRRHAAASAVVISGWHRMSYI---ATDIEKVFQSVELERQIRRLH  169



>ref|XP_007151936.1| hypothetical protein PHAVU_004G088400g [Phaseolus vulgaris]
 gb|ESW23930.1| hypothetical protein PHAVU_004G088400g [Phaseolus vulgaris]
Length=444

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 87/127 (69%), Gaps = 9/127 (7%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW   E  WS+ AA  AE VAA++CSGHG AY+DG +   G   VCEC+ CY+G DCS 
Sbjct  23   GEW---EAPWSRKAAEEAEAVAAIECSGHGSAYLDGLVLK-GHKQVCECNPCYTGSDCSK  78

Query  325  LLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENH  504
            LL +C A+A SGDP FLEPFW ++A SSA++VS WHRM Y++   S     Y SQ L +H
Sbjct  79   LLSNCSANAGSGDPYFLEPFWKKHARSSAILVSGWHRMGYTYSDGS-----YISQLLVDH  133

Query  505  IRKVHAV  525
            I+K+H +
Sbjct  134  IQKLHDI  140



>ref|XP_003519973.2| PREDICTED: tryptophan aminotransferase-related protein 4-like 
isoform X1 [Glycine max]
 gb|KHN00720.1| Tryptophan aminotransferase-related protein 4 [Glycine soja]
Length=438

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 88/129 (68%), Gaps = 11/129 (9%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKI--GDDGITPVCECHNCYSGPDC  318
            GEW   E  WS  AA  AE VAA+ CSGHGRAY+DG I  G + +  VCEC++C  G DC
Sbjct  6    GEW---EPTWSTRAAEEAEAVAAIPCSGHGRAYLDGLILKGHEHVH-VCECNSCNGGSDC  61

Query  319  SLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELE  498
               L DC A+A SGDP FLEPFW+++AASSA++VS WHRMSYS+   S     Y S+ L 
Sbjct  62   FKFLSDCIANASSGDPYFLEPFWMRHAASSAILVSGWHRMSYSYSDGS-----YISEVLV  116

Query  499  NHIRKVHAV  525
             +I+KVH++
Sbjct  117  KYIQKVHSI  125



>ref|XP_006574777.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
isoform X2 [Glycine max]
Length=460

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 88/129 (68%), Gaps = 11/129 (9%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKI--GDDGITPVCECHNCYSGPDC  318
            GEW   E  WS  AA  AE VAA+ CSGHGRAY+DG I  G + +  VCEC++C  G DC
Sbjct  28   GEW---EPTWSTRAAEEAEAVAAIPCSGHGRAYLDGLILKGHEHVH-VCECNSCNGGSDC  83

Query  319  SLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELE  498
               L DC A+A SGDP FLEPFW+++AASSA++VS WHRMSYS+   S     Y S+ L 
Sbjct  84   FKFLSDCIANASSGDPYFLEPFWMRHAASSAILVSGWHRMSYSYSDGS-----YISEVLV  138

Query  499  NHIRKVHAV  525
             +I+KVH++
Sbjct  139  KYIQKVHSI  147



>gb|AEX55243.1| unknown, partial [Allium sativum]
Length=386

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 80/122 (66%), Gaps = 6/122 (5%)
 Frame = +1

Query  160  RELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDC  339
            + L WS  AA  AE VAA+ CS HGRA++DG   +   +P CEC+NCY GP CS L+PDC
Sbjct  28   QRLGWSLKAATEAEAVAAIYCSEHGRAFLDGPTSNG--SPKCECNNCYEGPTCSNLIPDC  85

Query  340  FADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
             AD   GD LFLE +W  +  ++AVVVS WHRMSY F    NP + + S EL+  IR++H
Sbjct  86   IADVAGGDALFLEEYWKDHKQNTAVVVSGWHRMSYFF----NPQNNFMSSELDRTIRELH  141

Query  520  AV  525
             +
Sbjct  142  EL  143



>gb|ACN78838.1| alliinase [Allium sativum]
Length=474

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 79/121 (65%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  A   AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  27   KMTWTMKAVEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  84

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  85   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  140

Query  523  V  525
            V
Sbjct  141  V  141



>gb|ACL31074.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31113.1| alliinase, partial [Allium sativum]
 gb|ACL31128.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31057.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31110.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31079.1| alliinase, partial [Allium sativum]
 gb|ACL31084.1| alliinase, partial [Allium sativum]
 gb|ACL31104.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31076.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31038.1| alliinase, partial [Allium sativum]
 gb|ACL31041.1| alliinase, partial [Allium sativum]
 gb|ACL31045.1| alliinase, partial [Allium sativum]
 gb|ACL31051.1| alliinase, partial [Allium sativum]
 gb|ACL31053.1| alliinase, partial [Allium sativum]
 gb|ACL31054.1| alliinase, partial [Allium sativum]
 gb|ACL31058.1| alliinase, partial [Allium sativum]
 gb|ACL31070.1| alliinase, partial [Allium sativum]
 gb|ACL31095.1| alliinase, partial [Allium sativum]
 gb|ACL31135.1| alliinase, partial [Allium sativum]
 gb|ACL31137.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31120.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31061.1| alliinase, partial [Allium sativum]
 gb|ACL31073.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31088.1| alliinase, partial [Allium sativum]
 gb|ACL31090.1| alliinase, partial [Allium sativum]
 gb|ACL31106.1| alliinase, partial [Allium sativum]
 gb|ACL31133.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31115.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31067.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31036.1| alliinase, partial [Allium sativum]
 gb|ACL31039.1| alliinase, partial [Allium sativum]
 gb|ACL31040.1| alliinase, partial [Allium sativum]
 gb|ACL31043.1| alliinase, partial [Allium sativum]
 gb|ACL31044.1| alliinase, partial [Allium sativum]
 gb|ACL31046.1| alliinase, partial [Allium sativum]
 gb|ACL31047.1| alliinase, partial [Allium sativum]
 gb|ACL31049.1| alliinase, partial [Allium sativum]
 gb|ACL31050.1| alliinase, partial [Allium sativum]
 gb|ACL31052.1| alliinase, partial [Allium sativum]
 gb|ACL31055.1| alliinase, partial [Allium sativum]
 gb|ACL31056.1| alliinase, partial [Allium sativum]
 gb|ACL31059.1| alliinase, partial [Allium sativum]
 gb|ACL31062.1| alliinase, partial [Allium sativum]
 gb|ACL31063.1| alliinase, partial [Allium sativum]
 gb|ACL31064.1| alliinase, partial [Allium sativum]
 gb|ACL31066.1| alliinase, partial [Allium sativum]
 gb|ACL31068.1| alliinase, partial [Allium sativum]
 gb|ACL31069.1| alliinase, partial [Allium sativum]
 gb|ACL31071.1| alliinase, partial [Allium sativum]
 gb|ACL31081.1| alliinase, partial [Allium sativum]
 gb|ACL31083.1| alliinase, partial [Allium sativum]
 gb|ACL31089.1| alliinase, partial [Allium sativum]
 gb|ACL31093.1| alliinase, partial [Allium sativum]
 gb|ACL31094.1| alliinase, partial [Allium sativum]
 gb|ACL31098.1| alliinase, partial [Allium sativum]
 gb|ACL31101.1| alliinase, partial [Allium sativum]
 gb|ACL31103.1| alliinase, partial [Allium sativum]
 gb|ACL31107.1| alliinase, partial [Allium sativum]
 gb|ACL31112.1| alliinase, partial [Allium sativum]
 gb|ACL31122.1| alliinase, partial [Allium sativum]
 gb|ACL31123.1| alliinase, partial [Allium sativum]
 gb|ACL31125.1| alliinase, partial [Allium sativum]
 gb|ACL31126.1| alliinase, partial [Allium sativum]
 gb|ACL31130.1| alliinase, partial [Allium sativum]
 gb|ACL31131.1| alliinase, partial [Allium sativum]
 gb|ACL31132.1| alliinase, partial [Allium sativum]
 gb|ACL31134.1| alliinase, partial [Allium sativum]
 gb|ACL31136.1| alliinase, partial [Allium sativum]
 gb|ACL31138.1| alliinase, partial [Allium sativum]
 gb|ACL31139.1| alliinase, partial [Allium sativum]
 gb|ACL31140.1| alliinase, partial [Allium sativum]
 gb|ACL31141.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31077.1| alliinase, partial [Allium sativum]
Length=400

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  17   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  74

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  75   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  130

Query  523  V  525
            V
Sbjct  131  V  131



>gb|ACL31127.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31109.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31060.1| alliinase, partial [Allium sativum]
 gb|ACL31082.1| alliinase, partial [Allium sativum]
 gb|ACL31116.1| alliinase, partial [Allium sativum]
 gb|ACL31119.1| alliinase, partial [Allium sativum]
 gb|ACL31129.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31096.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31117.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31075.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31124.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31037.1| alliinase, partial [Allium sativum]
 gb|ACL31078.1| alliinase, partial [Allium sativum]
 gb|ACL31091.1| alliinase, partial [Allium sativum]
 gb|ACL31097.1| alliinase, partial [Allium sativum]
 gb|ACL31105.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31080.1| alliinase, partial [Allium sativum]
 gb|ACL31085.1| alliinase, partial [Allium sativum]
 gb|ACL31092.1| alliinase, partial [Allium sativum]
 gb|ACL31108.1| alliinase, partial [Allium sativum]
 gb|ACL31121.1| alliinase, partial [Allium sativum]
 gb|ACL31142.1| alliinase, partial [Allium sativum]
Length=400

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  17   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  74

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  75   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  130

Query  523  V  525
            V
Sbjct  131  V  131



>gb|ACL31102.1| alliinase, partial [Allium sativum]
Length=400

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  17   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  74

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  75   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  130

Query  523  V  525
            V
Sbjct  131  V  131



>ref|NP_001044074.1| Os01g0717400 [Oryza sativa Japonica Group]
 dbj|BAB68042.1| cysteine-sulphoxide lyase-like [Oryza sativa Japonica Group]
 dbj|BAB89832.1| cysteine-sulphoxide lyase-like [Oryza sativa Japonica Group]
 dbj|BAF05988.1| Os01g0717400 [Oryza sativa Japonica Group]
 dbj|BAG92851.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 82/128 (64%), Gaps = 14/128 (11%)
 Frame = +1

Query  139  GDG-EWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPD  315
            GDG  W L+  K ++D AA       + CSGHG  ++DG  G+DG  P CEC++C+SGPD
Sbjct  50   GDGLSWALQAAKEAEDVAA-------VDCSGHGSVFLDGVTGEDG-RPGCECNSCFSGPD  101

Query  316  CSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQEL  495
            CS+ +P+C AD   GDPLFLEP+W ++AA+SAVV S WHR+SY             S EL
Sbjct  102  CSVRIPNCAADGQGGDPLFLEPYWKRHAAASAVVFSGWHRLSY-----ITTDGHLKSVEL  156

Query  496  ENHIRKVH  519
            +  IR++H
Sbjct  157  DRQIRRLH  164



>gb|ACL31086.1| alliinase, partial [Allium sativum]
Length=400

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  17   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  74

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  75   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  130

Query  523  V  525
            V
Sbjct  131  V  131



>gb|EAY75616.1| hypothetical protein OsI_03520 [Oryza sativa Indica Group]
Length=485

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 82/128 (64%), Gaps = 14/128 (11%)
 Frame = +1

Query  139  GDG-EWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPD  315
            GDG  W L+  K ++D AA       + CSGHG  ++DG  G+DG  P CEC++C+SGPD
Sbjct  50   GDGLSWALQAAKEAEDVAA-------VDCSGHGSVFLDGVTGEDG-RPGCECNSCFSGPD  101

Query  316  CSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQEL  495
            CS+ +P+C AD   GDPLFLEP+W ++AA+SAVV S WHR+SY             S EL
Sbjct  102  CSVRIPNCAADGQGGDPLFLEPYWKRHAAASAVVFSGWHRLSY-----ITTDGHLKSVEL  156

Query  496  ENHIRKVH  519
            +  IR++H
Sbjct  157  DRQIRRLH  164



>pdb|2HOR|A Chain A, Crystal Structure Of Alliinase From Garlic- Apo Form
 pdb|2HOX|A Chain A, Alliinase From Allium Sativum (garlic)
 pdb|2HOX|B Chain B, Alliinase From Allium Sativum (garlic)
 pdb|2HOX|C Chain C, Alliinase From Allium Sativum (garlic)
 pdb|2HOX|D Chain D, Alliinase From Allium Sativum (garlic)
Length=427

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  1    KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  58

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  59   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  114

Query  523  V  525
            V
Sbjct  115  V  115



>gb|ACL31065.1| alliinase, partial [Allium sativum]
Length=399

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 79/120 (66%), Gaps = 6/120 (5%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            + W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C A
Sbjct  17   MTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCSA  74

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            D  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H V
Sbjct  75   DVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHEV  130



>gb|EEE55303.1| hypothetical protein OsJ_03258 [Oryza sativa Japonica Group]
Length=494

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 82/128 (64%), Gaps = 14/128 (11%)
 Frame = +1

Query  139  GDG-EWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPD  315
            GDG  W L+  K ++D AA       + CSGHG  ++DG  G+DG  P CEC++C+SGPD
Sbjct  50   GDGLSWALQAAKEAEDVAA-------VDCSGHGSVFLDGVTGEDG-RPGCECNSCFSGPD  101

Query  316  CSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQEL  495
            CS+ +P+C AD   GDPLFLEP+W ++AA+SAVV S WHR+SY             S EL
Sbjct  102  CSVRIPNCAADGQGGDPLFLEPYWKRHAAASAVVFSGWHRLSY-----ITTDGHLKSVEL  156

Query  496  ENHIRKVH  519
            +  IR++H
Sbjct  157  DRQIRRLH  164



>pdb|1LK9|A Chain A, The Three-Dimensional Structure Of Alliinase From Garlic
 pdb|1LK9|B Chain B, The Three-Dimensional Structure Of Alliinase From Garlic
Length=448

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  1    KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  58

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  59   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  114

Query  523  V  525
            V
Sbjct  115  V  115



>gb|ACL31099.1| alliinase, partial [Allium sativum]
Length=400

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 79/120 (66%), Gaps = 6/120 (5%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            + W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C A
Sbjct  18   MTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCSA  75

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            D  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H V
Sbjct  76   DVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHEV  131



>sp|Q41233.1|ALLN2_ALLSA RecName: Full=Alliin lyase 2; Short=Alliinase-2; AltName: Full=Cysteine 
sulphoxide lyase 2; Flags: Precursor [Allium sativum]
 gb|AAB32477.1| alliinase [Allium sativum]
Length=473

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  26   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  83

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  84   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  139

Query  523  V  525
            V
Sbjct  140  V  140



>sp|Q01594.1|ALLN1_ALLSA RecName: Full=Alliin lyase 1; Short=Alliinase-1; AltName: Full=Cysteine 
sulphoxide lyase 1; Flags: Precursor [Allium sativum]
 emb|CAA78268.1| precursor alliinase [Allium sativum]
Length=486

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  39   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  96

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  97   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  152

Query  523  V  525
            V
Sbjct  153  V  153



>dbj|BAD06448.1| alliinase-like [Allium cepa]
Length=471

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 72/102 (71%), Gaps = 7/102 (7%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            + CS HGRA++DG I D    P+CE +NCY+G DCS LLP+C AD  SGD LFLE +W++
Sbjct  63   INCSSHGRAFLDGIIADGA--PMCERNNCYNGSDCSTLLPNCSADVVSGDSLFLEEYWMR  120

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            + +++AV++S WHRMSY F     PGS + S  L+ HI+ +H
Sbjct  121  HKSNTAVLISGWHRMSYYFA----PGS-FISVVLKRHIKLLH  157



>gb|AAA32639.1| alliinase [Allium cepa]
 gb|AAA92463.1| alliinase [Allium cepa]
Length=479

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ WS  AA  AE VA + CSGHGRA++DG + D   +P CEC+ CY+G DCS  +  C 
Sbjct  35   KVTWSLKAAEEAEAVANINCSGHGRAFLDGILSDG--SPKCECNTCYTGADCSEKITGCS  92

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  93   ADVASGDGLFLEEYWQQHKENSAVLVSGWHRMSYFF----NPVSNFISFELEKTIKELHE  148

Query  523  V  525
            +
Sbjct  149  I  149



>emb|CAA78267.1| precursor alliinase [Allium cepa]
Length=480

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ WS  AA  AE VA + CSGHGRA++DG + D   +P CEC+ CY+G DCS  +  C 
Sbjct  36   KVSWSLKAAEEAEAVANINCSGHGRAFLDGILSDG--SPKCECNTCYTGADCSEKITGCS  93

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  94   ADVASGDGLFLEEYWQQHKENSAVLVSGWHRMSYFF----NPVSNFISFELEKTIKELHE  149

Query  523  V  525
            +
Sbjct  150  I  150



>gb|AAD26853.1|AF124405_1 alliinase precursor [Allium cepa]
Length=479

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ WS  AA  AE VA + CSGHGRA++DG + D   +P CEC+ CY+G DCS  +  C 
Sbjct  35   KVSWSLKAAEEAEAVANINCSGHGRAFLDGILSDG--SPKCECNTCYTGADCSEKITGCS  92

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  93   ADVASGDGLFLEEYWQQHKENSAVLVSGWHRMSYFF----NPVSNFISFELEKTIKELHE  148

Query  523  V  525
            +
Sbjct  149  I  149



>sp|P31757.2|ALLN_ALLCE RecName: Full=Alliin lyase; Short=Alliinase; AltName: Full=Cysteine 
sulphoxide lyase; Flags: Precursor [Allium cepa]
Length=479

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ WS  AA  AE VA + CSGHGRA++DG + D   +P CEC+ CY+G DCS  +  C 
Sbjct  35   KVSWSLKAAEEAEAVANINCSGHGRAFLDGILSDG--SPKCECNTCYTGADCSEKITGCS  92

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  93   ADVASGDGLFLEEYWQQHKENSAVLVSGWHRMSYFF----NPVSNFISFELEKTIKELHE  148

Query  523  V  525
            +
Sbjct  149  I  149



>gb|ACL31111.1| alliinase, partial [Allium sativum]
Length=399

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE  W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEHWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31042.1| alliinase, partial [Allium sativum]
Length=399

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMS+ F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSHFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31118.1| alliinase, partial [Allium sativum]
Length=399

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPDCS  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDCSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMS+ F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSHFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>ref|XP_010665065.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Vitis vinifera]
Length=489

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 85/134 (63%), Gaps = 17/134 (13%)
 Frame = +1

Query  136  GGDGEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPD  315
            GG GE     L WS+ AA   E VAA+ CSGHGRAY+DG + D   +PVCEC++  + P 
Sbjct  30   GGKGE-----LSWSRKAAEEEEAVAAVTCSGHGRAYLDGLVADG--SPVCECNSLNTYPI  82

Query  316  CSLLLPDCFADA-----DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAY  480
                L    A+A      SGDP+FLEPFW+QNAA+SAV+V+ WHRMSY F   S     +
Sbjct  83   VLQTLTRFIANAATCYISSGDPIFLEPFWMQNAANSAVLVAGWHRMSYRFDDQS-----F  137

Query  481  FSQELENHIRKVHA  522
             SQELE  IR++HA
Sbjct  138  ISQELERLIRRLHA  151



>sp|P31756.1|ALLN_ALLCG RecName: Full=Alliin lyase; Short=Alliinase; AltName: Full=Cysteine 
sulphoxide lyase; Flags: Precursor, partial [Allium cepa 
var. aggregatum]
 emb|CAA78266.1| precursor alliinase [Allium cepa var. aggregatum]
Length=447

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 79/121 (65%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ WS  AA  AE VA + CSGHGRA++DG + D   +P CEC+ CY+G DCS  +  C 
Sbjct  3    KVTWSLKAAEEAEAVANINCSGHGRAFLDGILSDG--SPKCECNTCYTGADCSQKITGCS  60

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHR SY F    NP S + S ELE  I+++H 
Sbjct  61   ADVASGDGLFLEEYWQQHKENSAVLVSGWHRTSYFF----NPVSNFISFELEKTIKELHE  116

Query  523  V  525
            +
Sbjct  117  I  117



>dbj|BAA20358.1| alliinase [Allium tuberosum]
Length=476

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 79/123 (64%), Gaps = 5/123 (4%)
 Frame = +1

Query  157  LRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPD  336
            ++ L W+  AA  AE VAA++CSGHGRAY DG +     +P+CEC+ CY G DCS   P+
Sbjct  27   VQTLSWTLKAAEEAEAVAAIKCSGHGRAYQDGVLSKG--SPICECNTCYEGSDCSTKTPN  84

Query  337  CFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKV  516
            C AD  SGD LFLE +W  +  ++AV+VS WHRMSY FP      S + S EL+  I ++
Sbjct  85   CSADVASGDALFLEEYWKDHKENTAVLVSGWHRMSYFFPEKD---SDFMSAELKRTITEL  141

Query  517  HAV  525
            H +
Sbjct  142  HEI  144



>gb|ACL31100.1| alliinase, partial [Allium sativum]
Length=399

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 79/121 (65%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPD S  +  C 
Sbjct  16   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDRSEKIQGCS  73

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  74   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  129

Query  523  V  525
            V
Sbjct  130  V  130



>gb|ACL31048.1| alliinase, partial [Allium sativum]
Length=400

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 79/121 (65%), Gaps = 6/121 (5%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            ++ W+  AA  AE VA + CS HGRA++DG I +   +P CEC+ CY+GPD S  +  C 
Sbjct  17   KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEG--SPKCECNTCYTGPDRSEKIQGCS  74

Query  343  ADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            AD  SGD LFLE +W Q+  +SAV+VS WHRMSY F    NP S + S ELE  I+++H 
Sbjct  75   ADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFF----NPVSNFISFELEKTIKELHE  130

Query  523  V  525
            V
Sbjct  131  V  131



>ref|XP_009407278.1| PREDICTED: tryptophan aminotransferase-related protein 3-like 
[Musa acuminata subsp. malaccensis]
Length=453

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 10/116 (9%)
 Frame = +1

Query  172  WSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADA  351
            W++ AA  AE VAA+ CSGHGRA++ G     G  P CEC+ CYSG DCS LL DC ADA
Sbjct  45   WARSAARDAEAVAAIDCSGHGRAFLAG-----GGLPACECNACYSGDDCSRLLLDCPADA  99

Query  352  DSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            DS DPLFLEP+W Q+A++S++V   W  MS     S   G  + S EL+ H+R +H
Sbjct  100  DSEDPLFLEPYWQQHASTSSIVSPGWQCMS-----SQTIGGDFNSAELDRHVRLLH  150



>ref|XP_002960756.1| hypothetical protein SELMODRAFT_75581 [Selaginella moellendorffii]
 gb|EFJ38295.1| hypothetical protein SELMODRAFT_75581 [Selaginella moellendorffii]
Length=522

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 77/120 (64%), Gaps = 3/120 (3%)
 Frame = +1

Query  160  RELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDC  339
            R+  W+  A+A AE  AA+ CSGHGR ++D  +  +G  P CEC+ C++G DCS  + +C
Sbjct  68   RDYHWTSKASAEAEKAAAIPCSGHGRVFVDTILAANG-EPSCECNRCFAGTDCSSKIKNC  126

Query  340  FADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
             A  DSGDP+FLEPFW  NA + AVV+   HRMSY F  ++  G    + ELE  IR+VH
Sbjct  127  NATVDSGDPMFLEPFWDANAEAGAVVIPPVHRMSY-FTEATGEGRK-ITLELERLIRQVH  184



>ref|XP_002983914.1| hypothetical protein SELMODRAFT_423204 [Selaginella moellendorffii]
 gb|EFJ14926.1| hypothetical protein SELMODRAFT_423204 [Selaginella moellendorffii]
Length=464

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 3/102 (3%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            + CSGHGR ++D  +  +G  P CEC+ C++G DCS  + +C A  DSGDP+FLEPFW  
Sbjct  36   IPCSGHGRVFLDTILAANG-EPSCECNRCFAGTDCSSKIKNCNAKVDSGDPMFLEPFWDA  94

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            NA + AVV+   HRMSY    ++       + ELE  IR+VH
Sbjct  95   NAEAGAVVIPPVHRMSYLTEATAE--GRRITLELERLIRQVH  134



>ref|XP_001756693.1| predicted protein [Physcomitrella patens]
 gb|EDQ78647.1| predicted protein [Physcomitrella patens]
Length=489

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 66/102 (65%), Gaps = 3/102 (3%)
 Frame = +1

Query  220  CSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNa  399
            CSG+G  ++D    D   +P CEC++C++GPDCSL LPDC ADA SGDPL  E +W +N+
Sbjct  86   CSGNGNVFVDTVGIDADGSPSCECNDCFAGPDCSLPLPDCVADAISGDPLLFEAYWRKNS  145

Query  400  assavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
               AVV+  W+RM Y    + +  S  +++ L   IR++HA+
Sbjct  146  DLGAVVIPAWYRMGYQ---TRDVTSMPYTEALVASIRELHAM  184



>ref|XP_002965434.1| hypothetical protein SELMODRAFT_406798 [Selaginella moellendorffii]
 gb|EFJ32854.1| hypothetical protein SELMODRAFT_406798 [Selaginella moellendorffii]
Length=461

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 62/108 (57%), Gaps = 12/108 (11%)
 Frame = +1

Query  220  CSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNa  399
            CSGHGR +      +DG    CEC +CY+G +CS L   C  DAD+GDP FLEPFW+++ 
Sbjct  49   CSGHGRVF------NDGSDLACECSDCYTGVNCSELQHGCMVDADAGDPTFLEPFWMEHG  102

Query  400  assavvvsxWHRMSYSF------PGSSNPGSAYFSQELENHIRKVHAV  525
            A + V +  W+RM YS       P        Y  +ELE+ IR++H +
Sbjct  103  ADAGVFMPSWYRMGYSVKKKGSSPAHKELPLVYVIKELEDSIRELHEL  150



>ref|XP_002994169.1| hypothetical protein SELMODRAFT_163364 [Selaginella moellendorffii]
 gb|EFJ04759.1| hypothetical protein SELMODRAFT_163364 [Selaginella moellendorffii]
Length=461

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 62/108 (57%), Gaps = 12/108 (11%)
 Frame = +1

Query  220  CSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNa  399
            CSGHGR +      +DG    CEC +CY+G +CS L   C  DAD+GDP FLEPFW+++ 
Sbjct  49   CSGHGRVF------NDGSDLACECSDCYTGVNCSELQHGCMVDADAGDPTFLEPFWMEHG  102

Query  400  assavvvsxWHRMSYSF------PGSSNPGSAYFSQELENHIRKVHAV  525
            A + V +  W+RM YS       P        Y  +ELE+ IR++H +
Sbjct  103  ADAGVFMPSWYRMGYSVKKKGSSPAHKELPLVYVIKELEDSIRELHEL  150



>emb|CDP11448.1| unnamed protein product [Coffea canephora]
Length=243

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 63/104 (61%), Gaps = 16/104 (15%)
 Frame = +1

Query  214  LQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQ  393
            L CS      +DG + D G  PVCEC+ C++GPDCS L+PDC        P+FLEPFW Q
Sbjct  38   LDCSA-----LDGSVLDGG-KPVCECNACHTGPDCSQLVPDCV-----WKPMFLEPFWKQ  86

Query  394  NaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            NAA+SA++V+ W +M Y F   S       S ELE  IRK+HA 
Sbjct  87   NAANSAIMVAGWLQMGYEFEDGS-----LTSNELEKVIRKLHAT  125



>ref|XP_001766876.1| predicted protein [Physcomitrella patens]
 gb|EDQ68278.1| predicted protein, partial [Physcomitrella patens]
Length=406

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 59/99 (60%), Gaps = 3/99 (3%)
 Frame = +1

Query  223  SGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNaa  402
            SG+G  ++D    +DG T  CEC++C++GPDCS  + +C AD+DSGDPL  E +W  N  
Sbjct  1    SGNGNVFVDIVDVNDGGTAACECNDCFTGPDCSTPVRECRADSDSGDPLLFEAYWRANPN  60

Query  403  ssavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
               VV+  W+RMSY    + +  +  ++  L   IR +H
Sbjct  61   LGTVVIPGWYRMSYL---TRDNAAILYTDALLRTIRDLH  96



>gb|KHG26661.1| Tryptophan aminotransferase-related 4 -like protein [Gossypium 
arboreum]
Length=130

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW    L WS  AAA AE VA + CSGHGRAY+DG +GD G  PVCEC+ CY+GP+CS 
Sbjct  29   GEW---SLSWSSKAAAEAEAVAEIACSGHGRAYLDGLVGD-GNEPVCECNTCYTGPNCSH  84

Query  325  LLPDCFADADSGDPLF  372
             +P C ADAD    +F
Sbjct  85   FIPHCTADADRSTRVF  100



>ref|XP_009778185.1| PREDICTED: alliin lyase 1-like [Nicotiana sylvestris]
 ref|XP_009778189.1| PREDICTED: alliin lyase 1-like [Nicotiana sylvestris]
Length=105

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 52/69 (75%), Gaps = 2/69 (3%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
             E   ++L WSQ AA  AE VA++ CSGHG+AY+DG + D GI P CEC+ CY+GPDCSL
Sbjct  37   SEQEKKKLSWSQRAAEEAEAVASISCSGHGKAYLDGLVVD-GI-PTCECYTCYAGPDCSL  94

Query  325  LLPDCFADA  351
            L+P+C A+A
Sbjct  95   LIPNCSANA  103



>gb|KJB14639.1| hypothetical protein B456_002G135400 [Gossypium raimondii]
Length=115

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 4/70 (6%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
             EW    L WS  AAA AE VA + CSGH RAY+DG +GD G  PVCEC+ CY+GP+CS 
Sbjct  29   AEW---SLSWSSKAAAEAEAVAEIACSGHRRAYLDGLVGD-GNEPVCECNTCYTGPNCSH  84

Query  325  LLPDCFADAD  354
             +P C ADAD
Sbjct  85   FIPHCTADAD  94



>emb|CAN81399.1| hypothetical protein VITISV_018728 [Vitis vinifera]
Length=129

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +1

Query  163  ELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCF  342
            +L WS+ AA  AE VAA+ CSGHGR Y+DG + D   +PVCEC++C+ GPDCS   PDC 
Sbjct  35   ZLSWSRRAAEEAEAVAAVSCSGHGRGYLDGLVVDG--SPVCECNSCFGGPDCSQFAPDCV  92

Query  343  ADAD  354
            ADAD
Sbjct  93   ADAD  96



>gb|KHN41290.1| Tryptophan aminotransferase-related protein 4 [Glycine soja]
Length=284

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = +1

Query  145  GEWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSL  324
            GEW   E  WS  AA   ET AA+ CSGHGRAY+DG I  D    +CEC++CY+G DCS 
Sbjct  8    GEW---EPTWSTRAAEETETGAAIPCSGHGRAYLDGLILKDMNESLCECNSCYAGSDCSQ  64

Query  325  LLPDCFADAD  354
             L DC A+AD
Sbjct  65   FLSDCPANAD  74



>ref|XP_006644626.1| PREDICTED: LOW QUALITY PROTEIN: tryptophan aminotransferase-related 
protein 4-like [Oryza brachyantha]
Length=486

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 67/119 (56%), Gaps = 6/119 (5%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L W+  AA  AE VAA  CSGHG   +DG        P C C     GPD S+LL     
Sbjct  55   LSWALQAAREAEAVAAADCSGHGGVVLDGXXXXXX-XPGCSCSRAMRGPDGSVLLQWFPF  113

Query  346  DADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            +  SG+PLFLEP+W ++AA+SAVV S WHR+SY          A+ S EL  HIR++H 
Sbjct  114  NLCSGNPLFLEPYWRRHAAASAVVFSGWHRLSY-----ITTDGAFHSVELVRHIRRLHT  167



>tpg|DAA57865.1| TPA: hypothetical protein ZEAMMB73_021845 [Zea mays]
Length=162

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L WS  AA  AE VAA++CSGHG+ ++DG  G+DG  P CEC++C+ GPDCSL  P+C A
Sbjct  57   LTWSLQAAREAEAVAAVECSGHGQVFVDGVAGEDG-RPGCECNSCFGGPDCSLRTPNCTA  115

Query  346  DAD  354
            DAD
Sbjct  116  DAD  118



>gb|ACG45500.1| hypothetical protein [Zea mays]
Length=160

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPDCFA  345
            L WS  AA  AE VAA++CSGHG+ ++DG  G+DG  P CEC++C+ GPDCSL  P+C A
Sbjct  55   LTWSLQAAREAEAVAAVECSGHGQVFVDGVAGEDG-RPGCECNSCFGGPDCSLRTPNCTA  113

Query  346  DAD  354
            DAD
Sbjct  114  DAD  116



>gb|EYU24346.1| hypothetical protein MIMGU_mgv1a008741mg [Erythranthe guttata]
Length=364

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 46/57 (81%), Gaps = 5/57 (9%)
 Frame = +1

Query  355  SGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            SGDPLFLEPFW+++AASSAV++S WHRMSY+F   S     + SQ+LENH+R+VH V
Sbjct  2    SGDPLFLEPFWMEHAASSAVLISGWHRMSYTFYDKS-----FISQQLENHVRRVHEV  53



>emb|CAN81398.1| hypothetical protein VITISV_018727 [Vitis vinifera]
Length=954

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 5/55 (9%)
 Frame = +1

Query  355  SGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVH  519
            SGDPLFLEPFW+QNAASSA++V+ WHRMSY+F   S       S+ LE+HIRK+H
Sbjct  660  SGDPLFLEPFWIQNAASSAMLVAGWHRMSYTFTNQS-----LISRLLEDHIRKLH  709



>ref|XP_001773769.1| predicted protein [Physcomitrella patens]
 gb|EDQ61386.1| predicted protein [Physcomitrella patens]
Length=410

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 3/82 (4%)
 Frame = +1

Query  280  VCECHNCYSGPDCSLLLPDCFADADSGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGS  459
            +C+C+ C+ G DCS ++ +C  D D GDP   E FW +NAA++  V+  + RMSY F  S
Sbjct  12   ICKCYECFGGVDCSQVIDNCVIDLDHGDPTMFEEFWFRNAANTITVILGYQRMSY-FAQS  70

Query  460  SNPGSAYFSQELENHIRKVHAV  525
             +    +   ELE  IR++H V
Sbjct  71   KHVW--FMENELEVQIRELHRV  90



>ref|XP_007200062.1| hypothetical protein PRUPE_ppa022549mg, partial [Prunus persica]
 gb|EMJ01261.1| hypothetical protein PRUPE_ppa022549mg, partial [Prunus persica]
Length=405

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 43/56 (77%), Gaps = 5/56 (9%)
 Frame = +1

Query  358  GDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            GDPLFLEPFW+Q+A+ SA+VV+ WHRMSY     ++   +Y S ELE HIRK+HA+
Sbjct  1    GDPLFLEPFWMQHASKSALVVAGWHRMSY-----TSADQSYISAELERHIRKLHAI  51



>gb|KJB10099.1| hypothetical protein B456_001G183500 [Gossypium raimondii]
Length=364

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 5/56 (9%)
 Frame = +1

Query  355  SGDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            SGDPLFLEPFW+Q+ ASSA+VV+ WH+MSY++ G S     +FS+EL   +RKVHA
Sbjct  5    SGDPLFLEPFWMQHLASSALVVAGWHQMSYTYGGKS-----FFSKELAKVVRKVHA  55



>gb|KCW71085.1| hypothetical protein EUGRSUZ_F041842, partial [Eucalyptus grandis]
Length=109

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +1

Query  148  EWRLRELKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLL  327
            E  ++ L WS  AAA AE+ AA +CSGHGRA++DG + D    P CEC+ CY GPDCSL 
Sbjct  43   EVNVQGLSWSGRAAAEAESAAARECSGHGRAFLDGAVADG--RPACECNTCYGGPDCSLF  100

Query  328  LP  333
             P
Sbjct  101  CP  102



>ref|XP_010063822.1| PREDICTED: tryptophan aminotransferase-related protein 4-like 
[Eucalyptus grandis]
Length=363

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 5/55 (9%)
 Frame = +1

Query  358  GDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            GDPLFLEPFW Q+A SSAVVV+ WHRMSYSF   +     + SQELE+ +RK+H+
Sbjct  5    GDPLFLEPFWKQHAESSAVVVAGWHRMSYSFSDQT-----FLSQELESLLRKLHS  54



>gb|KCW71086.1| hypothetical protein EUGRSUZ_F041841, partial [Eucalyptus grandis]
Length=357

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 5/53 (9%)
 Frame = +1

Query  364  PLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHA  522
            PLFLEPFW Q+A SSAVVV+ WHRMSYSF   +     + SQELE+ +RK+H+
Sbjct  1    PLFLEPFWKQHAESSAVVVAGWHRMSYSFSDQT-----FLSQELESLLRKLHS  48



>ref|XP_004969761.1| PREDICTED: alliin lyase-like [Setaria italica]
Length=99

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  166  LKWSQDaaaaaetvaaLQCSGHGRAYIDGKIGDDGITPVCECHNCYSGPDCSLLLPD  336
            L W+  AA  AE VAA+ CSGHG+ ++DG  G+DG  P CEC+ C++GPDC L  PD
Sbjct  42   LSWALRAAREAEAVAAVDCSGHGQVFLDGVAGEDG-RPGCECNACFAGPDCPLRTPD  97



>ref|XP_010501768.1| PREDICTED: tryptophan aminotransferase-related protein 4 [Camelina 
sativa]
Length=387

 Score = 49.3 bits (116),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 5/56 (9%)
 Frame = +1

Query  358  GDPLFLEPFWVQNaassavvvsxWHRMSYSFPGSSNPGSAYFSQELENHIRKVHAV  525
            GDPLFLEPFW++ A SSAV+VS WHRM Y++   +     + S+EL   IRK+H+V
Sbjct  45   GDPLFLEPFWMREAESSAVLVSGWHRMRYNYQDGT-----HVSRELGKVIRKLHSV  95


 Score = 21.6 bits (44),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 16/30 (53%), Gaps = 0/30 (0%)
 Frame = +2

Query  266  MVLHLCVSATTAILVLIALSYCLTALLMLT  355
            M  +L VSAT A    IA  +   AL MLT
Sbjct  13   MARNLLVSATIATQAKIAPFFSKIALSMLT  42



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600