BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G18

Length=593
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003603599.1|  BURP domain protein                                204   8e-61   Medicago truncatula
ref|NP_001235949.1|  BURP domain protein precursor                      194   5e-57   
gb|ACU21473.1|  unknown                                                 194   6e-57   Glycine max [soybeans]
gb|ACV60360.1|  RD22-like protein                                       194   7e-57   Camellia sinensis [black tea]
gb|ACH97124.1|  BURP domain-containing protein                          193   1e-56   Camellia sinensis [black tea]
ref|XP_007012037.1|  BURP domain-containing protein, putative iso...    193   1e-56   
ref|XP_007012036.1|  BURP domain-containing protein isoform 1           191   1e-55   
ref|XP_011081829.1|  PREDICTED: dehydration-responsive protein RD22     190   4e-55   Sesamum indicum [beniseed]
ref|XP_003522684.1|  PREDICTED: dehydration-responsive protein RD...    189   4e-55   Glycine max [soybeans]
gb|KHN10237.1|  Dehydration-responsive protein RD22                     189   5e-55   Glycine soja [wild soybean]
gb|ACU19496.1|  unknown                                                 188   2e-54   Glycine max [soybeans]
ref|XP_010667774.1|  PREDICTED: dehydration-responsive protein RD...    187   3e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|WP_039311086.1|  hypothetical protein                               183   6e-54   Paenibacillus sp. IHB B 3415
ref|XP_010925839.1|  PREDICTED: BURP domain-containing protein 3-...    183   3e-53   Elaeis guineensis
ref|NP_001267970.1|  rd22-c protein precursor                           184   5e-53   Vitis vinifera
gb|KJB54864.1|  hypothetical protein B456_009G052200                    179   3e-51   Gossypium raimondii
dbj|BAB60850.1|  BURP domain-containing protein                         178   4e-51   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010925834.1|  PREDICTED: BURP domain-containing protein 6-...    178   4e-51   Elaeis guineensis
gb|KJB54859.1|  hypothetical protein B456_009G052200                    177   1e-50   Gossypium raimondii
dbj|BAB60847.1|  BURP domain-containing protein                         175   3e-50   Bruguiera gymnorhiza [Burma mangrove]
gb|AFK48420.1|  unknown                                                 177   3e-50   Lotus japonicus
dbj|BAB60849.1|  BURP domain-containing protein                         176   3e-50   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_008797983.1|  PREDICTED: BURP domain-containing protein 3-...    174   6e-50   Phoenix dactylifera
ref|XP_010925836.1|  PREDICTED: BURP domain-containing protein 6-...    174   8e-50   
ref|XP_010911738.1|  PREDICTED: BURP domain-containing protein 6-...    175   8e-50   
emb|CAN83863.1|  hypothetical protein VITISV_030281                     175   9e-50   Vitis vinifera
emb|CBI28075.3|  unnamed protein product                                172   1e-49   Vitis vinifera
ref|XP_009416720.1|  PREDICTED: BURP domain-containing protein 3-...    176   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007137164.1|  hypothetical protein PHAVU_009G105300g             174   3e-49   Phaseolus vulgaris [French bean]
dbj|BAB60848.1|  BURP domain-containing protein                         174   3e-49   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_003588550.1|  BURP domain-containing protein                     173   4e-49   
gb|KJB54856.1|  hypothetical protein B456_009G052200                    173   6e-49   Gossypium raimondii
gb|KJB54855.1|  hypothetical protein B456_009G052200                    174   8e-49   Gossypium raimondii
ref|XP_010925838.1|  PREDICTED: BURP domain-containing protein 6-...    172   1e-48   Elaeis guineensis
ref|XP_010943940.1|  PREDICTED: BURP domain-containing protein 6-...    172   1e-48   
ref|XP_010648549.1|  PREDICTED: dehydration-responsive protein RD...    172   1e-48   Vitis vinifera
gb|AAL67991.1|  dehydration-induced protein RD22-like protein           172   1e-48   Gossypium hirsutum [American cotton]
gb|AES58801.2|  dehydration-responsive protein RD22                     171   2e-48   Medicago truncatula
gb|KHG03003.1|  Dehydration-responsive RD22 -like protein               172   2e-48   Gossypium arboreum [tree cotton]
gb|KJB54863.1|  hypothetical protein B456_009G052200                    172   2e-48   Gossypium raimondii
ref|NP_001268138.1|  rd22-b protein precursor                           171   3e-48   Vitis vinifera
ref|XP_010648548.1|  PREDICTED: dehydration-responsive protein RD...    171   3e-48   Vitis vinifera
ref|XP_010249743.1|  PREDICTED: dehydration-responsive protein RD22     173   3e-48   Nelumbo nucifera [Indian lotus]
gb|ACD62790.1|  BURP domain-containing protein                          171   3e-48   Phaseolus vulgaris [French bean]
ref|XP_010925835.1|  PREDICTED: BURP domain-containing protein 6-...    171   4e-48   
gb|AGV54277.1|  BURP domain-containing protein                          171   6e-48   Phaseolus vulgaris [French bean]
ref|XP_010648547.1|  PREDICTED: dehydration-responsive protein RD...    169   1e-47   Vitis vinifera
ref|XP_009762320.1|  PREDICTED: dehydration-responsive protein RD22     171   1e-47   Nicotiana sylvestris
emb|CAN63067.1|  hypothetical protein VITISV_031226                     170   2e-47   Vitis vinifera
ref|XP_002284434.1|  PREDICTED: dehydration-responsive protein RD...    169   3e-47   Vitis vinifera
ref|XP_009628254.1|  PREDICTED: dehydration-responsive protein RD...    169   5e-47   Nicotiana tomentosiformis
ref|XP_010917767.1|  PREDICTED: BURP domain-containing protein 6-...    167   5e-47   Elaeis guineensis
ref|XP_003588559.1|  BURP domain-containing protein                     168   6e-47   Medicago truncatula
ref|XP_009628253.1|  PREDICTED: dehydration-responsive protein RD...    169   6e-47   Nicotiana tomentosiformis
gb|AAQ22345.1|  BURP domain-containing protein                          166   3e-46   Gossypium hirsutum [American cotton]
ref|XP_004291216.1|  PREDICTED: dehydration-responsive protein RD22     168   3e-46   Fragaria vesca subsp. vesca
ref|XP_002284380.1|  PREDICTED: BURP domain-containing protein 3-...    165   4e-46   Vitis vinifera
ref|XP_007140998.1|  hypothetical protein PHAVU_008G158600g             166   6e-46   Phaseolus vulgaris [French bean]
gb|AGV54733.1|  dehydration-responsive protein RD22-like protein        165   8e-46   Phaseolus vulgaris [French bean]
ref|XP_010911557.1|  PREDICTED: BURP domain-containing protein 6-...    164   9e-46   Elaeis guineensis
gb|AGE46023.1|  dehydration-responsive protein RD22-like isoform 2      164   9e-46   Elaeis guineensis
ref|XP_011089427.1|  PREDICTED: BURP domain-containing protein 3-...    164   2e-45   Sesamum indicum [beniseed]
gb|KDO79703.1|  hypothetical protein CISIN_1g018131mg                   164   2e-45   Citrus sinensis [apfelsine]
gb|AAT66912.1|  dehydration-induced protein RD22-like protein 1         164   3e-45   Gossypium arboreum [tree cotton]
ref|XP_003588558.1|  BURP domain protein                                163   3e-45   
emb|CDP18475.1|  unnamed protein product                                164   3e-45   Coffea canephora [robusta coffee]
ref|XP_009400562.1|  PREDICTED: BURP domain-containing protein 3-...    164   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275413.1|  BURP domain-containing protein precursor           164   4e-45   Solanum tuberosum [potatoes]
ref|XP_003588548.1|  BURP domain-containing protein                     162   5e-45   
emb|CDP16139.1|  unnamed protein product                                163   6e-45   Coffea canephora [robusta coffee]
emb|CDP16143.1|  unnamed protein product                                160   3e-44   Coffea canephora [robusta coffee]
ref|XP_009400564.1|  PREDICTED: BURP domain-containing protein 3-...    161   4e-44   
ref|XP_003588464.1|  Dehydration-responsive protein RD22                160   5e-44   
gb|AES58800.2|  dehydration-responsive protein RD22                     159   5e-44   Medicago truncatula
ref|XP_009400563.1|  PREDICTED: BURP domain-containing protein 3-...    160   5e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001268112.1|  RD22-like protein precursor                        161   6e-44   Vitis vinifera
emb|CDP16137.1|  unnamed protein product                                159   6e-44   Coffea canephora [robusta coffee]
ref|XP_003588554.1|  BURP domain-containing protein                     160   6e-44   
ref|XP_003588552.1|  BURP domain protein                                160   7e-44   Medicago truncatula
ref|XP_002324250.2|  hypothetical protein POPTR_0018s00850g             159   1e-43   
emb|CDP18474.1|  unnamed protein product                                159   2e-43   Coffea canephora [robusta coffee]
ref|XP_008781671.1|  PREDICTED: BURP domain-containing protein 6-...    159   2e-43   
ref|NP_001234521.1|  BURP domain-containing protein precursor           159   3e-43   Solanum lycopersicum
ref|XP_008337839.1|  PREDICTED: dehydration-responsive protein RD...    158   3e-43   Malus domestica [apple tree]
ref|NP_001236126.1|  BURP domain protein 2 precursor                    159   3e-43   Glycine max [soybeans]
ref|XP_002308621.2|  Dehydration-responsive protein RD22 precursor      160   4e-43   
ref|XP_008792350.1|  PREDICTED: BURP domain-containing protein 3        159   4e-43   Phoenix dactylifera
gb|KDP34221.1|  hypothetical protein JCGZ_07792                         159   4e-43   Jatropha curcas
ref|XP_006388094.1|  hypothetical protein POPTR_0343s00200g             159   4e-43   Populus trichocarpa [western balsam poplar]
emb|CAN75710.1|  hypothetical protein VITISV_004492                     159   4e-43   Vitis vinifera
ref|XP_010112167.1|  hypothetical protein L484_019906                   161   7e-43   
gb|EYU20466.1|  hypothetical protein MIMGU_mgv1a020040mg                157   9e-43   Erythranthe guttata [common monkey flower]
ref|XP_006371718.1|  hypothetical protein POPTR_0018s00850g             159   9e-43   Populus trichocarpa [western balsam poplar]
emb|CDP21056.1|  unnamed protein product                                156   1e-42   Coffea canephora [robusta coffee]
ref|XP_006450616.1|  hypothetical protein CICLE_v10008742mg             157   1e-42   
gb|KDO79705.1|  hypothetical protein CISIN_1g018131mg                   156   1e-42   Citrus sinensis [apfelsine]
gb|ABH09493.1|  RD22-like protein                                       158   2e-42   Knorringia sibirica
emb|CAH59196.1|  BURP-domain containing protein                         156   2e-42   Plantago major [cart-track plant]
ref|XP_006450615.1|  hypothetical protein CICLE_v10008742mg             157   2e-42   Citrus clementina [clementine]
ref|XP_006476150.1|  PREDICTED: dehydration-responsive protein RD...    156   3e-42   Citrus sinensis [apfelsine]
ref|XP_011026571.1|  PREDICTED: dehydration-responsive protein RD...    157   3e-42   Populus euphratica
gb|ABK95182.1|  unknown                                                 157   4e-42   Populus trichocarpa [western balsam poplar]
ref|XP_002516581.1|  Dehydration-responsive protein RD22 precurso...    155   9e-42   Ricinus communis
gb|KHN15366.1|  Dehydration-responsive protein RD22                     154   1e-41   Glycine soja [wild soybean]
ref|XP_009367928.1|  PREDICTED: BURP domain-containing protein 3-...    155   1e-41   Pyrus x bretschneideri [bai li]
gb|KDP33666.1|  hypothetical protein JCGZ_07237                         154   1e-41   Jatropha curcas
emb|CDP16148.1|  unnamed protein product                                154   1e-41   Coffea canephora [robusta coffee]
gb|ADD54599.1|  dehydration-responsive protein RD22 precursor           150   2e-41   Linum usitatissimum
emb|CDP16146.1|  unnamed protein product                                154   2e-41   Coffea canephora [robusta coffee]
ref|XP_009367927.1|  PREDICTED: dehydration-responsive protein RD...    155   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_010924753.1|  PREDICTED: BURP domain-containing protein 3-...    153   5e-41   Elaeis guineensis
ref|XP_011019672.1|  PREDICTED: dehydration-responsive protein RD...    154   5e-41   Populus euphratica
ref|XP_002284368.1|  PREDICTED: dehydration-responsive protein RD22     151   5e-41   Vitis vinifera
ref|XP_009367929.1|  PREDICTED: dehydration-responsive protein RD...    154   6e-41   Pyrus x bretschneideri [bai li]
emb|CDP21613.1|  unnamed protein product                                152   6e-41   Coffea canephora [robusta coffee]
emb|CBI20911.3|  unnamed protein product                                152   7e-41   Vitis vinifera
ref|XP_009338717.1|  PREDICTED: BURP domain-containing protein 3-...    154   7e-41   
ref|XP_008378221.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    154   1e-40   
ref|XP_003588556.1|  Dehydration-responsive protein RD22                151   1e-40   Medicago truncatula
ref|XP_007211648.1|  hypothetical protein PRUPE_ppa008862mg             151   1e-40   Prunus persica
ref|XP_002514311.1|  polygalacturonase, putative                        150   3e-40   Ricinus communis
ref|XP_010049078.1|  PREDICTED: dehydration-responsive protein RD22     150   4e-40   Eucalyptus grandis [rose gum]
ref|XP_003588549.1|  BURP domain-containing protein                     149   5e-40   
ref|XP_009338715.1|  PREDICTED: BURP domain-containing protein 3-...    151   5e-40   Pyrus x bretschneideri [bai li]
ref|XP_009338716.1|  PREDICTED: dehydration-responsive protein RD...    151   5e-40   
ref|XP_002281750.2|  PREDICTED: dehydration-responsive protein RD...    148   5e-40   Vitis vinifera
ref|NP_001044161.1|  Os01g0733500                                       151   1e-39   
gb|AAT66913.1|  dehydration-induced protein RD22-like protein 2         149   2e-39   Gossypium arboreum [tree cotton]
ref|XP_008380463.1|  PREDICTED: dehydration-responsive protein RD...    149   2e-39   
ref|XP_009373565.1|  PREDICTED: dehydration-responsive protein RD...    149   2e-39   
ref|XP_007227268.1|  hypothetical protein PRUPE_ppa017769mg             148   2e-39   Prunus persica
gb|KJB54854.1|  hypothetical protein B456_009G052100                    149   2e-39   Gossypium raimondii
ref|XP_010648550.1|  PREDICTED: dehydration-responsive protein RD...    147   3e-39   Vitis vinifera
ref|XP_008220021.1|  PREDICTED: dehydration-responsive protein RD...    148   3e-39   Prunus mume [ume]
gb|EMS48341.1|  hypothetical protein TRIUR3_05844                       147   4e-39   Triticum urartu
gb|EAZ13440.1|  hypothetical protein OsJ_03360                          149   4e-39   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK06506.1|  predicted protein                                      150   5e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008244952.1|  PREDICTED: BURP domain-containing protein 3-...    146   7e-39   Prunus mume [ume]
gb|EAY75726.1|  hypothetical protein OsI_03637                          147   2e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_001274155.1|  uncharacterized protein LOC101767742 precursor     147   3e-38   Setaria italica
gb|KJB54857.1|  hypothetical protein B456_009G052200                    144   3e-38   Gossypium raimondii
gb|KDP46064.1|  hypothetical protein JCGZ_06575                         144   5e-38   Jatropha curcas
gb|KJB54858.1|  hypothetical protein B456_009G052200                    144   5e-38   Gossypium raimondii
ref|XP_007224966.1|  hypothetical protein PRUPE_ppa020936mg             145   5e-38   
ref|XP_006644664.1|  PREDICTED: BURP domain-containing protein 3-...    146   5e-38   
gb|KJB54861.1|  hypothetical protein B456_009G052200                    144   5e-38   Gossypium raimondii
ref|NP_001141101.1|  hypothetical protein precursor                     147   6e-38   Zea mays [maize]
ref|XP_010519915.1|  PREDICTED: dehydration-responsive protein RD22     145   6e-38   Tarenaya hassleriana [spider flower]
gb|KDP46071.1|  hypothetical protein JCGZ_06582                         144   6e-38   Jatropha curcas
gb|AAL26909.1|AF319165_1  dehydration-responsive protein RD22           144   8e-38   Prunus persica
ref|XP_004136300.1|  PREDICTED: dehydration-responsive protein RD...    145   9e-38   Cucumis sativus [cucumbers]
emb|CDM84063.1|  unnamed protein product                                146   1e-37   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008466264.1|  PREDICTED: dehydration-responsive protein RD...    144   1e-37   
ref|XP_002522982.1|  polygalacturonase, putative                        143   1e-37   
ref|XP_008245112.1|  PREDICTED: dehydration-responsive protein RD...    143   2e-37   Prunus mume [ume]
ref|XP_008466262.1|  PREDICTED: dehydration-responsive protein RD...    144   2e-37   Cucumis melo [Oriental melon]
gb|KHF97444.1|  Dehydration-responsive RD22 -like protein               142   2e-37   Gossypium arboreum [tree cotton]
gb|EPS58650.1|  hypothetical protein M569_16161                         142   2e-37   Genlisea aurea
ref|XP_007221784.1|  hypothetical protein PRUPE_ppa005699mg             145   2e-37   
ref|XP_007227242.1|  hypothetical protein PRUPE_ppa018182mg             141   5e-37   
dbj|BAH56805.1|  AT5G25610                                              142   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008226517.1|  PREDICTED: dehydration-responsive protein RD...    141   6e-37   Prunus mume [ume]
ref|XP_009345258.1|  PREDICTED: BURP domain-containing protein 3-...    140   8e-37   Pyrus x bretschneideri [bai li]
ref|XP_010667747.1|  PREDICTED: dehydration-responsive protein RD...    142   9e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_197943.1|  dehydration-responsive protein RD22                   142   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|EMT06192.1|  hypothetical protein F775_17404                         139   1e-36   
ref|XP_002456304.1|  hypothetical protein SORBIDRAFT_03g033760          143   1e-36   
gb|ACU20207.1|  unknown                                                 141   1e-36   Glycine max [soybeans]
gb|KHN15367.1|  Dehydration-responsive protein RD22                     141   1e-36   Glycine soja [wild soybean]
ref|NP_001132751.1|  hypothetical protein precursor                     141   2e-36   Zea mays [maize]
ref|XP_008356193.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    141   2e-36   
ref|XP_004306762.1|  PREDICTED: dehydration-responsive protein RD...    140   2e-36   Fragaria vesca subsp. vesca
ref|XP_010925837.1|  PREDICTED: BURP domain-containing protein 3-...    138   3e-36   
emb|CDY54896.1|  BnaC02g48560D                                          140   5e-36   Brassica napus [oilseed rape]
ref|XP_009129951.1|  PREDICTED: dehydration-responsive protein RD...    140   5e-36   Brassica rapa
ref|XP_008226515.1|  PREDICTED: dehydration-responsive protein RD...    139   6e-36   Prunus mume [ume]
emb|CDY05501.1|  BnaA02g31900D                                          140   6e-36   
ref|XP_010910127.1|  PREDICTED: BURP domain-containing protein 6-...    139   6e-36   
ref|XP_003569738.1|  PREDICTED: BURP domain-containing protein 3-...    141   6e-36   Brachypodium distachyon [annual false brome]
ref|XP_008226516.1|  PREDICTED: dehydration-responsive protein RD...    139   8e-36   Prunus mume [ume]
ref|NP_001238316.1|  BURP domain-containing protein precursor           139   8e-36   Glycine max [soybeans]
ref|XP_003579027.1|  PREDICTED: BURP domain-containing protein 3-...    138   1e-35   Brachypodium distachyon [annual false brome]
ref|XP_009151093.1|  PREDICTED: dehydration-responsive protein RD22     139   2e-35   Brassica rapa
gb|KJB55408.1|  hypothetical protein B456_009G074700                    135   2e-35   Gossypium raimondii
ref|XP_006394816.1|  hypothetical protein EUTSA_v10004736mg             136   2e-35   
emb|CDX80529.1|  BnaC07g29150D                                          138   3e-35   
ref|XP_002874271.1|  hypothetical protein ARALYDRAFT_489420             138   4e-35   Arabidopsis lyrata subsp. lyrata
emb|CDY19799.1|  BnaA09g04520D                                          137   5e-35   Brassica napus [oilseed rape]
ref|XP_009111670.1|  PREDICTED: dehydration-responsive protein RD...    137   5e-35   Brassica rapa
ref|XP_004498543.1|  PREDICTED: dehydration-responsive protein RD...    137   6e-35   Cicer arietinum [garbanzo]
ref|XP_010493823.1|  PREDICTED: dehydration-responsive protein RD...    137   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010910075.1|  PREDICTED: BURP domain-containing protein 3-...    134   1e-34   
sp|Q0JEP3.2|BURP5_ORYSJ  RecName: Full=BURP domain-containing pro...    135   1e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007211649.1|  hypothetical protein PRUPE_ppa008874mg             135   1e-34   
emb|CDX87079.1|  BnaC09g03940D                                          136   2e-34   
ref|XP_007015182.1|  Polygalacturonase, putative                        134   2e-34   
ref|XP_009763757.1|  PREDICTED: BURP domain-containing protein 5-...    135   2e-34   Nicotiana sylvestris
gb|AAQ57584.1|  BURP domain-containing protein                          136   2e-34   Brassica napus [oilseed rape]
emb|CAN83032.1|  hypothetical protein VITISV_006147                     134   2e-34   Vitis vinifera
ref|XP_003588551.1|  BURP domain-containing protein                     136   2e-34   Medicago truncatula
ref|XP_009598995.1|  PREDICTED: BURP domain-containing protein 3-...    135   2e-34   Nicotiana tomentosiformis
ref|XP_010493824.1|  PREDICTED: dehydration-responsive protein RD...    135   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006833278.1|  hypothetical protein AMTR_s00109p00021460          135   3e-34   Amborella trichopoda
ref|XP_010925840.1|  PREDICTED: BURP domain-containing protein 3-...    132   4e-34   
ref|NP_001052280.1|  Os04g0225700                                       134   5e-34   
ref|XP_007222322.1|  hypothetical protein PRUPE_ppa008080mg             134   5e-34   Prunus persica
ref|XP_007222614.1|  hypothetical protein PRUPE_ppa008481mg             134   6e-34   Prunus persica
gb|KFK27813.1|  hypothetical protein AALP_AA8G433300                    134   1e-33   Arabis alpina [alpine rockcress]
gb|EPS61992.1|  hypothetical protein M569_12801                         132   1e-33   Genlisea aurea
emb|CDY62417.1|  BnaA06g39340D                                          134   1e-33   Brassica napus [oilseed rape]
emb|CDP16140.1|  unnamed protein product                                131   2e-33   Coffea canephora [robusta coffee]
ref|XP_008219790.1|  PREDICTED: dehydration-responsive protein RD...    132   2e-33   
ref|XP_002522983.1|  polygalacturonase, putative                        131   5e-33   Ricinus communis
ref|XP_010999727.1|  PREDICTED: uncharacterized protein LOC105107486    130   6e-33   Populus euphratica
ref|XP_008219471.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    129   6e-33   Prunus mume [ume]
ref|XP_009353316.1|  PREDICTED: dehydration-responsive protein RD...    130   7e-33   Pyrus x bretschneideri [bai li]
gb|EAY93150.1|  hypothetical protein OsI_14956                          129   8e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_004233978.1|  PREDICTED: BURP domain-containing protein 5-...    130   9e-33   Solanum lycopersicum
ref|XP_008378148.1|  PREDICTED: dehydration-responsive protein RD...    130   9e-33   
ref|XP_009353333.1|  PREDICTED: BURP domain-containing protein 5-...    130   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_007226272.1|  hypothetical protein PRUPE_ppa019992mg             130   1e-32   
gb|KDP22142.1|  hypothetical protein JCGZ_25973                         130   1e-32   Jatropha curcas
emb|CAD39857.2|  OSJNBa0036B17.11                                       129   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006366573.1|  PREDICTED: BURP domain-containing protein 17...    130   2e-32   Solanum tuberosum [potatoes]
ref|XP_007225010.1|  hypothetical protein PRUPE_ppa020264mg             128   2e-32   
ref|XP_010454906.1|  PREDICTED: dehydration-responsive protein RD...    130   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006287907.1|  hypothetical protein CARUB_v10001141mg             130   3e-32   Capsella rubella
gb|KDP22140.1|  hypothetical protein JCGZ_25971                         132   3e-32   Jatropha curcas
ref|XP_006367868.1|  PREDICTED: BURP domain-containing protein 17...    129   3e-32   Solanum tuberosum [potatoes]
dbj|BAC22501.1|  resistant specific protein-3                           128   3e-32   Vigna radiata [mung bean]
ref|XP_010276358.1|  PREDICTED: dehydration-responsive protein RD...    129   4e-32   Nelumbo nucifera [Indian lotus]
ref|XP_008348420.1|  PREDICTED: dehydration-responsive protein RD...    128   4e-32   
ref|XP_009373564.1|  PREDICTED: dehydration-responsive protein RD...    130   4e-32   
ref|XP_008219773.1|  PREDICTED: dehydration-responsive protein RD...    128   4e-32   Prunus mume [ume]
ref|XP_007222162.1|  hypothetical protein PRUPE_ppa005767mg             130   5e-32   Prunus persica
ref|XP_007223280.1|  hypothetical protein PRUPE_ppa005535mg             130   5e-32   Prunus persica
ref|XP_009373563.1|  PREDICTED: dehydration-responsive protein RD...    130   5e-32   
ref|XP_004308362.1|  PREDICTED: dehydration-responsive protein RD...    128   5e-32   Fragaria vesca subsp. vesca
ref|XP_009373562.1|  PREDICTED: dehydration-responsive protein RD...    130   6e-32   Pyrus x bretschneideri [bai li]
ref|XP_010916769.1|  PREDICTED: BURP domain-containing protein 3-...    127   6e-32   Elaeis guineensis
emb|CDP18476.1|  unnamed protein product                                129   7e-32   Coffea canephora [robusta coffee]
ref|XP_008219789.1|  PREDICTED: dehydration-responsive protein RD...    128   8e-32   
ref|XP_007224167.1|  hypothetical protein PRUPE_ppa016850mg             126   1e-31   
ref|XP_009367978.1|  PREDICTED: dehydration-responsive protein RD...    127   1e-31   
ref|XP_006384368.1|  hypothetical protein POPTR_0004s14410g             127   2e-31   
gb|EPS64452.1|  hypothetical protein M569_10329                         127   2e-31   Genlisea aurea
ref|XP_006388650.1|  hypothetical protein POPTR_0129s00200g             127   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_007012035.1|  BURP domain-containing protein, putative           126   2e-31   
ref|XP_002325305.1|  embryonic abundant family protein                  127   2e-31   
ref|XP_004306763.1|  PREDICTED: BURP domain-containing protein 3-...    126   2e-31   Fragaria vesca subsp. vesca
ref|XP_008361049.1|  PREDICTED: dehydration-responsive protein RD...    126   3e-31   
ref|XP_007221811.1|  hypothetical protein PRUPE_ppa004101mg             126   4e-31   
ref|XP_006384370.1|  hypothetical protein POPTR_0004s14430g             126   4e-31   Populus trichocarpa [western balsam poplar]
emb|CDP21280.1|  unnamed protein product                                126   5e-31   Coffea canephora [robusta coffee]
ref|XP_010256408.1|  PREDICTED: BURP domain-containing protein 6-...    125   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_011016123.1|  PREDICTED: dehydration-responsive protein RD...    126   5e-31   Populus euphratica
ref|XP_006384367.1|  hypothetical protein POPTR_0004s14400g             125   6e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008245942.1|  PREDICTED: BURP domain-containing protein 3-...    125   7e-31   
emb|CDP21057.1|  unnamed protein product                                125   7e-31   Coffea canephora [robusta coffee]
ref|XP_008795038.1|  PREDICTED: BURP domain-containing protein 5-...    124   8e-31   Phoenix dactylifera
ref|XP_002522979.1|  polygalacturonase, putative                        124   1e-30   Ricinus communis
ref|XP_006370840.1|  hypothetical protein POPTR_0019s00670g             123   1e-30   
ref|XP_007224866.1|  hypothetical protein PRUPE_ppa022737mg             124   1e-30   
ref|XP_008245628.1|  PREDICTED: dehydration-responsive protein RD...    124   1e-30   
ref|XP_008367705.1|  PREDICTED: dehydration-responsive protein RD...    124   1e-30   
ref|XP_006366571.1|  PREDICTED: BURP domain-containing protein 3-...    124   1e-30   Solanum tuberosum [potatoes]
gb|KDP45576.1|  hypothetical protein JCGZ_17183                         126   2e-30   Jatropha curcas
ref|XP_011001236.1|  PREDICTED: dehydration-responsive protein RD...    124   2e-30   Populus euphratica
gb|KDP45575.1|  hypothetical protein JCGZ_17182                         126   2e-30   Jatropha curcas
ref|XP_008219787.1|  PREDICTED: dehydration-responsive protein RD...    124   2e-30   Prunus mume [ume]
ref|XP_002513544.1|  conserved hypothetical protein                     122   3e-30   
gb|AFI80905.1|  dehydration-responsive protein                          121   3e-30   Morus alba
ref|XP_004233980.2|  PREDICTED: BURP domain-containing protein 5-...    123   3e-30   Solanum lycopersicum
ref|XP_006387123.1|  hypothetical protein POPTR_1776s00200g             124   4e-30   
ref|XP_010999677.1|  PREDICTED: dehydration-responsive protein RD...    124   4e-30   Populus euphratica
ref|XP_010648537.1|  PREDICTED: dehydration-responsive protein RD...    120   4e-30   
ref|XP_008220015.1|  PREDICTED: BURP domain-containing protein 5-...    124   4e-30   Prunus mume [ume]
ref|XP_008219775.1|  PREDICTED: dehydration-responsive protein RD...    123   5e-30   Prunus mume [ume]
ref|XP_008780146.1|  PREDICTED: BURP domain-containing protein 3-...    121   8e-30   Phoenix dactylifera
ref|XP_007222784.1|  hypothetical protein PRUPE_ppa006620mg             123   1e-29   
gb|ABK96092.1|  unknown                                                 119   1e-29   
ref|XP_008219786.1|  PREDICTED: dehydration-responsive protein RD...    122   1e-29   
ref|XP_007221812.1|  hypothetical protein PRUPE_ppa004101mg             122   2e-29   
ref|XP_010648541.1|  PREDICTED: dehydration-responsive protein RD...    120   2e-29   
ref|XP_007225722.1|  hypothetical protein PRUPE_ppa006739mg             122   2e-29   
ref|XP_007221813.1|  hypothetical protein PRUPE_ppa004101mg             122   4e-29   
ref|XP_008219769.1|  PREDICTED: dehydration-responsive protein RD...    122   4e-29   
ref|XP_008245114.1|  PREDICTED: BURP domain-containing protein 5-...    121   4e-29   
gb|KDP22138.1|  hypothetical protein JCGZ_25969                         121   5e-29   
ref|XP_002522984.1|  Embryonic abundant protein USP87 precursor, ...    120   7e-29   
ref|XP_010648542.1|  PREDICTED: dehydration-responsive protein RD...    118   8e-29   
gb|KDP39097.1|  hypothetical protein JCGZ_00854                         119   8e-29   
ref|XP_002523253.1|  Polygalacturonase non-catalytic subunit AroG...    120   2e-28   
ref|XP_008220014.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...    119   2e-28   
gb|KDP22137.1|  hypothetical protein JCGZ_25968                         120   3e-28   
ref|XP_010648545.1|  PREDICTED: dehydration-responsive protein RD...    120   3e-28   
ref|XP_010648546.1|  PREDICTED: dehydration-responsive protein RD...    120   3e-28   
ref|XP_010256409.1|  PREDICTED: BURP domain-containing protein 6-...    118   3e-28   
ref|XP_009376258.1|  PREDICTED: BURP domain-containing protein 3-...    118   5e-28   
ref|XP_010648544.1|  PREDICTED: BURP domain-containing protein 12...    120   6e-28   
ref|NP_001054931.1|  Os05g0215000                                       116   6e-28   
ref|XP_010648543.1|  PREDICTED: BURP domain-containing protein 12...    120   6e-28   
ref|XP_002281706.3|  PREDICTED: BURP domain-containing protein 12...    120   7e-28   
ref|XP_002522978.1|  polygalacturonase, putative                        116   7e-28   
ref|XP_007225823.1|  hypothetical protein PRUPE_ppa011523mg             115   8e-28   
gb|EEE62752.1|  hypothetical protein OsJ_17555                          115   2e-27   
ref|XP_010999675.1|  PREDICTED: dehydration-responsive protein RD...    116   2e-27   
ref|XP_002522981.1|  polygalacturonase, putative                        115   3e-27   
ref|XP_010257624.1|  PREDICTED: BURP domain-containing protein 16...    117   3e-27   
ref|XP_010667737.1|  PREDICTED: dehydration-responsive protein RD...    115   5e-27   
ref|XP_009338714.1|  PREDICTED: dehydration-responsive protein RD...    112   5e-27   
ref|NP_001237833.1|  seed coat BURP domain protein 1 precursor          114   5e-27   
gb|ACU19518.1|  unknown                                                 114   6e-27   
ref|XP_010421423.1|  PREDICTED: dehydration-responsive protein RD...    115   6e-27   
gb|KHN10348.1|  Dehydration-responsive protein RD22                     115   8e-27   
gb|EAY96989.1|  hypothetical protein OsI_18912                          113   1e-26   
gb|KJB54860.1|  hypothetical protein B456_009G052200                    111   2e-26   
ref|XP_006653211.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...    113   2e-26   
gb|AES58805.2|  dehydration-responsive RD22-like protein                111   2e-26   
ref|XP_010106680.1|  BURP domain-containing protein 3                   111   7e-26   
gb|KJB55406.1|  hypothetical protein B456_009G074500                    110   2e-25   
ref|XP_007227727.1|  hypothetical protein PRUPE_ppa007469mg             110   3e-25   
ref|NP_001065861.1|  Os11g0170900                                       110   3e-25   
ref|XP_009598994.1|  PREDICTED: BURP domain-containing protein 3-...    110   3e-25   
ref|XP_002522730.1|  Polygalacturonase non-catalytic subunit AroG...    110   4e-25   
emb|CAN63066.1|  hypothetical protein VITISV_031225                     110   4e-25   
ref|XP_006361558.1|  PREDICTED: dehydration-responsive protein RD...    110   4e-25   
ref|XP_006361559.1|  PREDICTED: dehydration-responsive protein RD...    109   5e-25   
gb|EAY93151.1|  hypothetical protein OsI_14957                          108   5e-25   
ref|XP_003588546.1|  BURP domain-containing protein                     107   8e-25   
sp|B9G9L9.1|BURPH_ORYSJ  RecName: Full=BURP domain-containing pro...    111   9e-25   
gb|ABG76011.1|  RDB1                                                    111   1e-24   
ref|XP_006856199.1|  hypothetical protein AMTR_s00059p00191030          108   1e-24   
ref|XP_008220016.1|  PREDICTED: BURP domain-containing protein 3-...    104   1e-24   
gb|AAX95068.1|  BURP domain, putative                                   111   1e-24   
gb|AAT07562.1|  unknown protein                                         107   3e-24   
ref|XP_007226278.1|  hypothetical protein PRUPE_ppa019478mg             105   3e-24   
ref|XP_007226360.1|  hypothetical protein PRUPE_ppa022406mg             106   6e-24   
ref|XP_008245941.1|  PREDICTED: BURP domain-containing protein 3-...    105   6e-24   
sp|Q75G46.2|BURP8_ORYSJ  RecName: Full=BURP domain-containing pro...    106   7e-24   
ref|XP_008220020.1|  PREDICTED: BURP domain-containing protein 3-...    105   7e-24   
ref|XP_010919897.1|  PREDICTED: BURP domain-containing protein 3-...    104   1e-23   
ref|NP_001174278.1|  Os05g0215066                                       103   2e-23   
gb|AAT47026.1|  putative dehydration-responsive protein, contains...    103   3e-23   
ref|XP_002523250.1|  Dehydration-responsive protein RD22 precurso...    104   3e-23   
gb|EEE62766.1|  hypothetical protein OsJ_17569                          104   3e-23   
ref|NP_001054938.1|  Os05g0217800                                       103   5e-23   
gb|AFW85141.1|  hypothetical protein ZEAMMB73_186505                  97.8    1e-22   
ref|XP_004239211.1|  PREDICTED: dehydration-responsive protein RD22     102   1e-22   
dbj|BAG97564.1|  unnamed protein product                                101   2e-22   
ref|XP_008347810.1|  PREDICTED: dehydration-responsive protein RD...    102   3e-22   
ref|XP_008795079.1|  PREDICTED: BURP domain-containing protein 3-...    100   3e-22   
gb|ACF84595.1|  unknown                                               99.4    5e-22   
ref|XP_002306019.2|  embryonic abundant family protein                99.4    5e-22   
ref|XP_009758896.1|  PREDICTED: dehydration-responsive protein RD...    101   5e-22   
ref|XP_010648540.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...  98.2    6e-22   
gb|AFW85139.1|  hypothetical protein ZEAMMB73_186505                  99.0    7e-22   
ref|XP_011014851.1|  PREDICTED: dehydration-responsive protein RD...  98.2    1e-21   
ref|XP_002509472.1|  Dehydration-responsive protein RD22 precurso...  99.4    2e-21   
ref|XP_004299100.1|  PREDICTED: BURP domain-containing protein 3-...  99.0    2e-21   
gb|ACN40822.1|  unknown                                               99.4    2e-21   
gb|ABK24138.1|  unknown                                               99.4    3e-21   
emb|CAN83862.1|  hypothetical protein VITISV_030280                   97.4    3e-21   
ref|XP_003606871.1|  BURP domain-containing protein                   98.6    3e-21   
gb|AFK43537.1|  unknown                                               98.6    4e-21   
ref|XP_011092776.1|  PREDICTED: BURP domain-containing protein 17...  98.2    5e-21   
gb|KHG19017.1|  BURP domain-containing 17                             98.2    5e-21   
ref|XP_010916768.1|  PREDICTED: BURP domain-containing protein 6-...  98.2    6e-21   
gb|KJB77707.1|  hypothetical protein B456_012G152100                  97.8    6e-21   
gb|EMT27384.1|  hypothetical protein F775_07291                       99.0    7e-21   
ref|XP_010667726.1|  PREDICTED: BURP domain-containing protein 2-...  99.0    7e-21   
ref|XP_006852098.1|  hypothetical protein AMTR_s00041p00237820        95.5    8e-21   
gb|KHN10347.1|  Dehydration-responsive protein RD22                   96.7    1e-20   
ref|XP_008451378.1|  PREDICTED: BURP domain-containing protein 5-...  96.7    1e-20   
ref|XP_007136175.1|  hypothetical protein PHAVU_009G024400g           97.1    1e-20   
ref|XP_003537889.1|  PREDICTED: BURP domain-containing protein 3-...  97.1    1e-20   
ref|XP_010648808.1|  PREDICTED: dehydration-responsive protein RD...  94.7    2e-20   
gb|KJB55407.1|  hypothetical protein B456_009G074600                  95.5    2e-20   
ref|XP_007131847.1|  hypothetical protein PHAVU_011G046300g           96.7    2e-20   
gb|EPS58065.1|  hypothetical protein M569_16751                       95.5    2e-20   
ref|XP_003603899.1|  BURP domain-containing protein                   96.7    2e-20   
ref|XP_006852093.1|  hypothetical protein AMTR_s00041p00236870        95.1    2e-20   
ref|XP_009798351.1|  PREDICTED: BURP domain-containing protein 3-...  96.3    3e-20   
ref|XP_010667716.1|  PREDICTED: BURP domain-containing protein 3-...  97.1    5e-20   
emb|CDP18473.1|  unnamed protein product                              94.0    5e-20   
gb|ACU24326.1|  unknown                                               95.1    6e-20   
ref|XP_006578620.1|  PREDICTED: BURP domain-containing protein 9-...  97.4    6e-20   
ref|XP_007041485.1|  Uncharacterized protein TCM_006381               94.7    8e-20   
ref|XP_004507419.1|  PREDICTED: BURP domain-containing protein 3-...  94.4    9e-20   
gb|AIS71928.1|  BURP domain-containing protein 17                     94.7    1e-19   
ref|XP_006856048.1|  hypothetical protein AMTR_s00059p00084450        94.7    1e-19   
ref|XP_010317369.1|  PREDICTED: dehydration-responsive protein RD...  93.6    1e-19   
gb|KHN33762.1|  BURP domain-containing protein 17                     94.7    1e-19   
gb|KJB21815.1|  hypothetical protein B456_004G015400                  93.2    1e-19   
gb|ACU20119.1|  unknown                                               94.4    1e-19   
ref|XP_004230918.1|  PREDICTED: BURP domain-containing protein 5-...  95.1    1e-19   
ref|XP_010098486.1|  hypothetical protein L484_025922                 94.4    1e-19   
gb|KJB21816.1|  hypothetical protein B456_004G015500                  93.6    2e-19   
ref|XP_006856058.1|  hypothetical protein AMTR_s00059p00096660        94.7    2e-19   
ref|XP_007042224.1|  Uncharacterized protein isoform 1                94.0    2e-19   
ref|XP_007015179.1|  BURP domain-containing protein, putative         92.8    2e-19   
ref|XP_007042225.1|  Uncharacterized protein isoform 2                93.6    2e-19   
ref|XP_009607060.1|  PREDICTED: BURP domain-containing protein 3-...  94.0    2e-19   
ref|XP_007042226.1|  Uncharacterized protein isoform 3                93.6    2e-19   
gb|KJB55405.1|  hypothetical protein B456_009G074500                  92.4    3e-19   
ref|XP_008795078.1|  PREDICTED: BURP domain-containing protein 5-...  92.8    3e-19   
ref|XP_006365521.1|  PREDICTED: BURP domain-containing protein 3-...  93.6    3e-19   
ref|XP_006856051.1|  hypothetical protein AMTR_s00059p00088650        94.4    4e-19   
ref|XP_006852074.1|  hypothetical protein AMTR_s00041p00232840        90.5    4e-19   
gb|KDO46196.1|  hypothetical protein CISIN_1g023233mg                 92.4    5e-19   
ref|XP_006423230.1|  hypothetical protein CICLE_v10028994mg           92.4    5e-19   
dbj|BAC22498.1|  resistant specific protein-1(4)                      93.2    5e-19   
ref|XP_006419189.1|  hypothetical protein CICLE_v10030447mg           91.7    5e-19   
ref|XP_006423241.1|  hypothetical protein CICLE_v10029064mg           92.0    7e-19   
ref|XP_006487162.1|  PREDICTED: BURP domain-containing protein 17...  91.7    7e-19   
ref|XP_006487170.1|  PREDICTED: BURP domain-containing protein 17...  91.7    8e-19   
ref|XP_006487164.1|  PREDICTED: BURP domain-containing protein 17...  91.7    8e-19   
ref|XP_010687934.1|  PREDICTED: BURP domain-containing protein 5-...  92.0    8e-19   
ref|XP_006592108.1|  PREDICTED: putative GPI-anchored protein PB1...  93.6    1e-18   
ref|XP_006592107.1|  PREDICTED: putative GPI-anchored protein PB1...  94.0    1e-18   
ref|XP_007200499.1|  hypothetical protein PRUPE_ppa009236mg           91.3    1e-18   
ref|XP_002313055.2|  hypothetical protein POPTR_0009s11720g           91.3    1e-18   
ref|XP_010028578.1|  PREDICTED: BURP domain-containing protein 17     91.3    1e-18   
ref|XP_006852089.1|  hypothetical protein AMTR_s00041p00236010        89.7    1e-18   
ref|XP_006423236.1|  hypothetical protein CICLE_v10029053mg           90.9    1e-18   
emb|CBI20903.3|  unnamed protein product                              88.6    2e-18   
ref|XP_010106056.1|  hypothetical protein L484_021234                 90.9    2e-18   
ref|XP_003631639.1|  PREDICTED: BURP domain-containing protein 3-...  90.9    2e-18   
ref|XP_010096192.1|  hypothetical protein L484_026926                 90.9    2e-18   
ref|XP_010479365.1|  PREDICTED: dehydration-responsive protein RD...  90.9    2e-18   
dbj|BAP00548.1|  BURP domain-containing protein 17-like               90.9    2e-18   
emb|CAN74522.1|  hypothetical protein VITISV_034298                   90.9    2e-18   
ref|XP_008363539.1|  PREDICTED: BURP domain-containing protein 5-...  90.9    2e-18   
ref|XP_010461769.1|  PREDICTED: dehydration-responsive protein RD...  90.5    2e-18   
ref|XP_002534535.1|  Dehydration-responsive protein RD22 precurso...  89.7    2e-18   
ref|XP_010479366.1|  PREDICTED: dehydration-responsive protein RD...  90.5    2e-18   
dbj|BAC22500.1|  resistant specific protein-2                         92.0    2e-18   
ref|XP_011048751.1|  PREDICTED: BURP domain-containing protein 3-...  90.5    3e-18   
gb|KDP44387.1|  hypothetical protein JCGZ_20067                       90.1    3e-18   
gb|AJK93577.1|  RD22-like dehydration-responsive protein              89.4    5e-18   
ref|XP_010690912.1|  PREDICTED: BURP domain-containing protein 3-...  89.7    5e-18   
ref|XP_009368020.1|  PREDICTED: dehydration-responsive protein RD...  87.8    5e-18   
ref|XP_009793625.1|  PREDICTED: BURP domain-containing protein 5-...  90.1    5e-18   
gb|AFM91994.1|  RD-22 like protein                                    88.2    6e-18   
ref|XP_003527234.1|  PREDICTED: BURP domain-containing protein 17...  89.4    7e-18   
ref|XP_008236992.1|  PREDICTED: BURP domain-containing protein 3-...  89.0    9e-18   
ref|XP_010500474.1|  PREDICTED: protein RAFTIN 1B-like isoform X1     88.6    9e-18   
ref|XP_004500819.1|  PREDICTED: BURP domain-containing protein 17...  88.6    1e-17   
ref|XP_002306096.2|  hypothetical protein POPTR_0004s16050g           88.6    1e-17   
gb|KHN14854.1|  BURP domain-containing protein 3                      88.6    2e-17   
gb|KDP46236.1|  hypothetical protein JCGZ_10076                       88.2    2e-17   
ref|XP_004500818.1|  PREDICTED: BURP domain-containing protein 17...  87.8    2e-17   
emb|CDY48091.1|  BnaC06g02550D                                        87.8    2e-17   
ref|XP_011037546.1|  PREDICTED: BURP domain-containing protein 17     87.8    2e-17   
ref|XP_004168785.1|  PREDICTED: BURP domain-containing protein 17...  87.8    2e-17   
ref|XP_006356636.1|  PREDICTED: BURP domain-containing protein 3-...  86.7    2e-17   
emb|CDP14224.1|  unnamed protein product                              87.4    3e-17   
ref|XP_006856045.1|  hypothetical protein AMTR_s00059p00081630        87.0    3e-17   
emb|CBI20920.3|  unnamed protein product                              85.1    4e-17   
ref|XP_006304086.1|  hypothetical protein CARUB_v10009955mg           86.7    4e-17   
ref|XP_007136178.1|  hypothetical protein PHAVU_009G024700g           87.4    5e-17   
ref|NP_001149504.1|  RAFTIN1a protein precursor                       88.6    5e-17   
tpg|DAA47822.1|  TPA: RAFTIN1a protein                                88.6    6e-17   
gb|AFM91993.1|  RD-22 like protein                                    84.7    6e-17   
ref|XP_007200547.1|  hypothetical protein PRUPE_ppa009549mg           86.3    7e-17   
gb|KFK36020.1|  hypothetical protein AALP_AA4G067500                  85.9    8e-17   
ref|XP_007200280.1|  hypothetical protein PRUPE_ppa014595mg           85.9    9e-17   
ref|XP_002313054.2|  hypothetical protein POPTR_0009s11750g           85.9    9e-17   
gb|KJB32790.1|  hypothetical protein B456_005G261700                  85.5    1e-16   
ref|XP_004148853.1|  PREDICTED: BURP domain-containing protein 17...  85.5    1e-16   
gb|AFM91998.1|  RD-22 like protein                                    84.3    1e-16   
tpg|DAA47824.1|  TPA: hypothetical protein ZEAMMB73_194863            87.4    1e-16   
gb|ABK96114.1|  unknown                                               85.5    1e-16   
ref|XP_010248291.1|  PREDICTED: dehydration-responsive protein RD...  85.1    1e-16   
emb|CDP01516.1|  unnamed protein product                              85.5    1e-16   
ref|XP_009375835.1|  PREDICTED: BURP domain-containing protein 17...  85.1    1e-16   
ref|XP_009374194.1|  PREDICTED: BURP domain-containing protein 17...  85.1    2e-16   
ref|XP_003603451.1|  BURP domain-containing protein                   84.7    2e-16   
gb|AES73702.2|  dehydration-responsive RD22-like protein              84.7    2e-16   
gb|AFM91990.1|  RD-22 like protein                                    84.0    2e-16   
ref|XP_006660247.1|  PREDICTED: BURP domain-containing protein 13...  85.1    2e-16   
ref|XP_004230963.1|  PREDICTED: BURP domain-containing protein 5-...  84.7    2e-16   
ref|XP_008387386.1|  PREDICTED: BURP domain-containing protein 3-...  84.7    2e-16   
ref|XP_007015178.1|  BURP domain-containing protein, putative         86.3    2e-16   
gb|KGN44336.1|  hypothetical protein Csa_7G259360                     84.3    2e-16   
ref|NP_175357.1|  BURP domain protein USPL1                           84.3    3e-16   
ref|XP_008457931.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...  84.3    3e-16   
ref|XP_006851950.1|  hypothetical protein AMTR_s00041p00183830        83.6    3e-16   
ref|XP_002519076.1|  Dehydration-responsive protein RD22 precurso...  83.6    4e-16   
ref|XP_009147906.1|  PREDICTED: dehydration-responsive protein RD...  84.0    4e-16   
emb|CDY48863.1|  BnaA06g03190D                                        84.0    4e-16   
dbj|BAM13313.1|  RAFTIN 1                                             85.1    4e-16   
dbj|BAM13312.1|  RAFTIN 1                                             85.1    4e-16   
gb|ACO54862.1|  BURP domain protein                                   83.6    5e-16   
ref|XP_011048729.1|  PREDICTED: BURP domain-containing protein 3-...  83.6    5e-16   
emb|CDP21421.1|  unnamed protein product                              83.6    6e-16   
ref|XP_002891490.1|  BURP domain-containing protein                   83.6    6e-16   
ref|XP_006852085.1|  hypothetical protein AMTR_s00041p00235210        81.6    7e-16   
ref|XP_008447041.1|  PREDICTED: BURP domain-containing protein 5-...  83.6    7e-16   
gb|KHN25362.1|  Protein RAFTIN 1B                                     82.4    8e-16   



>ref|XP_003603599.1| BURP domain protein [Medicago truncatula]
 gb|AES73850.1| dehydration-responsive protein RD22 [Medicago truncatula]
Length=322

 Score =   204 bits (518),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 134/205 (65%), Gaps = 25/205 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            M++ LL +F++L++ +VA HAAL PE YWKSV+P TPMP A+ D L        ST  GV
Sbjct  1    MDYPLLPVFTILNLVLVATHAALPPELYWKSVLPTTPMPKAITDILHPGWMEDKSTNVGV  60

Query  206  GKVGVTPNAIL----------------FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQM  337
            GK GV+ NA                  F Y  AATE QLHDDP  ALFF + DL  G +M
Sbjct  61   GK-GVSVNAGHKRKGKPATVVVGPHSPFAYNYAATETQLHDDPRAALFFLEKDLHPGTKM  119

Query  338  KLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAM  517
             L+F ++SN ATFLPR  A   PFS+ KL  I ++FS+ P+S+EA VMK T+EECE  A+
Sbjct  120  DLNFIRSSNVATFLPRQVASATPFSSEKLSHIFNKFSVKPESEEAHVMKNTIEECEDAAI  179

Query  518  MGEEKLCATSLESMVDFSVSQLGKN  592
             GEEK CATSLESMVDFS+S+LGK 
Sbjct  180  QGEEKYCATSLESMVDFSISKLGKR  204



>ref|NP_001235949.1| BURP domain protein precursor [Glycine max]
 gb|ACM47360.1| BURP domain protein [Glycine max]
Length=343

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 135/228 (59%), Gaps = 47/228 (21%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            ME++LL IF+LL++A+VA HAAL PE YWKSV+P TPMP A+ D L        ST+  V
Sbjct  1    MEYRLLPIFTLLNLALVAIHAALPPEVYWKSVLPTTPMPKAITDILYPDWVEEKSTSVNV  60

Query  206  GKVGVTPNA--------------------------------------ILFIYTDAATEDQ  271
            G  GV  +A                                        F Y  A+TE Q
Sbjct  61   GGKGVNVHAGKGGGGTNVNVGGKGSGGGVNVHAGHKGKPVHVSVGSKSPFNYIYASTETQ  120

Query  272  LHDDPNVALFFKKNDLQQGNQMKLHFTKTSN-AATFLPRSAAGKIPFSAVKLPQILSRFS  448
            LHDDPNVALFF + DL  G ++ LHFT +SN  ATFLPR  A  IPFS+ K+  + ++FS
Sbjct  121  LHDDPNVALFFLEKDLHPGTKLNLHFTTSSNIQATFLPRQVADSIPFSSSKVEVVFNKFS  180

Query  449  LSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            + P S+EAQ+MK TL ECE   + GEEK CATSLESM+DFS S+LGKN
Sbjct  181  VKPGSEEAQIMKNTLSECEEGGIKGEEKYCATSLESMIDFSTSKLGKN  228



>gb|ACU21473.1| unknown [Glycine max]
 gb|KHN18208.1| Dehydration-responsive protein RD22 [Glycine soja]
Length=343

 Score =   194 bits (493),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 135/228 (59%), Gaps = 47/228 (21%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            ME++LL IF+LL++A+VA HAAL PE YWKSV+P TPMP A+ D L        ST+  V
Sbjct  1    MEYRLLPIFTLLNLALVAIHAALPPEVYWKSVLPTTPMPKAITDILYPDWVEEKSTSVNV  60

Query  206  GKVGVTPNA--------------------------------------ILFIYTDAATEDQ  271
            G  GV  +A                                        F Y  A+TE Q
Sbjct  61   GGKGVNVHAGKGGGGTNVNVGGKGSGGGVNVHAGHKGKPVHVSVGSKSPFNYIYASTETQ  120

Query  272  LHDDPNVALFFKKNDLQQGNQMKLHFTKTSN-AATFLPRSAAGKIPFSAVKLPQILSRFS  448
            LHDDPNVALFF + DL  G ++ LHFT +SN  ATFLPR  A  IPFS+ K+  + ++FS
Sbjct  121  LHDDPNVALFFLEKDLHPGTKLNLHFTTSSNIQATFLPRQVADSIPFSSSKVEVVFNKFS  180

Query  449  LSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            + P S+EAQ+MK TL ECE   + GEEK CATSLESM+DFS S+LGKN
Sbjct  181  VKPGSEEAQIMKNTLSECEEGGIKGEEKYCATSLESMIDFSTSKLGKN  228



>gb|ACV60360.1| RD22-like protein [Camellia sinensis]
Length=337

 Score =   194 bits (493),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 137/225 (61%), Gaps = 44/225 (20%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STA---  196
            MEF  L I + LS+ +VA HA LSPE YW S++PN+PMP AVKD L        STA   
Sbjct  1    MEFHFLPILAFLSLTLVASHATLSPEAYWNSILPNSPMPSAVKDLLHPEWMEDKSTAVGV  60

Query  197  --------GGVGK-------------------------VGVTPNAILFIYTDAATEDQLH  277
                     G GK                         VGV+     F+Y  AAT DQLH
Sbjct  61   GKGGVGVDAGQGKPGGTSVGVGKGGVSVNTGKKGKPVYVGVSKGPSPFVYHYAATADQLH  120

Query  278  DDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSP  457
            D+PN+ALFF +NDL++  +M LHFTKT+   TFLPR  A KIPFS+ K+PQIL  FS+ P
Sbjct  121  DNPNIALFFLENDLKKYTKMTLHFTKTTTPTTFLPRQVAEKIPFSSKKIPQILDYFSVKP  180

Query  458  DSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            +S EA+ +K+T++ECE P + GEEK CATSLESMVDF  ++LGK+
Sbjct  181  NSMEAKTIKQTIKECEEPGIKGEEKYCATSLESMVDFCSTRLGKS  225



>gb|ACH97124.1| BURP domain-containing protein [Camellia sinensis]
Length=337

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 137/225 (61%), Gaps = 44/225 (20%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STA---  196
            MEF  L I + LS+ +VA HA LSPE YW SV+PN+PMP AVKD L        STA   
Sbjct  1    MEFHFLPILAFLSLTLVASHATLSPEAYWNSVLPNSPMPTAVKDLLHPEWMEDKSTAVGV  60

Query  197  --------GGVGK-------------------------VGVTPNAILFIYTDAATEDQLH  277
                     G GK                         VGV+     F+Y  AAT DQLH
Sbjct  61   GKGGVGVDAGQGKPGGTSVGVGKGGVSVNTGKKGKPVSVGVSKGPNPFLYKYAATADQLH  120

Query  278  DDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSP  457
            D+PN+ALFF +NDL++  +M LHFTKT+   TFLPR  A KIPFS+ K+PQIL  FS+ P
Sbjct  121  DNPNIALFFLENDLKKYTKMTLHFTKTTTPTTFLPRQVAEKIPFSSKKIPQILDYFSVKP  180

Query  458  DSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            +S EA+ +K+T++ECE P + GEEK CATSLESMVDF  ++LGK+
Sbjct  181  NSMEAKTIKQTIKECEEPGIKGEEKYCATSLESMVDFCSTRLGKS  225



>ref|XP_007012037.1| BURP domain-containing protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY29656.1| BURP domain-containing protein, putative isoform 2 [Theobroma 
cacao]
Length=337

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 129/226 (57%), Gaps = 47/226 (21%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLS-------------  190
            MEF L  + + L++AVV  HAALSPE YW  V+PNTPMP AVK  L              
Sbjct  1    MEFNLSPVLAFLALAVVVSHAALSPEQYWNYVLPNTPMPKAVKVLLHPDFMENKGTSVNV  60

Query  191  -------------------------------TAGGVGK-VGVTPNAILFIYTDAATEDQL  274
                                             G  GK V V P    FIY  AATE Q+
Sbjct  61   GGGGVNVNTGKGKPGGGTSVNVGGKGGGVSVNTGHKGKPVYVNPGG--FIYNYAATETQV  118

Query  275  HDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLS  454
            HDDPNVALFF + D+     M LHFT+ +  ATFLPR  A KIPFS+ KLP+IL +FS+ 
Sbjct  119  HDDPNVALFFLEKDMHPRATMTLHFTENTETATFLPRQIAQKIPFSSDKLPEILKKFSVK  178

Query  455  PDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            P S EA++MK T++ECE P + GE+K CATSLESM+DFS S++GKN
Sbjct  179  PGSAEAEIMKNTIKECEQPQIQGEDKYCATSLESMIDFSTSKIGKN  224



>ref|XP_007012036.1| BURP domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY29655.1| BURP domain-containing protein isoform 1 [Theobroma cacao]
Length=345

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 130/234 (56%), Gaps = 55/234 (24%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGV--------  205
            MEF L  + + L++AVV  HAALSPE YW  V+PNTPMP AVK  L    G+        
Sbjct  1    MEFNLSPVLAFLALAVVVSHAALSPEQYWNYVLPNTPMPKAVKVLLHPGKGMEYMFYFME  60

Query  206  --------------------------------------------GK-VGVTPNAILFIYT  250
                                                        GK V V P    FIY 
Sbjct  61   NKGTSVNVGGGGVNVNTGKGKPGGGTSVNVGGKGGGVSVNTGHKGKPVYVNPGG--FIYN  118

Query  251  DAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQ  430
             AATE Q+HDDPNVALFF + D+     M LHFT+ +  ATFLPR  A KIPFS+ KLP+
Sbjct  119  YAATETQVHDDPNVALFFLEKDMHPRATMTLHFTENTETATFLPRQIAQKIPFSSDKLPE  178

Query  431  ILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            IL +FS+ P S EA++MK T++ECE P + GE+K CATSLESM+DFS S++GKN
Sbjct  179  ILKKFSVKPGSAEAEIMKNTIKECEQPQIQGEDKYCATSLESMIDFSTSKIGKN  232



>ref|XP_011081829.1| PREDICTED: dehydration-responsive protein RD22 [Sesamum indicum]
Length=361

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/248 (44%), Positives = 135/248 (54%), Gaps = 67/248 (27%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVK-----------DSLSTA  196
            MEF  L + + LSV +VA HAAL  E YWKSV+PN+PMP AVK           D  +T 
Sbjct  1    MEFNFLHVLAFLSVVIVATHAALPSEDYWKSVLPNSPMPKAVKDVLHPAPHWLDDKSTTV  60

Query  197  G----------------------------------------GVGKVGVT-----------  223
            G                                        G+GK GV+           
Sbjct  61   GVSKGGVRVNTGRGKPGGTGVYVGRGGVGVHTGKPGSRTNVGIGKGGVSVGTGTRKGKPV  120

Query  224  -----PNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRS  388
                 P    F Y  AATE Q+HD+PNVALFF + DL  G +M L F+K++N ATFLPR 
Sbjct  121  YVRVKPGPDPFNYLYAATETQMHDNPNVALFFLEKDLHIGKRMSLRFSKSTNEATFLPRQ  180

Query  389  AAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDF  568
             A  IPFS+ KLP+IL +FS++P S EA+ +KKT++ECE   + GEEK CATSLESMVDF
Sbjct  181  VADSIPFSSNKLPEILDKFSVNPGSDEAEAIKKTIKECEEKGIKGEEKFCATSLESMVDF  240

Query  569  SVSQLGKN  592
            S S+LGK+
Sbjct  241  STSKLGKD  248



>ref|XP_003522684.1| PREDICTED: dehydration-responsive protein RD22-like [Glycine 
max]
Length=341

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 134/228 (59%), Gaps = 47/228 (21%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLST------------  193
            ME++LL IF+LL++A+VA HAAL PE YWKSV+P TPMP A+ D L +            
Sbjct  1    MEYRLLPIFTLLNIALVATHAALPPEVYWKSVLPTTPMPKAITDILYSDWVEEKSSSVHV  60

Query  194  --------------------------------AGGVGK-VGVTPNAIL-FIYTDAATEDQ  271
                                            AG  GK V V+  +   F Y  AATE Q
Sbjct  61   GGGGVNVHTGKGGGSGTTVNVGGKGGGGVNVHAGHKGKPVHVSVGSKSPFDYVYAATETQ  120

Query  272  LHDDPNVALFFKKNDLQQGNQMKLHFTK-TSNAATFLPRSAAGKIPFSAVKLPQILSRFS  448
            LHDDPNVALFF + DL  G ++ LHFT+ TSN ATFL R  A  IPFS+ K+  I ++FS
Sbjct  121  LHDDPNVALFFLEKDLHSGTKLDLHFTRSTSNQATFLSRQVADSIPFSSNKVDFIFNKFS  180

Query  449  LSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            + P S+EAQ+MK T+ ECE   + GEEK CATSLESMVDFS S+LG N
Sbjct  181  VKPGSEEAQIMKNTISECEEGGIKGEEKYCATSLESMVDFSTSKLGNN  228



>gb|KHN10237.1| Dehydration-responsive protein RD22 [Glycine soja]
Length=341

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 134/228 (59%), Gaps = 47/228 (21%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLST------------  193
            ME++LL IF+LL++A+VA HAAL PE YWKSV+P TPMP A+ D L +            
Sbjct  1    MEYRLLPIFTLLNIALVATHAALPPEVYWKSVLPTTPMPKAITDILYSDWVEEKSSSVHV  60

Query  194  --------------------------------AGGVGK-VGVTPNAIL-FIYTDAATEDQ  271
                                            AG  GK V V+  +   F Y  AATE Q
Sbjct  61   GGGGVNVHTGKGGGSGTTVNVGGKGGGGVNVHAGHKGKPVHVSVGSKSPFDYVYAATETQ  120

Query  272  LHDDPNVALFFKKNDLQQGNQMKLHFTK-TSNAATFLPRSAAGKIPFSAVKLPQILSRFS  448
            LHDDPNVALFF + DL  G ++ LHFT+ TSN ATFL R  A  IPFS+ K+  I ++FS
Sbjct  121  LHDDPNVALFFLEKDLHSGTKLDLHFTRSTSNQATFLSRQVADSIPFSSNKVDFIFNKFS  180

Query  449  LSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            + P S+EAQ+MK T+ ECE   + GEEK CATSLESMVDFS S+LG N
Sbjct  181  VKPGSEEAQIMKNTISECEEGGIKGEEKYCATSLESMVDFSTSKLGNN  228



>gb|ACU19496.1| unknown [Glycine max]
Length=341

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 133/228 (58%), Gaps = 47/228 (21%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLST------------  193
            ME++LL IF+LL++A+VA HAAL PE YWKSV+P TPMP A+ D L +            
Sbjct  1    MEYRLLPIFTLLNIALVATHAALPPEAYWKSVLPTTPMPKAITDILYSDWVEEKSSSVHV  60

Query  194  --------------------------------AGGVGK-VGVTPNAIL-FIYTDAATEDQ  271
                                            AG  GK V V+  +   F Y  AATE Q
Sbjct  61   GGGGVNVHTGKGGGSGTTVNVGGKGGGGVNVHAGHKGKPVHVSVGSKSPFDYVYAATETQ  120

Query  272  LHDDPNVALFFKKNDLQQGNQMKLHFTK-TSNAATFLPRSAAGKIPFSAVKLPQILSRFS  448
             HDDPNVALFF + DL  G ++ LHFT+ TSN ATFL R  A  IPFS+ K+  I ++FS
Sbjct  121  FHDDPNVALFFLEKDLHSGTKLDLHFTRSTSNQATFLSRQVADSIPFSSNKVDFIFNKFS  180

Query  449  LSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            + P S+EAQ+MK T+ ECE   + GEEK CATSLESMVDFS S+LG N
Sbjct  181  VKPGSEEAQIMKNTISECEEGGIKGEEKYCATSLESMVDFSTSKLGNN  228



>ref|XP_010667774.1| PREDICTED: dehydration-responsive protein RD22-like [Beta vulgaris 
subsp. vulgaris]
Length=332

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 132/214 (62%), Gaps = 36/214 (17%)
 Frame = +2

Query  56   FQLLGIFSLLSVAV-VACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGG----------  202
            F+LL IF+ L VA+ V C AA S E YWK ++PNT MP  + +SL + GG          
Sbjct  6    FRLLTIFAFLFVALGVTCLAAQSSEDYWKKLLPNTVMPKTIHESLKSEGGTGVHVGNQGV  65

Query  203  ---------------VGKVG---------VTPNAILFIYTDAATEDQLHDDPNVALFFKK  310
                           VGK G         V P    FIY  AAT+ QL  + NVALFF++
Sbjct  66   DVSVGKPGTGSTDVHVGKGGPKGKHTSVYVHPKGNPFIYQYAATKTQLQANQNVALFFQE  125

Query  311  NDLQQGNQMKLHFTKTSNAAT-FLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKK  487
             DL+ G QM LHFTKT+N  T FLPR     IPFS  K+P+ILSRF ++PDS+EA+VMK+
Sbjct  126  KDLKLGTQMNLHFTKTTNNETPFLPRKIVESIPFSTEKMPEILSRFEVAPDSEEAKVMKE  185

Query  488  TLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            T++ECEA  + GEEK CATSLESMVD++ S+LGK
Sbjct  186  TIKECEAKGIEGEEKYCATSLESMVDYATSKLGK  219



>ref|WP_039311086.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91152.1| hypothetical protein QW71_36310 [Paenibacillus sp. IHB B 3415]
Length=221

 Score =   183 bits (464),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 128/199 (64%), Gaps = 19/199 (10%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STA---  196
            MEF  L I + LS+ +VA HA LSPE YW SV+PN+PMP AVKD L        STA   
Sbjct  1    MEFHFLPILAFLSLTLVASHATLSPEAYWNSVLPNSPMPTAVKDLLHPEWMEDKSTAVGV  60

Query  197  --------GGVGKVGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFT  352
                     G GK G T   +      AAT DQLHD+PN+ALFF +NDL++  +M LHFT
Sbjct  61   GKGGVGVDAGQGKPGGTSVGVGKGGVYAATADQLHDNPNIALFFLENDLKKYTKMTLHFT  120

Query  353  KTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEK  532
            KT+   TFLPR  A KIPFS+ K+PQIL  FS+ P+S EA+ +K+T++ECE P + GEEK
Sbjct  121  KTTTPTTFLPRQVAEKIPFSSKKIPQILDYFSVKPNSMEAKTIKQTIKECEEPGIKGEEK  180

Query  533  LCATSLESMVDFSVSQLGK  589
             CATSLES    +V  LGK
Sbjct  181  YCATSLESWSISAVPGLGK  199



>ref|XP_010925839.1| PREDICTED: BURP domain-containing protein 3-like [Elaeis guineensis]
Length=280

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 116/165 (70%), Gaps = 12/165 (7%)
 Frame = +2

Query  92   AVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAILFIYTDAATEDQ  271
            AV AC AAL  + YW SV+PNTPMP A+ D+           + P+ +  + T AATE Q
Sbjct  14   AVGACRAALPADLYWNSVLPNTPMPSAISDA-----------IRPDVMANMKT-AATEAQ  61

Query  272  LHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSL  451
            + +DP  ALFF + DL+ G +M LHFT+T++AATFLPR AA  IPFS+ KLP +L+R S+
Sbjct  62   VQEDPAAALFFIEKDLRPGARMTLHFTRTTSAATFLPRKAADSIPFSSAKLPAVLARLSI  121

Query  452  SPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
             P+S +AQ MKKTL ECE PA+ GE KLCATSLESMV+FS S LG
Sbjct  122  DPNSNKAQAMKKTLHECEEPAIDGETKLCATSLESMVEFSTSSLG  166



>ref|NP_001267970.1| rd22-c protein precursor [Vitis vinifera]
 gb|ACP40551.1| RD22 [Vitis vinifera]
Length=337

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 132/226 (58%), Gaps = 47/226 (21%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF LL I + L +A+ + HA L  E YW S++PNTPMP +++D L        S++  V
Sbjct  1    MEFHLLPILAFLCLALTS-HAVLPSEVYWNSMLPNTPMPKSIRDVLRPDLVEDKSSSVDV  59

Query  206  GK-------------------------------------VGVTPNAILFIYTDAATEDQL  274
            GK                                     VGVTP    F Y  AATEDQL
Sbjct  60   GKGGVNVDAGQGKPGGGTNVGVGKGGVSVNTGHKGKPVYVGVTPGPSPFTYKYAATEDQL  119

Query  275  HDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLS  454
            H DP+VALFF + D++ G +M LHF K +  ATFLP+S    I FS+ KLP+IL  FS+ 
Sbjct  120  HADPSVALFFMEKDMRPGTKMNLHFIKNTKEATFLPQSEHPII-FSSEKLPEILKHFSVK  178

Query  455  PDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            P+S EAQ++K T++ECEAP   GEEK CATSLESM+DFS+S+LGK 
Sbjct  179  PESVEAQIIKNTIKECEAPGTKGEEKYCATSLESMIDFSISKLGKR  224



>gb|KJB54864.1| hypothetical protein B456_009G052200 [Gossypium raimondii]
Length=324

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 126/204 (62%), Gaps = 31/204 (15%)
 Frame = +2

Query  71   IFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--STAGGV-------------  205
            I + L++AVVA HAALSPE YW   +PNTPMP AVK+ L     GGV             
Sbjct  7    ILACLALAVVASHAALSPEQYWSYKLPNTPMPKAVKEILHPGECGGVNVNTGKGKPGGDT  66

Query  206  -------------GKVGVTPNAIL---FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQM  337
                         GK G   +  +   F Y  AA+E Q+H+DPNVALFF + D+  G  M
Sbjct  67   HVNVGGKGVGVNTGKPGGGTHVNVGDPFNYLYAASETQIHEDPNVALFFLEKDMHPGATM  126

Query  338  KLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAM  517
             LHFT+ +  + FLP   A KIPFS+ KLP+I ++FS+ P S +A++MK T+ ECE PA+
Sbjct  127  SLHFTENTEKSAFLPYQTAQKIPFSSDKLPEIFNKFSVKPGSLKAEMMKNTITECEQPAI  186

Query  518  MGEEKLCATSLESMVDFSVSQLGK  589
             GEEK CATSLESM+D+S+S+LGK
Sbjct  187  EGEEKYCATSLESMIDYSISKLGK  210



>dbj|BAB60850.1| BURP domain-containing protein [Bruguiera gymnorhiza]
Length=307

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 123/196 (63%), Gaps = 27/196 (14%)
 Frame = +2

Query  80   LLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGVGKVGVTPNA-  232
            LL +A+VA  AAL+PE YW SV+PNTPMP A+KD L         T+  VGK G   +A 
Sbjct  2    LLMLALVASGAALAPEAYWNSVLPNTPMPKAIKDLLHPDMLEDKGTSVAVGKGGENVDAG  61

Query  233  ----------------ILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN  364
                            +  IY  AA+EDQ+HD+PNVALFF + DL+ G  M L F  +SN
Sbjct  62   KGKPGGGGTNFGIDRAVSNIY--AASEDQIHDNPNVALFFLQKDLKPGKSMNLDFPASSN  119

Query  365  AATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCAT  544
             ATFLPR  A  IPFS+ KL      FS+ P S EA++M+ T++ECE P + GEEK CAT
Sbjct  120  TATFLPRHVADSIPFSSNKLQDAFREFSVKPGSLEAEIMENTVKECENPGIEGEEKYCAT  179

Query  545  SLESMVDFSVSQLGKN  592
            SLESMVDFS S+LGK+
Sbjct  180  SLESMVDFSTSKLGKD  195



>ref|XP_010925834.1| PREDICTED: BURP domain-containing protein 6-like [Elaeis guineensis]
Length=293

 Score =   178 bits (451),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 108/165 (65%), Gaps = 1/165 (1%)
 Frame = +2

Query  92   AVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAILFIYTDAATEDQ  271
            AV ACHAAL  E YW S++PNTPMP A+ D           G     +   Y  AAT+ Q
Sbjct  14   AVEACHAALPAEVYWNSILPNTPMPSAIHDVTRPGVFEDDKGDDRKGLFIEYRTAATQSQ  73

Query  272  LHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSL  451
            + D P+ A++F + DL  G +M  HF +T   AT LPR AA  IPFS+ KLP+ILSR S+
Sbjct  74   IQD-PSEAVYFLEKDLHPGARMTFHFIRTITGATLLPRQAADSIPFSSAKLPEILSRLSI  132

Query  452  SPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            +P+S EAQ MKKTL+ECE PAM GE K CATS+E+MVDFS S LG
Sbjct  133  TPNSIEAQAMKKTLQECEKPAMEGETKYCATSVEAMVDFSTSSLG  177



>gb|KJB54859.1| hypothetical protein B456_009G052200 [Gossypium raimondii]
Length=323

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 125/203 (62%), Gaps = 30/203 (15%)
 Frame = +2

Query  71   IFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL-------------STAGG---  202
            I + L++AVVA HAALSPE YW   +PNTPMP AVK+ L                GG   
Sbjct  7    ILACLALAVVASHAALSPEQYWSYKLPNTPMPKAVKEILHPGGGGVNVNTGKGKPGGDTH  66

Query  203  -----------VGKVGVTPNAIL---FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMK  340
                        GK G   +  +   F Y  AA+E Q+H+DPNVALFF + D+  G  M 
Sbjct  67   VNVGGKGVGVNTGKPGGGTHVNVGDPFNYLYAASETQIHEDPNVALFFLEKDMHPGATMS  126

Query  341  LHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMM  520
            LHFT+ +  + FLP   A KIPFS+ KLP+I ++FS+ P S +A++MK T+ ECE PA+ 
Sbjct  127  LHFTENTEKSAFLPYQTAQKIPFSSDKLPEIFNKFSVKPGSLKAEMMKNTITECEQPAIE  186

Query  521  GEEKLCATSLESMVDFSVSQLGK  589
            GEEK CATSLESM+D+S+S+LGK
Sbjct  187  GEEKYCATSLESMIDYSISKLGK  209



>dbj|BAB60847.1| BURP domain-containing protein [Bruguiera gymnorhiza]
Length=292

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 121/180 (67%), Gaps = 9/180 (5%)
 Frame = +2

Query  80   LLSVAVVACHAALSPETYWKSVIPNTPMPGAVK-----DSLSTAG---GVGKVGVTPNAI  235
            LL +A+VA  AAL+PE YW SV+PNTPMP A+K     D L   G    VGK  V  +A 
Sbjct  2    LLMLALVASDAALAPEAYWNSVLPNTPMPKAIKVLLHPDMLEDKGTSVAVGKGAVNVDAG  61

Query  236  LFI-YTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFS  412
             FI Y +AA+EDQ+ D+ N+ +FF + DL+ G  M L+F ++SN ATFLPR  A  +PFS
Sbjct  62   SFINYYNAASEDQIRDNSNITIFFLEKDLKPGKSMNLYFFESSNTATFLPRHVADSMPFS  121

Query  413  AVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            + KL +    FS+ P S EA+ M+ T++ECE P + GEEK C TSLES+VDFS S+LGK+
Sbjct  122  SNKLQEAFREFSVKPGSLEAETMEDTIKECENPRIEGEEKYCVTSLESIVDFSSSKLGKD  181



>gb|AFK48420.1| unknown [Lotus japonicus]
Length=366

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 133/252 (53%), Gaps = 71/252 (28%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVAC-HAALSPETYWKSVIPNTPMPGAVKDSL-------------  187
            ME+ LL + +LLSV +VA  HAAL PE YWKSV+P TPMP A+ D L             
Sbjct  1    MEYPLLSVCALLSVLLVATSHAALPPELYWKSVLPTTPMPKAITDILYPDWVEEKSTNVG  60

Query  188  ----------------STAGGVGKVGVTPNAI----------------------------  235
                             T   VGK GV  NA                             
Sbjct  61   VGKGGVNVDAGKGKPGHTKVDVGKGGVNVNAGKGSGGGHGGTNVNVGGGKGGGVSVHTGH  120

Query  236  ----LFI---------YTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATF  376
                +F+         Y  AATE QLH DPNVALFF + +L  G +M LHFTKTSN ATF
Sbjct  121  KGKPVFVNVGSKSPFDYVYAATETQLHSDPNVALFFLEKNLHPGTKMNLHFTKTSNKATF  180

Query  377  LPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLES  556
            LPR  A  IPFS+ K+   L+++S+   S+EAQVMK T++ECE   + GEEK CATSLES
Sbjct  181  LPRIVADSIPFSSEKVELALNKYSVKAGSEEAQVMKNTIDECEQKGIQGEEKYCATSLES  240

Query  557  MVDFSVSQLGKN  592
            MVDF+ S+LG+N
Sbjct  241  MVDFTTSKLGEN  252



>dbj|BAB60849.1| BURP domain-containing protein [Bruguiera gymnorhiza]
Length=336

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 130/226 (58%), Gaps = 47/226 (21%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            ME ++  I  LL +A+VA  AAL+PE YW SV+PNTPMP A+KD L         T+  V
Sbjct  1    MESRIPYILGLLMLALVASGAALAPEAYWNSVLPNTPMPKAIKDLLHPDMLEDKGTSVAV  60

Query  206  GKVGVTPNA-------------------------------------ILFIYTDAATEDQL  274
            GK GV  +A                                     +  IY  AA+EDQ+
Sbjct  61   GKGGVNVDAGKGKPGGGTHVGVGGKGVGVDAGKPGGGGTNFGFDRAVSNIY--AASEDQI  118

Query  275  HDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLS  454
            HD+PN+ALFF + DL+ G  M L F ++SN ATFLPR  A  IPFS+ KL      FS+ 
Sbjct  119  HDNPNLALFFLQKDLKPGKSMNLDFPESSNTATFLPRHVADSIPFSSNKLQDAFREFSVK  178

Query  455  PDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            P S EA++M+ T++ECE P + GEEK CATSLESMVDFS S+LGK+
Sbjct  179  PGSLEAEIMENTVKECENPGIEGEEKYCATSLESMVDFSTSKLGKD  224



>ref|XP_008797983.1| PREDICTED: BURP domain-containing protein 3-like [Phoenix dactylifera]
Length=280

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 113/165 (68%), Gaps = 12/165 (7%)
 Frame = +2

Query  92   AVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAILFIYTDAATEDQ  271
            AV ACHAAL  + YW  V P+TPMP A++D L            P+ ++    +AA E Q
Sbjct  14   AVGACHAALPADLYWNVVFPSTPMPSAIRDVLR-----------PD-VIANEKNAAAEPQ  61

Query  272  LHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSL  451
            + DDP  ALFF + DL+ G +M LHFT+T++AA FLPR AA  IPFS+ KLP +L+R S+
Sbjct  62   VQDDPAAALFFIEKDLRPGARMTLHFTRTTSAANFLPRKAADSIPFSSAKLPAVLARLSI  121

Query  452  SPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
             P+S++AQ MKKTL+ECE  A+ GE K CATSLESMV+FS S LG
Sbjct  122  DPNSEKAQAMKKTLQECEEQAIDGETKRCATSLESMVEFSTSSLG  166



>ref|XP_010925836.1| PREDICTED: BURP domain-containing protein 6-like isoform X1 [Elaeis 
guineensis]
Length=290

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 113/169 (67%), Gaps = 12/169 (7%)
 Frame = +2

Query  92   AVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPN---AILFI-YTDAA  259
            AV ACHAAL  E YW S++PNTPMP A+ D       V + GV  +      FI Y  AA
Sbjct  14   AVEACHAALPTEVYWNSILPNTPMPSAIHD-------VTRPGVFEDDKGGDRFIAYRTAA  66

Query  260  TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILS  439
            T+ Q+ D P+ A++F + DL  G +M  HF +T   AT LPR AA  IPFS+ KLP+ILS
Sbjct  67   TQSQIQD-PSEAIYFLEKDLHPGARMTFHFIRTITGATLLPRQAADSIPFSSAKLPEILS  125

Query  440  RFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            R S++P+S EA+ MKKTL+ECE PAM GE K CATS+E+MVDFS S LG
Sbjct  126  RLSITPNSIEAEAMKKTLQECEKPAMEGETKYCATSVEAMVDFSTSSLG  174



>ref|XP_010911738.1| PREDICTED: BURP domain-containing protein 6-like [Elaeis guineensis]
Length=323

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 126/192 (66%), Gaps = 10/192 (5%)
 Frame = +2

Query  20   LQVALLSSTSM-EFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTA  196
              V LL S+SM  F +   FSLL  AV ACHAAL  + YW SV+PNTPMP A+ D ++  
Sbjct  23   FSVQLLVSSSMARFLVFLSFSLL--AVEACHAALPADLYWNSVLPNTPMPSAIHD-MTRP  79

Query  197  GGVG--KVGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAA  370
            G  G  K   + N     Y  A TEDQ+ D P+V  +F + DL  G +M LHF +T   A
Sbjct  80   GVFGDEKWDKSDNKN---YGKAVTEDQIQD-PSVTNYFFEKDLHPGAKMTLHFIRTITGA  135

Query  371  TFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSL  550
            T LPR AA  IPFS+ +LP+ILSR S++P+S EA+ MKKTL++CE PA+ GE K CATS+
Sbjct  136  TLLPRQAADSIPFSSDRLPEILSRLSITPNSIEAKAMKKTLQDCEEPAIEGETKYCATSV  195

Query  551  ESMVDFSVSQLG  586
            E+MVDFS S LG
Sbjct  196  EAMVDFSTSSLG  207



>emb|CAN83863.1| hypothetical protein VITISV_030281 [Vitis vinifera]
Length=312

 Score =   175 bits (443),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 127/197 (64%), Gaps = 18/197 (9%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLS-------TAGGV-  205
            MEF LL + + LS+ + A  + L  E YW SV+PNTPMP AVK+SL        + GGV 
Sbjct  1    MEFYLLPLLAFLSLTLTAGDSDLPSEIYWNSVLPNTPMPQAVKNSLRPGTDIGVSKGGVS  60

Query  206  ---------GKVGVTP-NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTK  355
                     G VGVT     +F Y  AATEDQLH DP+VALFF + D++ G +M L F K
Sbjct  61   VSTGHEEKPGYVGVTKAKKPIFFYRYAATEDQLHADPSVALFFLEKDMRLGTKMNLDFMK  120

Query  356  TSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKL  535
             +N ATFLP   A  IPFS+ KLP+IL + S+ P+S EA+ +K T+ +C+ P + GEEK 
Sbjct  121  NTNEATFLPHQVATSIPFSSDKLPEILDQLSVKPESVEAETIKNTIIDCDRPGIKGEEKY  180

Query  536  CATSLESMVDFSVSQLG  586
            CATSLESM+DFS S+LG
Sbjct  181  CATSLESMIDFSTSKLG  197



>emb|CBI28075.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 123/213 (58%), Gaps = 32/213 (15%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG-GVGKVGVT-  223
            MEF  + I  L+S+AVV   A +  + YW+ V+PNT MP A++  L     G+G   V  
Sbjct  1    MEFHPVPIIILISLAVVVADATVPSDVYWQKVLPNTAMPKALRHLLPEEDEGLGDEAVDV  60

Query  224  ------------PNA------------------ILFIYTDAATEDQLHDDPNVALFFKKN  313
                        P+                     FIY  AA++DQL DDPNVALFF + 
Sbjct  61   GVGGGGVSVGTGPDGSKYLWWRHHPHHPYHPWHEPFIYRYAASQDQLRDDPNVALFFLEK  120

Query  314  DLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTL  493
            DL    ++ LHFTKT++ A  LPR  A  IPFS+ +   IL+RFS+ P S EA  MKKT+
Sbjct  121  DLHPSKKLNLHFTKTTSGAKLLPRHVAETIPFSSNEFSDILNRFSVEPGSAEALEMKKTI  180

Query  494  EECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            EECE PAM GE+K CATSLE+MVD+S S+LGKN
Sbjct  181  EECEVPAMEGEDKYCATSLEAMVDYSTSKLGKN  213



>ref|XP_009416720.1| PREDICTED: BURP domain-containing protein 3-like [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 116/176 (66%), Gaps = 15/176 (9%)
 Frame = +2

Query  65   LGIFSLLSVAVVACHAALSPE--TYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAIL  238
            LG  +   +A V CHA+ SP    YW SV+P+TPMP A+ D ++T    G+         
Sbjct  102  LGRLNCYHLATV-CHASSSPAQVIYWNSVLPDTPMPRAISDLITTEVVAGE---------  151

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAV  418
                DAAT+ QLHDDPNVALFF + DL  G +MKLHFT T + A+FL R AA  IPFS+ 
Sbjct  152  ---KDAATDTQLHDDPNVALFFLEKDLHPGAKMKLHFTNTISGASFLRRRAADSIPFSST  208

Query  419  KLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            +L +IL RFS+ P+S EA  +K+TL +CE PA+ GE K CATSLE+MV+FS S LG
Sbjct  209  RLREILDRFSVEPNSAEAAAIKQTLRDCEEPAVRGERKTCATSLEAMVEFSTSSLG  264



>ref|XP_007137164.1| hypothetical protein PHAVU_009G105300g [Phaseolus vulgaris]
 gb|ESW09158.1| hypothetical protein PHAVU_009G105300g [Phaseolus vulgaris]
Length=338

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 127/225 (56%), Gaps = 44/225 (20%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACH-AALSPETYWKSVIPNTPMPGAVKDSL--------STAGG  202
            ME  LL IF+LL++AVVA H AAL P+ YWKS++P TP+P A+   L         TA  
Sbjct  1    MENLLLPIFALLNLAVVATHGAALPPQLYWKSLLPTTPIPNAITRILRPDWVEEKGTAVN  60

Query  203  VGKVGVTPNA-----------------------------------ILFIYTDAATEDQLH  277
            VGK GV  +A                                     F Y  AAT  QLH
Sbjct  61   VGKGGVNVHAGKGGGTNVNVGGKGGGVSVNAGHKKKPVHVSVGPKSPFDYRYAATATQLH  120

Query  278  DDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSP  457
            DD  VALFF + DL  G ++  HFT +SN ATFLPR  A  IPFS+ K+  + ++FS+ P
Sbjct  121  DDTKVALFFLEKDLHYGTKLDAHFTTSSNQATFLPRQVADSIPFSSDKVDDVFTKFSIKP  180

Query  458  DSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
             S+EA +++ TL ECE   + GEEK CATSLESMVDFS S+LGKN
Sbjct  181  GSEEAHIIENTLSECEETGIKGEEKYCATSLESMVDFSTSKLGKN  225



>dbj|BAB60848.1| BURP domain-containing protein [Bruguiera gymnorhiza]
Length=346

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 127/233 (55%), Gaps = 62/233 (27%)
 Frame = +2

Query  80   LLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGVGKVGV-----  220
            LL +A+VA  AAL+PE YW SV+PNTPMP A+KD L         T+  VGK GV     
Sbjct  2    LLMLALVASDAALAPEAYWNSVLPNTPMPKAIKDLLHPDMLEDKGTSVAVGKGGVNVDAG  61

Query  221  ----------------------------------------------TP---NAILFIYTD  253
                                                          TP   N   F+Y  
Sbjct  62   KGKPGGGTHVGVGGKGVGVDAGTPGGGGTNVGVGKGGVSVNTGHKGTPVNVNVSPFVYRY  121

Query  254  AATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQI  433
            AA+EDQ+HD+PNVALFF + D++ G  M L F+++SN ATFLPR  A  IPFS+ KL   
Sbjct  122  AASEDQIHDNPNVALFFLEKDMKPGKSMNLDFSESSNTATFLPRHVADSIPFSSNKLQDA  181

Query  434  LSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
               FS+ P S EA++M+ T++ECE P + GEEK CATSLESMVDFS S+LGK+
Sbjct  182  FREFSVKPGSMEAEIMENTVKECENPGIEGEEKYCATSLESMVDFSTSKLGKD  234



>ref|XP_003588550.1| BURP domain-containing protein [Medicago truncatula]
Length=325

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 123/201 (61%), Gaps = 8/201 (4%)
 Frame = +2

Query  8    LYFLLQVALLSSTSMEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL  187
            LYF L      S+ MEF  L IF  L++A+VA HAAL PE YWKS +P T +P A+ D L
Sbjct  14   LYFHL--PFRCSSLMEFPYLSIFISLNLALVATHAALPPELYWKSKLPTTQIPKAITDIL  71

Query  188  STAGG-----VGKVGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFT  352
                G     VG  G     +   +   A++ QLHD  N+ALFF + DL  G ++ + FT
Sbjct  72   HPRKGGTWVDVGNAGRVQQLLFIYWPYDASDTQLHDYRNLALFFFEKDLHNGTKLNMQFT  131

Query  353  KTSN-AATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEE  529
            KTS+  ATFLPR  A  IPFS+ K+  IL+ FS+   S E +++K T+  CE PA+ GEE
Sbjct  132  KTSDYGATFLPREVANSIPFSSNKVENILNYFSIKQGSAEYEIVKNTIGSCEMPAIEGEE  191

Query  530  KLCATSLESMVDFSVSQLGKN  592
            K C TSLESMVDF+ S+LG N
Sbjct  192  KSCVTSLESMVDFTTSKLGNN  212



>gb|KJB54856.1| hypothetical protein B456_009G052200 [Gossypium raimondii]
Length=335

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 124/215 (58%), Gaps = 42/215 (20%)
 Frame = +2

Query  71   IFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLS-------------------T  193
            I + L++AVVA HAALSPE YW   +PNTPMP AVK+ L                     
Sbjct  7    ILACLALAVVASHAALSPEQYWSYKLPNTPMPKAVKEILHPELMEEKSTSVNVGGGGVNV  66

Query  194  AGGVGKVGVTPNAIL-----------------------FIYTDAATEDQLHDDPNVALFF  304
              G GK G   +  +                       F Y  AA+E Q+H+DPNVALFF
Sbjct  67   NTGKGKPGGDTHVNVGGKGVGVNTGKPGGGTHVNVGDPFNYLYAASETQIHEDPNVALFF  126

Query  305  KKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMK  484
             + D+  G  M LHFT+ +  + FLP   A KIPFS+ KLP+I ++FS+ P S +A++MK
Sbjct  127  LEKDMHPGATMSLHFTENTEKSAFLPYQTAQKIPFSSDKLPEIFNKFSVKPGSLKAEMMK  186

Query  485  KTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
             T+ ECE PA+ GEEK CATSLESM+D+S+S+LGK
Sbjct  187  NTITECEQPAIEGEEKYCATSLESMIDYSISKLGK  221



>gb|KJB54855.1| hypothetical protein B456_009G052200 [Gossypium raimondii]
Length=367

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 128/227 (56%), Gaps = 42/227 (19%)
 Frame = +2

Query  35   LSSTSMEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLS--------  190
             +STS       I + L++AVVA HAALSPE YW   +PNTPMP AVK+ L         
Sbjct  27   FTSTSQMKVFSPILACLALAVVASHAALSPEQYWSYKLPNTPMPKAVKEILHPELMEEKS  86

Query  191  -----------TAGGVGKVGVTPNAIL-----------------------FIYTDAATED  268
                          G GK G   +  +                       F Y  AA+E 
Sbjct  87   TSVNVGGGGVNVNTGKGKPGGDTHVNVGGKGVGVNTGKPGGGTHVNVGDPFNYLYAASET  146

Query  269  QLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFS  448
            Q+H+DPNVALFF + D+  G  M LHFT+ +  + FLP   A KIPFS+ KLP+I ++FS
Sbjct  147  QIHEDPNVALFFLEKDMHPGATMSLHFTENTEKSAFLPYQTAQKIPFSSDKLPEIFNKFS  206

Query  449  LSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            + P S +A++MK T+ ECE PA+ GEEK CATSLESM+D+S+S+LGK
Sbjct  207  VKPGSLKAEMMKNTITECEQPAIEGEEKYCATSLESMIDYSISKLGK  253



>ref|XP_010925838.1| PREDICTED: BURP domain-containing protein 6-like [Elaeis guineensis]
Length=318

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 120/197 (61%), Gaps = 27/197 (14%)
 Frame = +2

Query  74   FSLLSVAVVACHAALSPETYWKSVIPNTPMPGAV----------------------KDSL  187
            F L ++AV A HA    E YW  V+PNTPMP A+                      KD+ 
Sbjct  7    FLLFALAVGASHAPSPAEVYWHKVLPNTPMPSAITDLLHHDVVADEKSDRRVNVNGKDTS  66

Query  188  STAGGVGK---VGVTPN-AILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTK  355
             + G  GK   V V P  +  F+Y  AAT+ Q+ D P+V LFF + DL  G +M LHF +
Sbjct  67   VSVGYKGKPVVVNVKPYYSGPFLYNYAATQSQIQD-PSVTLFFLEKDLHPGAKMTLHFIR  125

Query  356  TSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKL  535
            T+  AT LPR AA  IPFS+ KLP+ILSR S++P+S EA+VMKKTL ECE PA+ GE K 
Sbjct  126  TTTGATLLPRRAADSIPFSSAKLPEILSRLSIAPNSMEAEVMKKTLHECEEPAIGGETKY  185

Query  536  CATSLESMVDFSVSQLG  586
            CATS+ESMVDFS S LG
Sbjct  186  CATSVESMVDFSTSSLG  202



>ref|XP_010943940.1| PREDICTED: BURP domain-containing protein 6-like [Elaeis guineensis]
Length=331

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 125/201 (62%), Gaps = 13/201 (6%)
 Frame = +2

Query  11   YFL-LQVALLSSTSM-EFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDS  184
            Y L   V LL S+SM  F +   FSLL  AV ACHAAL  + YW SV+PNTPMP A+ D 
Sbjct  19   YLLSFSVQLLVSSSMARFLVFLSFSLL--AVEACHAALPADLYWNSVLPNTPMPSAIHD-  75

Query  185  LSTAGGVGKVGVTPNAILF-------IYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKL  343
            ++  G  G      + +         ++  A TE Q+ D P+V  FF K DL  G +M L
Sbjct  76   MTRLGVFGDEKWDKSDVRLGWRRADTVWGKAVTEGQIQD-PSVTNFFLKKDLHPGAKMTL  134

Query  344  HFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMG  523
            HF +T   AT LPR  A  IPFS+ KLP+ILSR S++P+S EA+ MK TL++CE PA+ G
Sbjct  135  HFIRTITGATLLPRQVADSIPFSSAKLPEILSRLSITPNSIEAKAMKMTLQDCEEPAIEG  194

Query  524  EEKLCATSLESMVDFSVSQLG  586
            E K CATS+E+MVDFS S LG
Sbjct  195  ETKYCATSVEAMVDFSTSSLG  215



>ref|XP_010648549.1| PREDICTED: dehydration-responsive protein RD22-like isoform X3 
[Vitis vinifera]
Length=312

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 126/197 (64%), Gaps = 18/197 (9%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLS-------TAGGV-  205
            MEF LL + + LS+ + A  + L  E YW SV+PNTPMP AVK+SL        + GGV 
Sbjct  1    MEFYLLPLLAFLSLTLTAGDSDLPSEIYWNSVLPNTPMPQAVKNSLRPGTDIGVSKGGVS  60

Query  206  ---------GKVGVTP-NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTK  355
                     G VGVT     +F Y  AATEDQLH  P+VALFF + D++ G +M L F K
Sbjct  61   VSTGHEEKPGYVGVTKAKKPIFFYRYAATEDQLHAHPSVALFFLEKDMRLGTKMNLDFMK  120

Query  356  TSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKL  535
             +N ATFLP   A  IPFS+ KLP+IL + S+ P+S EA+ +K T+ +C+ P + GEEK 
Sbjct  121  NTNEATFLPHQVATSIPFSSDKLPEILDQLSVKPESVEAETIKNTIIDCDRPGIKGEEKY  180

Query  536  CATSLESMVDFSVSQLG  586
            CATSLESM+DFS S+LG
Sbjct  181  CATSLESMIDFSTSKLG  197



>gb|AAL67991.1| dehydration-induced protein RD22-like protein [Gossypium hirsutum]
Length=335

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 124/215 (58%), Gaps = 42/215 (20%)
 Frame = +2

Query  71   IFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLS-------------------T  193
            I + L++AVV  HAALSPE YW   +PNTPMP AVK+ L                     
Sbjct  7    ILACLALAVVVSHAALSPEQYWSYKLPNTPMPKAVKEILHPELMEEKSTSVNVGGGGVNV  66

Query  194  AGGVGKVGVTPNAIL-----------------------FIYTDAATEDQLHDDPNVALFF  304
              G GK G   +  +                       F Y  AA+E Q+H+DPNVALFF
Sbjct  67   NTGKGKPGGDTHVNVGGKGVGVNTGKPGGGTHVNVGDPFNYLYAASETQIHEDPNVALFF  126

Query  305  KKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMK  484
             + D+  G  M LHFT+ +  + FLP   A KIPFS+ KLP+I ++FS+ P S +A++MK
Sbjct  127  LEKDMHPGATMSLHFTENTEKSAFLPYQTAQKIPFSSDKLPEIFNKFSVKPGSLKAEMMK  186

Query  485  KTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
             T++ECE PA+ GEEK CATSLESM+D+S+S+LGK
Sbjct  187  NTIKECEQPAIEGEEKYCATSLESMIDYSISKLGK  221



>gb|AES58801.2| dehydration-responsive protein RD22 [Medicago truncatula]
Length=300

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 117/187 (63%), Gaps = 6/187 (3%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGG-----VGKV  214
            MEF  L IF  L++A+VA HAAL PE YWKS +P T +P A+ D L    G     VG  
Sbjct  1    MEFPYLSIFISLNLALVATHAALPPELYWKSKLPTTQIPKAITDILHPRKGGTWVDVGNA  60

Query  215  GVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN-AATFLPRSA  391
            G     +   +   A++ QLHD  N+ALFF + DL  G ++ + FTKTS+  ATFLPR  
Sbjct  61   GRVQQLLFIYWPYDASDTQLHDYRNLALFFFEKDLHNGTKLNMQFTKTSDYGATFLPREV  120

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ K+  IL+ FS+   S E +++K T+  CE PA+ GEEK C TSLESMVDF+
Sbjct  121  ANSIPFSSNKVENILNYFSIKQGSAEYEIVKNTIGSCEMPAIEGEEKSCVTSLESMVDFT  180

Query  572  VSQLGKN  592
             S+LG N
Sbjct  181  TSKLGNN  187



>gb|KHG03003.1| Dehydration-responsive RD22 -like protein [Gossypium arboreum]
 gb|KHG09413.1| Dehydration-responsive RD22 -like protein [Gossypium arboreum]
Length=335

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 125/217 (58%), Gaps = 46/217 (21%)
 Frame = +2

Query  71   IFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLS-------------------T  193
            I + L++AVVA HAALSPE YW   +PNTPMP AVK+ L                     
Sbjct  7    ILACLALAVVASHAALSPEQYWSYKLPNTPMPKAVKEILHPELMEEKSTSVNVGGGGVNV  66

Query  194  AGGVGKVG-------------------------VTPNAILFIYTDAATEDQLHDDPNVAL  298
              G GK G                           P+   ++Y  AA+E Q+H+DPNVAL
Sbjct  67   NTGKGKPGGDTHVNVGGKGVGVNTGKPGGGTDVNDPDPFNYLY--AASETQIHEDPNVAL  124

Query  299  FFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQV  478
            FF + D+  G  M LHF + +  + FLP   A KIPFS+ KLP+I ++FS+ P S +A++
Sbjct  125  FFLEKDMHPGATMSLHFIENTEKSAFLPYQTAQKIPFSSDKLPEIFNKFSVKPGSVKAEM  184

Query  479  MKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            MK T++ECE PA+ GEEK CATSLESM+D+S+S+LGK
Sbjct  185  MKNTIKECEQPAIEGEEKYCATSLESMIDYSISKLGK  221



>gb|KJB54863.1| hypothetical protein B456_009G052200 [Gossypium raimondii]
Length=342

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 125/222 (56%), Gaps = 49/222 (22%)
 Frame = +2

Query  71   IFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG-----------------  199
            I + L++AVVA HAALSPE YW   +PNTPMP AVK+ L  A                  
Sbjct  7    ILACLALAVVASHAALSPEQYWSYKLPNTPMPKAVKEILHPAHFGVFAELMEEKSTSVNV  66

Query  200  ---------GVGKVGVTPNAIL-----------------------FIYTDAATEDQLHDD  283
                     G GK G   +  +                       F Y  AA+E Q+H+D
Sbjct  67   GGGGVNVNTGKGKPGGDTHVNVGGKGVGVNTGKPGGGTHVNVGDPFNYLYAASETQIHED  126

Query  284  PNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDS  463
            PNVALFF + D+  G  M LHFT+ +  + FLP   A KIPFS+ KLP+I ++FS+ P S
Sbjct  127  PNVALFFLEKDMHPGATMSLHFTENTEKSAFLPYQTAQKIPFSSDKLPEIFNKFSVKPGS  186

Query  464  KEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
             +A++MK T+ ECE PA+ GEEK CATSLESM+D+S+S+LGK
Sbjct  187  LKAEMMKNTITECEQPAIEGEEKYCATSLESMIDYSISKLGK  228



>ref|NP_001268138.1| rd22-b protein precursor [Vitis vinifera]
 gb|ACP40550.1| RD22 [Vitis vinifera]
Length=327

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 124/213 (58%), Gaps = 32/213 (15%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG-GVGKVGVT-  223
            MEF  + I  L+S+AVV   A +  + YW+ V+PNT MP A++  L     G+G   V  
Sbjct  1    MEFHPVPIIILISLAVVVADATVPSDVYWQKVLPNTAMPKALRHLLPEEDEGLGDEAVDV  60

Query  224  ------------PNA------------------ILFIYTDAATEDQLHDDPNVALFFKKN  313
                        P+                     FIY  AA++DQL DDPNVALFF + 
Sbjct  61   GVGGGGVSVGTGPDGSKYLWWRHHPHHPYHPWHEPFIYRYAASQDQLRDDPNVALFFLEK  120

Query  314  DLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTL  493
            DL    ++ LHFTKT++ A  LPR  A  IPFS+ +L  IL+RFS+ P S EA  MKKT+
Sbjct  121  DLHPSKKLNLHFTKTTSGAKLLPRHVAETIPFSSNELSDILNRFSVEPGSAEALEMKKTI  180

Query  494  EECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            EECE PAM GE+K CATSLE+MVD+S ++LGKN
Sbjct  181  EECEVPAMEGEDKYCATSLEAMVDYSTTKLGKN  213



>ref|XP_010648548.1| PREDICTED: dehydration-responsive protein RD22-like isoform X2 
[Vitis vinifera]
Length=317

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 113/171 (66%), Gaps = 14/171 (8%)
 Frame = +2

Query  116  LSPETYWKSVIPNTPMPGAVKDSLS---TAGGV----------GKVGVTP-NAILFIYTD  253
            L  E YW SV+PNTPMP AVK+SL    + GGV          G VGVT     +F Y  
Sbjct  32   LPSEIYWNSVLPNTPMPQAVKNSLRPGVSKGGVSVSTGHEEKPGYVGVTKAKKPIFFYRY  91

Query  254  AATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQI  433
            AATEDQLH  P+VALFF + D++ G +M L F K +N ATFLP   A  IPFS+ KLP+I
Sbjct  92   AATEDQLHAHPSVALFFLEKDMRLGTKMNLDFMKNTNEATFLPHQVATSIPFSSDKLPEI  151

Query  434  LSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            L + S+ P+S EA+ +K T+ +C+ P + GEEK CATSLESM+DFS S+LG
Sbjct  152  LDQLSVKPESVEAETIKNTIIDCDRPGIKGEEKYCATSLESMIDFSTSKLG  202



>ref|XP_010249743.1| PREDICTED: dehydration-responsive protein RD22 [Nelumbo nucifera]
Length=404

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P A  F+Y  AA+EDQL DDPNVALFF + DL  G +M L FTKT++ ATFLPR  
Sbjct  164  VGVHPGASPFLYKYAASEDQLRDDPNVALFFMEKDLNAGTKMNLRFTKTTSGATFLPRQV  223

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+  LPQIL +FS+ P S+EA++MK TLE+CE PAM GE+KLCATSLESMVDFS
Sbjct  224  ADTIPFSSKALPQILRQFSVEPQSEEAELMKNTLEDCEMPAMEGEDKLCATSLESMVDFS  283

Query  572  VSQLGKN  592
             S+LGK+
Sbjct  284  TSKLGKH  290


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL  187
            ME + L IF+ LS+A+V  HA L  E YW+SV+P+TPMP A++D L
Sbjct  1    MELRFLPIFAFLSLALVVSHATLPSEVYWQSVLPDTPMPKAIRDLL  46



>gb|ACD62790.1| BURP domain-containing protein [Phaseolus vulgaris]
 gb|AHA84261.1| dehydration-responsive protein RD22 [Phaseolus vulgaris]
 gb|AHA84280.1| BURP domain-containing protein [Phaseolus vulgaris]
Length=338

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 126/225 (56%), Gaps = 44/225 (20%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACH-AALSPETYWKSVIPNTPMPGAVKDSL--------STAGG  202
            ME  LL IF+LL++AVVA H AAL P+ YWKS++P TP+P A+   L         TA  
Sbjct  1    MENLLLPIFALLNLAVVATHGAALPPQLYWKSLLPTTPIPNAITRILRPDWVEEKGTAVN  60

Query  203  VGKVGVTPNA-----------------------------------ILFIYTDAATEDQLH  277
            VGK GV  +A                                     F Y  AAT  QLH
Sbjct  61   VGKGGVNVHAGKGGGTNVNVGGKGGGVSVNAGHKKKPVHVSVGPKSPFDYVYAATATQLH  120

Query  278  DDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSP  457
            D   VALFF + DL  G ++  HFT +SN ATFLPR  A  IPFS+ K+  + ++FS+ P
Sbjct  121  DATKVALFFLEKDLHYGTKLDAHFTTSSNQATFLPRQVADSIPFSSDKVDDVFTKFSIKP  180

Query  458  DSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
             S+EA +++ TL ECE   + GEEK CATSLESMVDFS S+LGKN
Sbjct  181  GSEEAHIIENTLSECEETGIKGEEKYCATSLESMVDFSTSKLGKN  225



>ref|XP_010925835.1| PREDICTED: BURP domain-containing protein 6-like [Elaeis guineensis]
Length=331

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 121/199 (61%), Gaps = 9/199 (5%)
 Frame = +2

Query  11   YFL-LQVALLSSTSMEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL  187
            Y L   V LL S+SM    L   S   VAV ACHAAL  + YW SV+PNTPMP A+ D  
Sbjct  19   YLLSFSVQLLVSSSMA-HFLVFLSFFLVAVEACHAALPADLYWNSVLPNTPMPSAIHDMT  77

Query  188  STAGGVGKVGVTPNAIL------FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHF  349
                  G+ G   +  L       ++  A T+ Q+ D P+V  FF + DL  G +M LHF
Sbjct  78   RPGVFGGEKGDKSDVRLGWRRADTVWGKAVTKGQIQD-PSVTNFFLEKDLHPGAKMTLHF  136

Query  350  TKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEE  529
             +T   AT LPR  A  IPFS+ KLP+ILSR S++P+S EA+ MK TL++CE PA+ GE 
Sbjct  137  IRTITGATLLPRQVADSIPFSSAKLPEILSRLSITPNSIEAKAMKMTLQDCEEPAIDGET  196

Query  530  KLCATSLESMVDFSVSQLG  586
            K CATS+E+MVDFS S LG
Sbjct  197  KYCATSVEAMVDFSTSSLG  215



>gb|AGV54277.1| BURP domain-containing protein [Phaseolus vulgaris]
Length=338

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 126/225 (56%), Gaps = 44/225 (20%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACH-AALSPETYWKSVIPNTPMPGAVKDSL--------STAGG  202
            ME  LL IF+LL++AVVA H AAL P+ YWKS++P TP+P A+   L         TA  
Sbjct  1    MENLLLPIFALLNLAVVATHGAALPPQLYWKSLLPTTPIPNAITRILRPDWVEEKGTAVN  60

Query  203  VGKVGVTPNA-----------------------------------ILFIYTDAATEDQLH  277
            VGK GV  +A                                     F Y  AAT  QLH
Sbjct  61   VGKGGVNVHAGKGGGTNVNVGGKGGGVSVNAGHKKKPVHVSVGPKSPFDYVYAATATQLH  120

Query  278  DDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSP  457
            D   VALFF + DL  G ++  HFT +SN ATFLPR  A  IPFS+ K+  + ++FS+ P
Sbjct  121  DATKVALFFLEKDLHYGTKLDAHFTTSSNQATFLPRQVADSIPFSSDKVDDVFTKFSIKP  180

Query  458  DSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
             S+EA +++ TL ECE   + GEEK CATSLESMVDFS S+LGKN
Sbjct  181  GSEEAHIIENTLSECEETGIKGEEKYCATSLESMVDFSTSKLGKN  225



>ref|XP_010648547.1| PREDICTED: dehydration-responsive protein RD22-like isoform X1 
[Vitis vinifera]
Length=321

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 113/175 (65%), Gaps = 18/175 (10%)
 Frame = +2

Query  116  LSPETYWKSVIPNTPMPGAVKDSLS-------TAGGV----------GKVGVTP-NAILF  241
            L  E YW SV+PNTPMP AVK+SL        + GGV          G VGVT     +F
Sbjct  32   LPSEIYWNSVLPNTPMPQAVKNSLRPGTDIGVSKGGVSVSTGHEEKPGYVGVTKAKKPIF  91

Query  242  IYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVK  421
             Y  AATEDQLH  P+VALFF + D++ G +M L F K +N ATFLP   A  IPFS+ K
Sbjct  92   FYRYAATEDQLHAHPSVALFFLEKDMRLGTKMNLDFMKNTNEATFLPHQVATSIPFSSDK  151

Query  422  LPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            LP+IL + S+ P+S EA+ +K T+ +C+ P + GEEK CATSLESM+DFS S+LG
Sbjct  152  LPEILDQLSVKPESVEAETIKNTIIDCDRPGIKGEEKYCATSLESMIDFSTSKLG  206



>ref|XP_009762320.1| PREDICTED: dehydration-responsive protein RD22 [Nicotiana sylvestris]
Length=388

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN-AATFLPRS  388
            VGV P    F+Y  AA +DQLHD+PNVALFF + DL QG+ M L F KT+N AATFLPR 
Sbjct  146  VGVRPGPSPFVYNYAAKDDQLHDNPNVALFFLEKDLHQGSNMNLQFVKTTNNAATFLPRQ  205

Query  389  AAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDF  568
             A  IPFS+ K+P+ILS+FS+ PDS+EAQ++K+T++ECE P + GEEK CATSLESMVDF
Sbjct  206  VANSIPFSSNKMPEILSQFSVKPDSEEAQILKQTVQECEEPGIKGEEKYCATSLESMVDF  265

Query  569  SVSQLG  586
            S S+LG
Sbjct  266  STSKLG  271


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 13/73 (18%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSP----ETYWKSVIPNTPMPGAVKDSL---------S  190
            ME +LL + + LS+A+VA +AAL P    +TYW + +PNTP+P A+KDSL         S
Sbjct  1    MELKLLHVLTYLSLALVASYAALPPASSGQTYWNTKLPNTPIPKAIKDSLQPTGLTEDKS  60

Query  191  TAGGVGKVGVTPN  229
            T+  VGK GV  N
Sbjct  61   TSVEVGKGGVNVN  73



>emb|CAN63067.1| hypothetical protein VITISV_031226 [Vitis vinifera]
Length=353

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 118/192 (61%), Gaps = 26/192 (14%)
 Frame = +2

Query  89   VAVVACHAALSPETYWKSVIPNTPMPGAVKDSL----STAGGVGK---VGVTPNAI----  235
            + + A  + L  E YW SV+PNTPMP AVK+SL    ST   +GK   +GV+   +    
Sbjct  47   LTLTAGDSDLPSEIYWNSVLPNTPMPQAVKNSLRPEESTGVEIGKGTDIGVSKGGVSVST  106

Query  236  ---------------LFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAA  370
                            F Y  AATEDQLH DP+VALFF + D++ G +M L F K +N A
Sbjct  107  GHEEKPAYVGVTKGHTFFYRYAATEDQLHADPSVALFFLEKDMRLGTKMNLDFMKNTNEA  166

Query  371  TFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSL  550
            TFLP   A  IPFS+ KLP+IL + S+ P+S EA+ +K T+ +CE P + GEEK CATSL
Sbjct  167  TFLPHQVATSIPFSSDKLPEILDQLSMKPESIEAETIKNTIIDCERPGIKGEEKYCATSL  226

Query  551  ESMVDFSVSQLG  586
            ESM+DFS S+LG
Sbjct  227  ESMIDFSTSKLG  238



>ref|XP_002284434.1| PREDICTED: dehydration-responsive protein RD22-like [Vitis vinifera]
Length=356

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 121/195 (62%), Gaps = 27/195 (14%)
 Frame = +2

Query  80   LLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGVGK--------  211
            LL + + A  A L  E YW SV+PNTPMP AVK+SL        ST   +GK        
Sbjct  48   LLQLTLTAGDADLPSEVYWSSVLPNTPMPQAVKNSLRPDLLEDQSTPVEIGKGTSMGFSK  107

Query  212  --------VGVTPN--AILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTS  361
                     GV P   A+ F Y  AAT+DQLH  PNVA+FF + D+  G ++ LHFTKT+
Sbjct  108  EGGAMNMYAGVKPAKAAMPFSYHYAATKDQLHAYPNVAIFFLEKDMHPGMKLTLHFTKTT  167

Query  362  NAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCA  541
            NA TFLP   A  +PFS+ KL +IL + S+ P+S EA+ +K T+EECE P + GEEK CA
Sbjct  168  NA-TFLPHQVANSLPFSSDKLAEILDQLSIKPESVEAETIKNTIEECEDPGIKGEEKYCA  226

Query  542  TSLESMVDFSVSQLG  586
            TSLESM+DFS S+LG
Sbjct  227  TSLESMIDFSTSKLG  241



>ref|XP_009628254.1| PREDICTED: dehydration-responsive protein RD22-like isoform X2 
[Nicotiana tomentosiformis]
Length=388

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN-AATFLPRS  388
            VGV P    F+Y  AA +DQLHD+PNVALFF + DL QG+ M L F KT+N AATFLPR 
Sbjct  146  VGVRPGPSPFVYNYAAKDDQLHDNPNVALFFLEKDLHQGSNMNLQFVKTTNTAATFLPRQ  205

Query  389  AAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDF  568
             A  IPFS+ K+P+IL++FS+ PDS+EAQ++K+T++ECE P + GEEK CATSLESMVDF
Sbjct  206  VANSIPFSSNKMPEILNQFSVKPDSEEAQILKQTVQECEQPGIKGEEKYCATSLESMVDF  265

Query  569  SVSQLG  586
            S S+LG
Sbjct  266  STSKLG  271


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 3/53 (6%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSP---ETYWKSVIPNTPMPGAVKDSLSTAG  199
            ME +LL I + LS+A+VA +AAL P   +TYW + +PNTPMP A+KDSL   G
Sbjct  1    MELKLLHILTYLSLALVASYAALPPSSGQTYWNTKLPNTPMPKAIKDSLQPTG  53



>ref|XP_010917767.1| PREDICTED: BURP domain-containing protein 6-like [Elaeis guineensis]
Length=314

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 123/189 (65%), Gaps = 6/189 (3%)
 Frame = +2

Query  26   VALLSSTSMEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGV  205
            V LL S+SM  + L   S   +AV ACHAAL  + YW SV+PNTPMP A+ D ++  G  
Sbjct  14   VQLLVSSSMA-RFLVFLSFFLLAVEACHAALPADVYWNSVLPNTPMPSAIHD-MTRPGVF  71

Query  206  G--KVGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFL  379
            G  K   T  A +  +  A TEDQ+ D P+V  +F + DL     M +HF +T   AT L
Sbjct  72   GDEKWDKTDTANIG-WGKAVTEDQIQD-PSVTNYFFEKDLHPSANMTMHFIRTITGATLL  129

Query  380  PRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESM  559
            PR AA  IPFS+ KLP+ILSR S++P+S EA+ MKKTL++CE PA+ GE K CATS+E+M
Sbjct  130  PRQAADSIPFSSAKLPEILSRLSITPNSIEAKAMKKTLQDCEEPAIEGETKYCATSVEAM  189

Query  560  VDFSVSQLG  586
            VDFS S LG
Sbjct  190  VDFSTSSLG  198



>ref|XP_003588559.1| BURP domain-containing protein [Medicago truncatula]
 gb|ACJ84431.1| unknown [Medicago truncatula]
 gb|AES58810.1| dehydration-responsive protein RD22 [Medicago truncatula]
Length=325

 Score =   168 bits (425),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 122/211 (58%), Gaps = 30/211 (14%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAA-LSPETYWKSVIPNTPMPGAVKDSLSTAG---------  199
            M+F L+ I +   + V A +A  L P+ YWKS++PN+PMP A+ + L  AG         
Sbjct  1    MDFHLVHIITFFMLVVGATNAVMLPPQLYWKSMLPNSPMPKAITNLLHPAGYWSEEKGTW  60

Query  200  -------------------GVGKVGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQ  322
                               G   V V      FIY  AA+E QLHD PNVALFF + DL 
Sbjct  61   VDVGKGGVDVGVRKGYYEGGGTDVNVGVGRSPFIYNYAASETQLHDKPNVALFFLEKDLH  120

Query  323  QGNQMKLHFTKT-SNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEE  499
             G ++ L F+KT SNAATFLPR  A  IPFS+ K+  I+++ ++   SK  Q++K T+ E
Sbjct  121  HGTKLNLQFSKTTSNAATFLPRQVANSIPFSSNKMEYIINKLNIKKGSKGVQIVKNTISE  180

Query  500  CEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            CE   + GEEK+C TSLESMVDF+ S+LGKN
Sbjct  181  CEEQGIKGEEKVCVTSLESMVDFTTSKLGKN  211



>ref|XP_009628253.1| PREDICTED: dehydration-responsive protein RD22-like isoform X1 
[Nicotiana tomentosiformis]
Length=391

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN-AATFLPRS  388
            VGV P    F+Y  AA +DQLHD+PNVALFF + DL QG+ M L F KT+N AATFLPR 
Sbjct  149  VGVRPGPSPFVYNYAAKDDQLHDNPNVALFFLEKDLHQGSNMNLQFVKTTNTAATFLPRQ  208

Query  389  AAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDF  568
             A  IPFS+ K+P+IL++FS+ PDS+EAQ++K+T++ECE P + GEEK CATSLESMVDF
Sbjct  209  VANSIPFSSNKMPEILNQFSVKPDSEEAQILKQTVQECEQPGIKGEEKYCATSLESMVDF  268

Query  569  SVSQLG  586
            S S+LG
Sbjct  269  STSKLG  274


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 3/49 (6%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSP---ETYWKSVIPNTPMPGAVKDSL  187
            ME +LL I + LS+A+VA +AAL P   +TYW + +PNTPMP A+KDSL
Sbjct  1    MELKLLHILTYLSLALVASYAALPPSSGQTYWNTKLPNTPMPKAIKDSL  49



>gb|AAQ22345.1| BURP domain-containing protein [Gossypium hirsutum]
Length=335

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 121/215 (56%), Gaps = 42/215 (20%)
 Frame = +2

Query  71   IFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLS-------------------T  193
            I + L++AVV  HA LSPE YW   +PN PMP AVK+ L                     
Sbjct  7    ILACLALAVVVSHAVLSPEQYWSYKLPNIPMPKAVKEILHPELMEEKSTSVNVGGGGVNV  66

Query  194  AGGVGKVGVTPNAIL-----------------------FIYTDAATEDQLHDDPNVALFF  304
              G GK G   +  +                       F Y  AA+E Q+H+DPNVALFF
Sbjct  67   NTGKGKPGGDTHVNVGGKGVGVNTGKPGGGTHVNDPDPFNYLYAASETQIHEDPNVALFF  126

Query  305  KKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMK  484
             + D+  G  M LHF + +  + FLP   A KIPFS+ KLP+I ++FS+ P S +A++MK
Sbjct  127  LEKDMHPGATMSLHFIENTEKSAFLPYQTAQKIPFSSDKLPEIFNKFSVKPGSVKAEMMK  186

Query  485  KTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
             T++ECE PA+ GEEK CATSLESM+D+S+S+LGK
Sbjct  187  NTIKECEQPAIEGEEKYCATSLESMIDYSISKLGK  221



>ref|XP_004291216.1| PREDICTED: dehydration-responsive protein RD22 [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGVTP+   F+Y  AATE QLH+DP VALFF + D+  G +M LHFT +S+ ATFLPR  
Sbjct  164  VGVTPSKNPFLYQYAATETQLHEDPQVALFFLEKDMHPGTKMNLHFTTSSDTATFLPRKT  223

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+IL +FS+ P+S EA  +K+T+EECE P + GEEK CATSLESMVDFS
Sbjct  224  AESIPFSSSKLPEILDQFSVKPESAEADTLKQTIEECEKPGITGEEKYCATSLESMVDFS  283

Query  572  VSQLGKN  592
             S+LG+N
Sbjct  284  TSKLGRN  290


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 39/69 (57%), Gaps = 8/69 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            M F L  IF   +  +V  HAALSP+ YW SV+PNTPMP  + + L        ST+  V
Sbjct  1    MGFHLPHIFGFFTFTLVVSHAALSPQLYWNSVLPNTPMPKTLSELLQSDFSEEKSTSVLV  60

Query  206  GKVGVTPNA  232
            GK GV  NA
Sbjct  61   GKGGVNVNA  69



>ref|XP_002284380.1| PREDICTED: BURP domain-containing protein 3-like [Vitis vinifera]
Length=295

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 115/185 (62%), Gaps = 4/185 (2%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPN  229
            MEF+     + LSV VV  HA+   E YWK  +P+TPMP A++D L + G       T +
Sbjct  1    MEFRSFPFLAFLSVMVVVIHASQPDEDYWKLALPHTPMPKAIRDLLQSKGLSSVDASTAS  60

Query  230  AILFIYTDA----ATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAG  397
              + I+ D     A E+   DD  +  FF + DL  G +MKL+   T+N A FLP   A 
Sbjct  61   CTVHIHFDKFSQPAGEEAQVDDSKIGNFFLETDLHPGKKMKLNLATTTNGAVFLPHQVAE  120

Query  398  KIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVS  577
             +PFS+ KLP+IL+RFSL  +S EA+++KK LEECE PAM GE + CATSL+S++ FS S
Sbjct  121  SMPFSSNKLPEILNRFSLKENSAEAEIIKKELEECEEPAMEGEARYCATSLQSLIHFSTS  180

Query  578  QLGKN  592
            +LG+N
Sbjct  181  KLGRN  185



>ref|XP_007140998.1| hypothetical protein PHAVU_008G158600g [Phaseolus vulgaris]
 gb|ESW12992.1| hypothetical protein PHAVU_008G158600g [Phaseolus vulgaris]
Length=340

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 126/230 (55%), Gaps = 51/230 (22%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLS-------------  190
            MEF +L I + L + V A  AALSPE YWKSV+P TPMP A+ D L              
Sbjct  1    MEFHILPIVTFLMLGVAAS-AALSPEFYWKSVLPTTPMPKAITDLLHPDWKEEKDGSADV  59

Query  191  --------------------------------TAGGVGK---VGVTPNAILFIYTDAATE  265
                                             AG  GK   VGV P++  F YT  A+E
Sbjct  60   GNGVNVGVEKGNQGQGGGTDVNVGGGNGGVNVHAGPKGKPVHVGVGPHSP-FDYTYGASE  118

Query  266  DQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNA-ATFLPRSAAGKIPFSAVKLPQILSR  442
             QL DDPN+ LFF + +L  G ++ L F++TSNA ATFLPR  A  IPFS+ K+  IL R
Sbjct  119  TQLRDDPNLVLFFLEKNLHHGTKLDLLFSQTSNAEATFLPRPLADSIPFSSNKVNDILHR  178

Query  443  FSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            FS+   S EAQV+K T+ ECE P + GEEK C TSLESMVDF+ S+LG N
Sbjct  179  FSIKAWSDEAQVVKNTISECERPIIKGEEKRCVTSLESMVDFATSKLGNN  228



>gb|AGV54733.1| dehydration-responsive protein RD22-like protein [Phaseolus vulgaris]
Length=338

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 124/225 (55%), Gaps = 44/225 (20%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACH-AALSPETYWKSVIPNTPMPGAVKDSL--------STAGG  202
            ME  LL IF+LL++AVVA H AAL P+ YWKS++P TP+P A+   L         TA  
Sbjct  1    MENLLLPIFALLNLAVVATHGAALPPQLYWKSLLPTTPIPNAITRILRPDWVEEKGTAVN  60

Query  203  VGKVGVTPNA-----------------------------------ILFIYTDAATEDQLH  277
            VGK GV  +A                                     F Y  AAT  QLH
Sbjct  61   VGKGGVNVHAGKGGGTNVNVGGKGGGVSVNAGHKKKPVHVSVGPKSPFDYVYAATATQLH  120

Query  278  DDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSP  457
            D   VALFF + DL  G ++  HFT +SN ATFLPR  A  IPFS+ K+  + ++FS+ P
Sbjct  121  DATKVALFFLEKDLHYGTKLDAHFTTSSNQATFLPRQVADSIPFSSDKVDDVFTKFSIKP  180

Query  458  DSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
             S+EA +++ TL ECE   + GE K CATSLESMV+FS  QLGKN
Sbjct  181  GSEEAHIIENTLSECEETGIKGEGKYCATSLESMVEFSTFQLGKN  225



>ref|XP_010911557.1| PREDICTED: BURP domain-containing protein 6-like [Elaeis guineensis]
Length=294

 Score =   164 bits (415),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 105/165 (64%), Gaps = 0/165 (0%)
 Frame = +2

Query  92   AVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAILFIYTDAATEDQ  271
            AV A HAAL  + YWKSV+PNTPMP A+ D         +     + +   Y  AA    
Sbjct  14   AVEAYHAALPADVYWKSVLPNTPMPSAIHDVTRPGVFADEKWDQQDDVFAHYGHAAVTPS  73

Query  272  LHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSL  451
               DP+V +FF + DL  G +M LHF +T   AT LPR AA  IPFS+ KLP+ILSR S+
Sbjct  74   QIPDPSVTVFFLEKDLHPGAKMTLHFIRTVAGATLLPRQAADSIPFSSAKLPEILSRLSI  133

Query  452  SPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            +P S EA+ MKKTL++CE PA+ GE K CATS+E+MVDFS S LG
Sbjct  134  TPYSMEAKAMKKTLQDCEEPAIEGETKYCATSVEAMVDFSTSSLG  178



>gb|AGE46023.1| dehydration-responsive protein RD22-like isoform 2 [Elaeis guineensis]
Length=294

 Score =   164 bits (414),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 105/165 (64%), Gaps = 0/165 (0%)
 Frame = +2

Query  92   AVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAILFIYTDAATEDQ  271
            AV A HAAL  + YWKSV+PNTPMP A+ D         +     + +   Y  AA    
Sbjct  14   AVEAYHAALPADVYWKSVLPNTPMPSAIHDVTRPGVFADEKWDQQDDVFAHYGHAAVTPS  73

Query  272  LHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSL  451
               DP+V +FF + DL  G +M LHF +T   AT LPR AA  IPFS+ KLP+ILSR S+
Sbjct  74   QIPDPSVTVFFLEKDLHPGAKMTLHFIRTVAGATLLPRQAADSIPFSSAKLPEILSRLSI  133

Query  452  SPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            +P S EA+ MKKTL++CE PA+ GE K CATS+E+MVDFS S LG
Sbjct  134  TPYSMEAKAMKKTLQDCEEPAIEGETKYCATSVEAMVDFSTSSLG  178



>ref|XP_011089427.1| PREDICTED: BURP domain-containing protein 3-like [Sesamum indicum]
Length=333

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 125/214 (58%), Gaps = 33/214 (15%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAAL--SPETYWKSVIPNTPMPGAVKDSLST--AGGVGKVG  217
            MEF+ L I + LS+ +V  HA L  + E YW SV+PN+ MP AVKD L    A  +GK G
Sbjct  2    MEFKFLHILAFLSLGIVVSHATLNLASENYWNSVLPNSAMPKAVKDLLQPPPAAELGKTG  61

Query  218  VTP--------------------NAILF------IYTDAATEDQLHDD--PNVALFFKKN  313
             T                      ++L        Y +   E+QL DD  PN ALFF + 
Sbjct  62   ATTMSGGGKGVVTMGSGIEKGKRESVLINLPAPIFYRNPPGENQLQDDHDPNAALFFMEK  121

Query  314  DLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTL  493
            DL  G  MKL+F+K  N A FL R  A  +PFS+ KLP+IL  FS+ P S EAQVMKKT+
Sbjct  122  DLYPGKLMKLNFSKNGNWAPFLTRHDADSVPFSSDKLPEILRAFSVDPSSDEAQVMKKTI  181

Query  494  EECEA-PAMMGEEKLCATSLESMVDFSVSQLGKN  592
            + CE   ++ GEEKLCATSLESM+DF+ S+LGK+
Sbjct  182  QGCEQNQSVKGEEKLCATSLESMIDFATSKLGKD  215



>gb|KDO79703.1| hypothetical protein CISIN_1g018131mg [Citrus sinensis]
Length=332

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 121/214 (57%), Gaps = 33/214 (15%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF LL I + LS+A+VA HA +SPE YWK+V+PN+PMP AVKD L        ST+  V
Sbjct  1    MEFHLLPILAFLSLALVASHADISPELYWKTVLPNSPMPKAVKDLLQPDVLEDKSTSVNV  60

Query  206  GKVGVT-------PNAILFIYTDAATEDQLHDDPNVALFFKK------------------  310
            GK GV        P     +             P+                         
Sbjct  61   GKGGVNVDAGKGKPGGGTHVNVGGKGVGVNTGKPDKRTSVGVGKGGVSVSTGHKGKPVYV  120

Query  311  NDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKT  490
             DL  G +M LHFT+TSN ATFL R AA   PFS+ KLP+I ++FS+ P S EA++M+ T
Sbjct  121  GDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNT  180

Query  491  LEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            ++ECE P + GE+K CATSLESM+DFS S+LGK+
Sbjct  181  IKECEDPGIKGEQKYCATSLESMIDFSTSKLGKS  214



>gb|AAT66912.1| dehydration-induced protein RD22-like protein 1 [Gossypium arboreum]
Length=335

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 122/217 (56%), Gaps = 46/217 (21%)
 Frame = +2

Query  71   IFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLS-------------------T  193
            I + L++AVV  HAALSPE YW   +PNTPMP AVK+ L                     
Sbjct  7    ILACLALAVVVSHAALSPEQYWSYKLPNTPMPKAVKEILHPELMEEKSTSVNVGGGGVNV  66

Query  194  AGGVGKVG-------------------------VTPNAILFIYTDAATEDQLHDDPNVAL  298
              G GK G                           P+   ++Y  AA+E Q+H+DPNVAL
Sbjct  67   NTGKGKPGGDTHVNVGGKGVGVNTGKPGGGTHVNDPDPFNYLY--AASETQIHEDPNVAL  124

Query  299  FFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQV  478
            FF + D+  G  M LHF + +  + FLP   A K  FS+ KLP+I ++FS+ P S +A++
Sbjct  125  FFLEKDMHPGATMSLHFIENTEKSAFLPYQTAPKNTFSSDKLPEIFNKFSVKPGSVKAEM  184

Query  479  MKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            MK T++ECE PA+ GEEK CATSLESM+D+S+S+LGK
Sbjct  185  MKNTIKECEQPAIEGEEKYCATSLESMIDYSISKLGK  221



>ref|XP_003588558.1| BURP domain protein [Medicago truncatula]
Length=323

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 122/209 (58%), Gaps = 29/209 (14%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSP-ETYWKSVIPNTPMPGAVKDSLSTAG---------  199
            MEF L  I + L V +V  +A +SP + YWKS++PN+PMP ++ + L  AG         
Sbjct  1    MEFHLFHIITFLMVVLVGTNATVSPPQLYWKSMLPNSPMPKSITNLLHPAGYWSKEKARD  60

Query  200  --------GV------GKVGVTPNAILFIY----TDAATEDQLHDDPNVALFFKKNDLQQ  325
                    GV      G +G+      FIY        ++ QLHD  NV LFF K DL  
Sbjct  61   VSNNGLDVGVREGYEGGGIGLNDEKFPFIYFYPIILNESQIQLHDKQNVTLFFLKKDLHH  120

Query  326  GNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECE  505
            G ++ L FT  S  A FLP+  A  IPFS+ K+  IL++FS+   SKEA+++K+T+ ECE
Sbjct  121  GTKLNLQFTNNS-GAKFLPKEVANSIPFSSNKMENILNKFSIKEGSKEAEIVKRTISECE  179

Query  506  APAMMGEEKLCATSLESMVDFSVSQLGKN  592
            A  + GEEKLC TSLESMVDF++S+LG N
Sbjct  180  ANGIKGEEKLCITSLESMVDFTISKLGNN  208



>emb|CDP18475.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGVTP    F Y  AATEDQLHD+PNVALFF K DL +G  M L F K+SN ATFLPR  
Sbjct  118  VGVTPGYSPFNYLYAATEDQLHDNPNVALFFLKKDLHRGTSMNLQFVKSSNPATFLPRKV  177

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+  +P+I  +FS+ P+S EA+ +K T++ECE P + GE+K CATSLESMVDFS
Sbjct  178  ADSIPFSSKYIPEIFDKFSVKPESVEAETIKNTIKECEEPGIKGEDKYCATSLESMVDFS  237

Query  572  VSQLGKN  592
             S+LG N
Sbjct  238  TSKLGNN  244


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 10/66 (15%)
 Frame = +2

Query  56   FQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGVGK  211
             +LL I + LS+AVVA HA L  + YWKS +PNTPMP AV+D L        ST+  VGK
Sbjct  4    LKLLHICTFLSLAVVASHADL--DIYWKSKLPNTPMPKAVRDILHSEWLEDKSTSVAVGK  61

Query  212  VGVTPN  229
             GV  N
Sbjct  62   GGVNVN  67



>ref|XP_009400562.1| PREDICTED: BURP domain-containing protein 3-like [Musa acuminata 
subsp. malaccensis]
Length=353

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 121/219 (55%), Gaps = 59/219 (27%)
 Frame = +2

Query  107  HAALSPE-TYWKSVIPNTPMPGAVKDSLS-------------------------------  190
            HAALSP+  YW SV+PNTPMP A+ D +                                
Sbjct  18   HAALSPQLVYWHSVLPNTPMPSAISDFIDPDVLAEDKSGVNVYVKGKSGGTTVNVGHGGV  77

Query  191  ----------------TAGGV-------GK--VGVT-PNAILFIYTDAATEDQLHDDPNV  292
                              GGV       GK  V VT P++  FIY  AATE Q+HDDPNV
Sbjct  78   HVGTGKPGGGGTNVNVGHGGVHVNTGHKGKPRVAVTVPSSKDFIYNYAATETQIHDDPNV  137

Query  293  ALFFKKNDLQQGNQMKLHFTK-TSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKE  469
            ALFF + +L+ G +M LHFTK TS  A+FL +  A  IPFS+ KLP+IL  FS+ P S E
Sbjct  138  ALFFLEEELRSGAKMNLHFTKTTSGGASFLTQKEADAIPFSSAKLPEILDHFSVKPGSAE  197

Query  470  AQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            A+ +K TL+ECE PA+ GE K CATSLESMV+FS+S LG
Sbjct  198  AEALKTTLQECEEPAVKGERKYCATSLESMVEFSMSSLG  236



>ref|NP_001275413.1| BURP domain-containing protein precursor [Solanum tuberosum]
 gb|ACD49738.1| BURP domain-containing protein [Solanum tuberosum]
Length=365

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F+Y  AA +DQL+D+PNVALFF + DL QG+ M L F K +N A+FLPR  
Sbjct  121  VGVQPGPSPFLYNYAAKDDQLNDNPNVALFFLEKDLHQGSNMNLQFVKNANGASFLPREE  180

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ K+P+IL++FS+ PDS+E Q+MK+T++ECE P + GEEK CATSLESMVDF+
Sbjct  181  ADSIPFSSEKMPEILNQFSVDPDSEEGQIMKQTVQECEEPGIKGEEKYCATSLESMVDFT  240

Query  572  VSQLG  586
             S+LG
Sbjct  241  TSKLG  245


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG  199
            ME + L I + LS+A+VA HAAL P TYW + +PNTPMP A+K+SL  +G
Sbjct  1    MELKFLHILTYLSLALVASHAAL-PVTYWTTKLPNTPMPKAIKESLQPSG  49



>ref|XP_003588548.1| BURP domain-containing protein [Medicago truncatula]
 gb|AES58799.1| dehydration-responsive protein RD22 [Medicago truncatula]
Length=313

 Score =   162 bits (411),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 118/200 (59%), Gaps = 19/200 (10%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGV--------  205
            M+F  + IF  LS+A+VA HA L PE YWKS +P T +P A+ D L    GV        
Sbjct  1    MKFAYISIFISLSLALVATHATLPPELYWKSKLPTTQIPKAITDILHPRKGVTSVDDGKI  60

Query  206  ---GKVGVTPN-------AILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTK  355
               GK+ V          A ++ Y + A E +LHD+ N+A+F  + DL  G +  + FTK
Sbjct  61   SVDGKISVNGKTRIVYDAAPIYFYENDANEAELHDNRNLAMFLLEKDLHHGTKFNIQFTK  120

Query  356  TSNAA-TFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEK  532
            TS+   TFLP   A  IPFS+ KL  IL+ FS+   S E++++K T+ ECEA  + GEEK
Sbjct  121  TSDHGPTFLPGDVANSIPFSSNKLENILNYFSIKQGSTESEIVKNTISECEAYGIKGEEK  180

Query  533  LCATSLESMVDFSVSQLGKN  592
            LC TSLESM+DF+  +LG N
Sbjct  181  LCVTSLESMIDFTTLKLGNN  200



>emb|CDP16139.1| unnamed protein product [Coffea canephora]
Length=342

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 119/189 (63%), Gaps = 12/189 (6%)
 Frame = +2

Query  56   FQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG--GVGKVGVTPN  229
             +LL   + +S+ + A HA L  E YWKS +PNTPMP AV+D +      GVG +  +P 
Sbjct  38   LKLLCFLTSVSLGIAAEHADL--EVYWKSKLPNTPMPKAVRDIIQNGKPPGVGALSASPQ  95

Query  230  AILFIYTDAA-------TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKT-SNAATFLPR  385
            AI F Y           TE QL +  NV +FF K DL  G+ M LHF     N A FLPR
Sbjct  96   AIPFRYGRYMIRYGKNPTEGQLLNHQNVTVFFLKMDLHGGSIMNLHFVNLLENTAAFLPR  155

Query  386  SAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVD  565
              A  IPFS+  +P+IL++FS++P+S +A+ +K+T+ +CE P + GE+K CATSLESMVD
Sbjct  156  QVADSIPFSSKSVPEILNKFSVNPNSVQAEAIKETIADCEEPGIEGEDKRCATSLESMVD  215

Query  566  FSVSQLGKN  592
            F+ S+LGKN
Sbjct  216  FTTSKLGKN  224



>emb|CDP16143.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 114/179 (64%), Gaps = 14/179 (8%)
 Frame = +2

Query  92   AVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAI-----------L  238
             V A HA L  E YWKS +PNTPMP AV+D +       +V + P A             
Sbjct  16   GVGANHADL--EAYWKSELPNTPMPKAVRDLIKDGKLPERVRLRPGATPVLTTYGVRYRF  73

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAAT-FLPRSAAGKIPFSA  415
             IY    TED+LH DP V +FF K DL +G+ M + F ++  + T FLPR  A  IPFS+
Sbjct  74   SIYGRNPTEDELHIDPKVKVFFLKMDLNRGSSMNMKFVESVKSPTAFLPRQVANSIPFSS  133

Query  416  VKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
              +P+IL+++SL+P S++A ++K+T+ ECE PAM GE+K CATSLESMVDF+ S+LGK+
Sbjct  134  KSVPEILNKYSLNPQSQDAGIIKETIAECEVPAMKGEDKYCATSLESMVDFTTSKLGKD  192



>ref|XP_009400564.1| PREDICTED: BURP domain-containing protein 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=345

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 117/212 (55%), Gaps = 54/212 (25%)
 Frame = +2

Query  107  HAALSPE-TYWKSVIPNTPMPGAVK---------------DSLSTAGGVGKVGV------  220
            HAALSP+  YW SV+PNTPMP A+                 S  T   VG  GV      
Sbjct  18   HAALSPQLVYWHSVLPNTPMPSAINVLAEEKSGVNVYTKGKSGGTTVNVGHGGVHVATGK  77

Query  221  -----------------------------TPNAILFIYTDAATEDQLHDDPNVALFFKKN  313
                                          PN I +IY +AATE Q HDDPNVALFF + 
Sbjct  78   PGPGTNVNVGHGSVNENTGHKGKPRVVVTVPNRI-YIY-NAATETQTHDDPNVALFFLEK  135

Query  314  DLQQGNQMKLHFTKT-SNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKT  490
            +L+ G +M LHFTKT S  A+FL +  A  IPFS+ KLP+IL  FS+ P S EA+ MK T
Sbjct  136  ELRPGAKMNLHFTKTTSGGASFLTQKEADAIPFSSAKLPEILDHFSVKPGSAEAEAMKTT  195

Query  491  LEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            L++CE PA+ GE K CATSLESMV+FS+S LG
Sbjct  196  LQDCEEPAVRGERKYCATSLESMVEFSMSSLG  227



>ref|XP_003588464.1| Dehydration-responsive protein RD22 [Medicago truncatula]
 gb|AES58715.1| dehydration-responsive protein RD22 [Medicago truncatula]
 gb|KEH16133.1| dehydration-responsive protein RD22 [Medicago truncatula]
Length=325

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 122/215 (57%), Gaps = 38/215 (18%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAA-LSPETYWKSVIPNTPMPGAVKDSLSTAG---------  199
            M+F L+   +   + VVA +A  L P+ YWKS++P + MP A+ + L  AG         
Sbjct  1    MDFHLVHTITFFMLVVVATNATMLPPQLYWKSMLPTSLMPKAITNLLHPAGYWSEEKGTW  60

Query  200  ----------GVGK-------------VGVTPNAILFIYTDAATEDQLHDDPNVALFFKK  310
                      GV K             VG +P    F Y  AA+E QLHD PNVALFF +
Sbjct  61   VDAGKGGVDVGVRKGYYEGGGTDMNVGVGRSP----FSYNYAASETQLHDKPNVALFFLE  116

Query  311  NDLQQGNQMKLHFTKT-SNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKK  487
             DL  G ++ L FTKT SNAATFLPR  A  IPFS  K+  I+++ ++   SK  Q++K 
Sbjct  117  KDLHHGTKLNLQFTKTTSNAATFLPRQVANSIPFSLNKVEYIINKLNIKKGSKGVQIVKN  176

Query  488  TLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            T+ ECE   + GEEK+C TSLESMVDF+ S+LGKN
Sbjct  177  TISECEEQGIKGEEKVCVTSLESMVDFTTSKLGKN  211



>gb|AES58800.2| dehydration-responsive protein RD22 [Medicago truncatula]
Length=297

 Score =   159 bits (403),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 115/187 (61%), Gaps = 9/187 (5%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGG-----VGKV  214
            MEF  L IF  L++A+VA HAAL PE YWKS +P T +P A+ D L    G     VGK 
Sbjct  1    MEFPYLSIFISLNLALVATHAALPPELYWKSKLPTTQIPKAITDILHPRKGGTSMDVGKA  60

Query  215  GVTPNAILFIYTDA-ATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
                  +LFIY    A+  QLHD  N+ LFF + DL  G ++ + FTKT   ATFLPR  
Sbjct  61   RRM-QPLLFIYWPYDASVTQLHDYQNLDLFFFEKDLHNGTKLNMQFTKT--GATFLPREV  117

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ K+  IL+ FS+   S E++ +K+ +  CE P + GEEK C TSLESMVDF+
Sbjct  118  ANSIPFSSNKVENILNYFSIKQGSAESENLKQAIGYCETPTIEGEEKSCVTSLESMVDFT  177

Query  572  VSQLGKN  592
             S+LG N
Sbjct  178  TSKLGNN  184



>ref|XP_009400563.1| PREDICTED: BURP domain-containing protein 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=351

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 98/218 (45%), Positives = 118/218 (54%), Gaps = 60/218 (28%)
 Frame = +2

Query  107  HAALSPE-TYWKSVIPNTPMPGAVKD---------------------SLSTAGGVGKVGV  220
            HAALSP+  YW SV+PNTPMP A+ D                     S  T   VG  GV
Sbjct  18   HAALSPQLVYWHSVLPNTPMPSAISDFIDPDVLAEEKSGVNVYTKGKSGGTTVNVGHGGV  77

Query  221  -----------------------------------TPNAILFIYTDAATEDQLHDDPNVA  295
                                                PN I +IY +AATE Q HDDPNVA
Sbjct  78   HVATGKPGPGTNVNVGHGSVNENTGHKGKPRVVVTVPNRI-YIY-NAATETQTHDDPNVA  135

Query  296  LFFKKNDLQQGNQMKLHFTKT-SNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEA  472
            LFF + +L+ G +M LHFTKT S  A+FL +  A  IPFS+ KLP+IL  FS+ P S EA
Sbjct  136  LFFLEKELRPGAKMNLHFTKTTSGGASFLTQKEADAIPFSSAKLPEILDHFSVKPGSAEA  195

Query  473  QVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            + MK TL++CE PA+ GE K CATSLESMV+FS+S LG
Sbjct  196  EAMKTTLQDCEEPAVRGERKYCATSLESMVEFSMSSLG  233



>ref|NP_001268112.1| RD22-like protein precursor [Vitis vinifera]
 gb|AAV36561.1| RD22-like protein [Vitis vinifera]
Length=364

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +2

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAV  418
            F Y  AATEDQLHDDPNVALFF + ++Q G +M+LHF + +N ATFLPR  A  IPFS+ 
Sbjct  134  FDYKYAATEDQLHDDPNVALFFFEKNMQPGTKMELHFIRDANLATFLPRQVANSIPFSSK  193

Query  419  KLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            K P+IL+ FS+ P+S+EA+ +K T+ ECE P + GEEK CATSLESMVDFS S+LGK
Sbjct  194  KFPEILNEFSIKPESEEAETIKNTIRECEEPGIKGEEKYCATSLESMVDFSTSKLGK  250


 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 8/69 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF LL I +L+S+ V A HAAL  + YW SV+PNTPMP A++D L         T+  V
Sbjct  1    MEFHLLPILALISLVVAAGHAALPTKVYWNSVLPNTPMPKAIRDILRPDLMEEKGTSVSV  60

Query  206  GKVGVTPNA  232
            GK GV  +A
Sbjct  61   GKGGVNVHA  69



>emb|CDP16137.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 115/177 (65%), Gaps = 16/177 (9%)
 Frame = +2

Query  92   AVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAILFIYTDAA----  259
             V A HA L  E YWKS +PNTPMP AV+D L      GK     N  L  Y D+     
Sbjct  16   GVGANHADL--EAYWKSELPNTPMPKAVRDLLKD----GKWPERGNFRLKTYDDSCSFKH  69

Query  260  -----TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAAT-FLPRSAAGKIPFSAVK  421
                 TED+LH DP V +FF K DL +G+ M + F ++  + T FLPR  A  IPFS+  
Sbjct  70   YCGNPTEDELHIDPKVKVFFLKMDLNRGSSMNMKFVESVKSPTAFLPRQVANSIPFSSKS  129

Query  422  LPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            +P+IL+++SL+P S++A+++K+T+ ECE PAM GE+K CATSLESMVDF+ S+LGK+
Sbjct  130  VPEILNKYSLNPQSQDARIIKETIAECEVPAMKGEDKYCATSLESMVDFTTSKLGKD  186



>ref|XP_003588554.1| BURP domain-containing protein [Medicago truncatula]
Length=327

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 121/212 (57%), Gaps = 31/212 (15%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAA-LSPETYWKSVIPNTPMPGAVKDSLSTAGGVGK-----  211
            MEF L  I + L V +V  +A  L P+ YWKS++ N+PMP A+ + L  AG   K     
Sbjct  1    MEFHLFHIITFLMVVLVGTNAEILPPQLYWKSMLTNSPMPKAITNLLHPAGYWSKEKARD  60

Query  212  -------VGVTPNA--------------ILFIYTD-AATEDQLHDDPNVALFFKKNDLQQ  325
                   VG+                  ++F YT    ++ QLHD  NV LFF K DL  
Sbjct  61   ASNGGFDVGIRKGYEGSGTYLNDEKFIPLIFFYTLLNESQIQLHDKQNVTLFFLKKDLHH  120

Query  326  GNQMKLHFTKTS---NAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLE  496
            G ++ L F +T+   N   FLPR  A  IPFS+ KL  IL++FS+   SKEA+++K+T+ 
Sbjct  121  GTKLNLQFQETTSNNNGTKFLPREVANSIPFSSNKLENILNKFSIKEGSKEAEIVKRTIS  180

Query  497  ECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            ECEA  + GEEKLC TSLESMVDF++S+LG N
Sbjct  181  ECEANGIKGEEKLCVTSLESMVDFTISKLGNN  212



>ref|XP_003588552.1| BURP domain protein [Medicago truncatula]
 gb|AES58803.1| dehydration-responsive protein RD22 [Medicago truncatula]
Length=326

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 122/212 (58%), Gaps = 32/212 (15%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAAL-SPETYWKSVIPNTPMPGAVKDSLSTAG---------  199
            MEF L  I + L + +V  +AA+  P+ YWKS++PN+ MP A+ D L+ AG         
Sbjct  1    MEFHLFHIITSLMLVLVGTNAAIFPPQYYWKSMLPNSSMPKAITDLLNPAGYWSKEKATM  60

Query  200  ----------GVGKV----GVTPN-------AILFIYTDAATEDQLHDDPNVALFFKKND  316
                      GV KV    G   N          ++Y    ++ QLHD  NV LFF K D
Sbjct  61   VDVSKGGVDVGVRKVYEGGGTYVNDEKFPFVPFFYLYALNESQIQLHDKQNVTLFFLKKD  120

Query  317  LQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLE  496
            L  G ++ L FT  S  A FLP+  A  IPFS+ K+  IL++FS+   SKEA+++K+T+ 
Sbjct  121  LHHGTKLNLQFTNNS-GAKFLPKEVANSIPFSSNKMENILNKFSIKEGSKEAEIVKRTIS  179

Query  497  ECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            ECEA  + GEEKLC TSLESMVDF++S+LG N
Sbjct  180  ECEANGIKGEEKLCITSLESMVDFTISKLGNN  211



>ref|XP_002324250.2| hypothetical protein POPTR_0018s00850g [Populus trichocarpa]
 gb|EEF02815.2| hypothetical protein POPTR_0018s00850g [Populus trichocarpa]
Length=303

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 98/147 (67%), Gaps = 10/147 (7%)
 Frame = +2

Query  152  NTPMPGAVKDSLSTAGGVGKVGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGN  331
            NT  PG       T  GVGK GV      F+Y  AATE QLH DP VALFF + D+  G 
Sbjct  55   NTGKPGK-----GTQVGVGKGGVP-----FLYKYAATETQLHHDPTVALFFLEKDMHPGK  104

Query  332  QMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAP  511
             M L FT+ +N ATFLPR  A  IPFS+  LP+I S FS+ P S EA+VMK+T++ECE P
Sbjct  105  MMNLQFTENTNTATFLPRQVADSIPFSSNNLPEIYSEFSVKPGSTEAEVMKETIKECENP  164

Query  512  AMMGEEKLCATSLESMVDFSVSQLGKN  592
             + GEEK CATSLESM+DFS S+LGKN
Sbjct  165  GIEGEEKECATSLESMIDFSTSKLGKN  191



>emb|CDP18474.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 112/179 (63%), Gaps = 14/179 (8%)
 Frame = +2

Query  92   AVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG--GVGKVGVTPNAI---------L  238
             V A HA L  E YWKS +PNTPMP AV+D L        G   + P+A           
Sbjct  16   GVGANHADL--EAYWKSQLPNTPMPKAVRDLLKDGKLPERGNFRLKPDATPALKTYGVRF  73

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAAT-FLPRSAAGKIPFSA  415
             IY    TED+LH DP V +FF + DL +G+ M + F ++  + T FLPR  A  IPFS+
Sbjct  74   IIYGRNPTEDELHIDPKVKVFFLEKDLHRGSSMDMQFVESVKSTTAFLPREVADSIPFSS  133

Query  416  VKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
              +P+IL+RFS++P S +A+ + +T+ ECE PAM GE+K CATSLESMVDF+ S+LGKN
Sbjct  134  KSIPEILNRFSVNPRSAQAKAIMETIAECEVPAMKGEDKTCATSLESMVDFATSKLGKN  192



>ref|XP_008781671.1| PREDICTED: BURP domain-containing protein 6-like, partial [Phoenix 
dactylifera]
Length=333

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 116/217 (53%), Gaps = 52/217 (24%)
 Frame = +2

Query  89   VAVVACHAALSPETYWKSVIPNTPMPGAVKDSL---------------------------  187
            +A+ A HA+   E YW  V+PNTPMP AV D L                           
Sbjct  2    LALGASHASSPAEDYWHKVLPNTPMPSAVTDLLLHLSLSLSHTSLTVGLSIEQAVVADEK  61

Query  188  -STAGGVGKVGVT---------------PNAI--------LFIYTDAATEDQLHDDPNVA  295
              TA  VGK GV                P  +         F+Y  AAT+ Q+ D P+V 
Sbjct  62   SGTAANVGKGGVNVTGKDTSVSVGYHGRPVNVNVNPYYSGPFLYNYAATKSQIQD-PSVT  120

Query  296  LFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQ  475
            LFF + DL  G +M LHF +T+  AT LPR AA  IPFS+ KLP ILSR S++P+S EA+
Sbjct  121  LFFLEEDLHPGAKMTLHFIRTTTGATLLPRRAADSIPFSSAKLPAILSRLSIAPNSIEAK  180

Query  476  VMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            VM KTL ECE PA+ GE K CATS+ESMVDFS S LG
Sbjct  181  VMNKTLHECEEPAIDGETKYCATSVESMVDFSTSSLG  217



>ref|NP_001234521.1| BURP domain-containing protein precursor [Solanum lycopersicum]
 gb|ACD49740.1| BURP domain-containing protein [Solanum lycopersicum]
Length=365

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F+Y  AA +DQL+D+PNVALFF + DL +G+ MKL F +  N A+FLPR  
Sbjct  123  VGVHPGPSPFVYNYAAKDDQLNDNPNVALFFLEKDLHEGSNMKLKFVENGNGASFLPRQE  182

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ K+P+IL +FS+  DS+E Q+MKKT+ ECE P + GEEK CATSLESM+DF+
Sbjct  183  ADSIPFSSEKMPEILHKFSVDEDSEEGQIMKKTVRECEEPGIKGEEKYCATSLESMIDFT  242

Query  572  VSQLG  586
             S+LG
Sbjct  243  TSKLG  247


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG  199
            ME + L I + LS+A+VA HAAL P TYW + +PNTP+P A+K+SL  +G
Sbjct  1    MELKFLHILTYLSLALVASHAAL-PVTYWNTKLPNTPIPKAIKESLQPSG  49



>ref|XP_008337839.1| PREDICTED: dehydration-responsive protein RD22-like [Malus domestica]
Length=308

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 117/188 (62%), Gaps = 9/188 (5%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVA--CHAALS-PETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGV  220
            M F L  IF+LL++AVVA   HAAL   + YW SV+PNT MP A+ + L  A  + +   
Sbjct  1    MGFHLGYIFALLTLAVVALASHAALPVAQLYWNSVLPNTQMPKAISELLQPAEFIIEDKS  60

Query  221  TPNAI-----LFIYTDAATEDQLHDDPNVA-LFFKKNDLQQGNQMKLHFTKTSNAATFLP  382
            TP  +       +Y  AA   Q  +DPN A L F + +++ G  M   + + +N ATFLP
Sbjct  61   TPAEVENPDAKKMYAYAAENHQFREDPNAAALVFLEKNIRPGTTMNWPYARNTNTATFLP  120

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  I FS+ KLP+IL  FSL P S EA  +K+T++ECEAP + GEEK CATSLESM+
Sbjct  121  RRTAESIAFSSTKLPEILKHFSLEPSSVEANTIKETIQECEAPGIKGEEKYCATSLESMI  180

Query  563  DFSVSQLG  586
            DF+ S+LG
Sbjct  181  DFTTSKLG  188



>ref|NP_001236126.1| BURP domain protein 2 precursor [Glycine max]
 gb|ACN82420.1| BURP domain protein 2 [Glycine max]
Length=349

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/234 (42%), Positives = 124/234 (53%), Gaps = 54/234 (23%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVA-CHAALSPETYWKSVIPNTPMPGAVKDSLS------------  190
            MEF +L I + L + V     AAL P  YWKS +P TPMP A+ D L             
Sbjct  1    MEFHILPIITFLMLVVATNADAALPPAFYWKSKLPTTPMPKAITDLLQPDWKEEKDTSVD  60

Query  191  ----------------------------------TAGGVGK---VGVTPNAILFIYTDAA  259
                                                G  GK   VGV P++  F Y  AA
Sbjct  61   VGKGGVNVGVEKGNQGPGDGTDVNVGGGDGGVNVHTGPKGKPVHVGVGPHSP-FDYNYAA  119

Query  260  TEDQLHDDPNVALFFKKNDLQQGNQMKLHFT--KTSNA-ATFLPRSAAGKIPFSAVKLPQ  430
            +E QLHDDPNVALFF + DL  G ++ LHFT   TSN  ATFLPRS +  IPFS+ K+  
Sbjct  120  SETQLHDDPNVALFFLEKDLHHGTKLNLHFTIYYTSNVDATFLPRSVSDSIPFSSNKVND  179

Query  431  ILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            +L++FS+   S EA+ +K T+ ECE P++ GEEK C TSLESMVDF+ ++LG N
Sbjct  180  VLNKFSIKDGSDEAKTVKNTINECEGPSIKGEEKRCVTSLESMVDFATTKLGSN  233



>ref|XP_002308621.2| Dehydration-responsive protein RD22 precursor [Populus trichocarpa]
 gb|EEE92144.2| Dehydration-responsive protein RD22 precursor [Populus trichocarpa]
Length=401

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 95/137 (69%), Gaps = 3/137 (2%)
 Frame = +2

Query  191  TAGGVGK---VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTS  361
            T G  GK   VGV P    F Y  AATE QLHDDPNVALFF + D+  G  M L FT+ +
Sbjct  152  TKGHHGKPVIVGVRPGPGPFNYIYAATETQLHDDPNVALFFLEKDMHPGKIMNLQFTENT  211

Query  362  NAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCA  541
            N ATFLPR  A  IPFS+ KLP+I S FS+ P S EA  M+ T++ECE+P + GEEK CA
Sbjct  212  NTATFLPRQVADSIPFSSDKLPEIYSEFSVKPGSMEAAEMENTIKECESPGIKGEEKYCA  271

Query  542  TSLESMVDFSVSQLGKN  592
            TSLESM+DFS S+LGKN
Sbjct  272  TSLESMIDFSTSKLGKN  288


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 8/69 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF L  I + LS A+V  HAAL PE YW SV+PNTPMP +V+D L        ST+  V
Sbjct  1    MEFHLTRILAFLSFALVGSHAALPPELYWNSVLPNTPMPKSVRDLLHPDLVEDKSTSVAV  60

Query  206  GKVGVTPNA  232
            GK GV  +A
Sbjct  61   GKGGVNVDA  69



>ref|XP_008792350.1| PREDICTED: BURP domain-containing protein 3 [Phoenix dactylifera]
Length=367

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +2

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAV  418
            F Y  AATE QLHDDPNVALFF + DL+ G +M LHFT+T++ ATFLPR  A  IPFS+ 
Sbjct  133  FDYNYAATETQLHDDPNVALFFLEKDLRPGAKMNLHFTETTSGATFLPRQEADSIPFSSS  192

Query  419  KLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            KLP IL RFS+  DS EA+ MKKTL ECE PA+ GE+K CATSLESMV+FS S LG +
Sbjct  193  KLPAILDRFSIESDSVEAEAMKKTLNECEQPAVGGEKKYCATSLESMVEFSTSSLGTH  250



>gb|KDP34221.1| hypothetical protein JCGZ_07792 [Jatropha curcas]
Length=378

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F Y  AATE+QLHDDP VALFF + D+  G  M LHFT+  N ATFLPR  
Sbjct  140  VGVRPGPSPFNYVYAATENQLHDDPTVALFFLEEDMYIGKTMNLHFTENPNIATFLPRQV  199

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPF++ KLP+I + FS+ P S EA++MK T+ ECE P + GE+K CATSLESM+DFS
Sbjct  200  ANSIPFTSKKLPEIYNEFSVKPGSTEAEIMKTTIRECEEPGIKGEKKYCATSLESMIDFS  259

Query  572  VSQLGKN  592
             S LGKN
Sbjct  260  TSVLGKN  266


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL  187
            MEF L  I   +++A+   HAAL+PE YW SV+P+TPMP AV D L
Sbjct  1    MEFHLPHIILFITIALATTHAALTPELYWNSVLPDTPMPKAVTDLL  46



>ref|XP_006388094.1| hypothetical protein POPTR_0343s00200g [Populus trichocarpa]
 gb|ERP47008.1| hypothetical protein POPTR_0343s00200g [Populus trichocarpa]
Length=401

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F Y  AATE QLHDDPNVALFF + D+  G  M L FT+ +N ATFLPR  
Sbjct  162  VGVRPGPGPFNYIYAATETQLHDDPNVALFFLEKDMHPGKIMNLQFTENTNTATFLPRQV  221

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+I S FS+ P S EA  M+ T++ECE+P + GEEK CATSLESM+DFS
Sbjct  222  ADSIPFSSDKLPEIYSEFSVKPGSMEAAEMENTIKECESPGIKGEEKYCATSLESMIDFS  281

Query  572  VSQLGKN  592
             S+LGKN
Sbjct  282  TSKLGKN  288


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 8/69 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF L  I + LS A+VA HAAL PE YW SV+PNTPMP +V+D L        ST+  V
Sbjct  1    MEFHLTRILAFLSFALVASHAALPPELYWNSVLPNTPMPKSVRDLLHPDLVEDKSTSVAV  60

Query  206  GKVGVTPNA  232
            GK GV  +A
Sbjct  61   GKGGVNVDA  69



>emb|CAN75710.1| hypothetical protein VITISV_004492 [Vitis vinifera]
Length=369

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  254  AATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQI  433
            AATEDQLHDDPNVALFF + ++Q G +M+LHF + +N ATFLPR  A  IPFS+ K P+I
Sbjct  144  AATEDQLHDDPNVALFFFEKNMQPGTKMELHFIRDANLATFLPRQVANSIPFSSKKFPEI  203

Query  434  LSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            L+ FS+ P+S+EA+ +K T+ ECE P + GEEK CATSLESMVDFS S+LGK
Sbjct  204  LNEFSIKPESEEAETIKNTIRECEEPGIKGEEKYCATSLESMVDFSTSKLGK  255


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVK  178
            MEF LL I +L+S+ V A HAAL  E YW SV+PNTPMP A++
Sbjct  1    MEFHLLPILALISLVVAAGHAALPTEVYWNSVLPNTPMPKAIQ  43



>ref|XP_010112167.1| hypothetical protein L484_019906 [Morus notabilis]
 gb|EXC32792.1| hypothetical protein L484_019906 [Morus notabilis]
Length=574

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F Y  AA+E QLH+DPNVALFF + D+  G ++ LHFTK+SN ATFLPR  
Sbjct  119  VGVHPGKDPFNYLYAASETQLHEDPNVALFFLEKDVHPGAKINLHFTKSSNRATFLPRQV  178

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+IL++FS++P S+EA ++K+TL EC++P++ GEEK CATSLESM+DFS
Sbjct  179  AASIPFSSNKLPEILTKFSVTPQSEEADMIKETLNECDSPSVKGEEKYCATSLESMIDFS  238

Query  572  VSQLGKN  592
              +LGK+
Sbjct  239  TFKLGKD  245



>gb|EYU20466.1| hypothetical protein MIMGU_mgv1a020040mg, partial [Erythranthe 
guttata]
Length=311

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F Y  AATE QLHD+PNVALFF + DL  G +M L F+K ++ ATFLPR  
Sbjct  68   VGVHPGPNPFQYLYAATETQLHDNPNVALFFLEKDLHTGKKMNLKFSKATHEATFLPRQV  127

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ K P+IL +FS+   S EA++MKKT++ECE   + GEEK CATSLESMVDF+
Sbjct  128  ADSIPFSSNKFPEILDKFSVKSGSDEAEIMKKTIKECEESGLKGEEKFCATSLESMVDFT  187

Query  572  VSQLGKN  592
             S+LGKN
Sbjct  188  TSKLGKN  194



>ref|XP_006371718.1| hypothetical protein POPTR_0018s00850g [Populus trichocarpa]
 gb|ERP49515.1| hypothetical protein POPTR_0018s00850g [Populus trichocarpa]
Length=421

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F+Y  AATE QLH DP VALFF + D+  G  M L FT+ +N ATFLPR  
Sbjct  183  VGVHPGPSPFLYKYAATETQLHHDPTVALFFLEKDMHPGKMMNLQFTENTNTATFLPRQV  242

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+  LP+I S FS+ P S EA+VMK+T++ECE P + GEEK CATSLESM+DFS
Sbjct  243  ADSIPFSSNNLPEIYSEFSVKPGSTEAEVMKETIKECENPGIEGEEKECATSLESMIDFS  302

Query  572  VSQLGKN  592
             S+LGKN
Sbjct  303  TSKLGKN  309


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 44/69 (64%), Gaps = 8/69 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF +  I + L+ A+V  HAAL PE YWK+V+PNTPMP +V+D L        ST+  V
Sbjct  1    MEFHVPRILAFLAFALVVSHAALPPELYWKNVLPNTPMPKSVRDLLHPDLVEDKSTSVAV  60

Query  206  GKVGVTPNA  232
            GK GV  +A
Sbjct  61   GKGGVNVDA  69



>emb|CDP21056.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 114/178 (64%), Gaps = 10/178 (6%)
 Frame = +2

Query  83   LSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG--GVGKVGVTPNAI-LFIYTD  253
            +S  V A HA L  E YWKS +PN+PMP A++D +      GVG   V P+ I L IY  
Sbjct  13   VSTGVGAKHADL--EVYWKSKLPNSPMPKALRDIVRNGKPPGVGSFSVRPDRIPLKIYKY  70

Query  254  AA----TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN-AATFLPRSAAGKIPFSAV  418
             A    TEDQLH    V  FF K DL +G+ + + F ++ N    FLPR  A   PFS+ 
Sbjct  71   IAHYSPTEDQLHYHQKVTAFFLKKDLHRGSSVNMQFIESVNDTPAFLPRQVADSTPFSSK  130

Query  419  KLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
             +P+IL++FS++P S +A+ +KKT+ ECE PA+ GE+K CATSLESMVDF+ S+LGKN
Sbjct  131  SVPEILNKFSVNPHSAQAEAIKKTIAECEEPAIEGEDKYCATSLESMVDFTTSKLGKN  188



>ref|XP_006450616.1| hypothetical protein CICLE_v10008742mg [Citrus clementina]
 gb|ESR63856.1| hypothetical protein CICLE_v10008742mg [Citrus clementina]
Length=323

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 4/127 (3%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV+P    F Y  AA E+QLHDDPN ALFF + DL  G +M LHFT+TSN ATFL R A
Sbjct  83   VGVSP----FNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQA  138

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A   PFS+ KLP+I ++FS+ P S EA++M+ T++ECE P + GE+K CATSLESM+DFS
Sbjct  139  AKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTIKECEDPGIKGEQKYCATSLESMIDFS  198

Query  572  VSQLGKN  592
             S+LGK+
Sbjct  199  TSKLGKS  205



>gb|KDO79705.1| hypothetical protein CISIN_1g018131mg [Citrus sinensis]
Length=323

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 4/127 (3%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV+P    F Y  AA E+QLHDDPN ALFF + DL  G +M LHFT+TSN ATFL R A
Sbjct  83   VGVSP----FNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQA  138

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A   PFS+ KLP+I ++FS+ P S EA++M+ T++ECE P + GE+K CATSLESM+DFS
Sbjct  139  AKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTIKECEDPGIKGEQKYCATSLESMIDFS  198

Query  572  VSQLGKN  592
             S+LGK+
Sbjct  199  TSKLGKS  205



>gb|ABH09493.1| RD22-like protein [Knorringia sibirica]
Length=405

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    FIY  AATE QLHDDPNVALFF + DL+ GN+M LHF ++++ ATFLPR  
Sbjct  166  VGVHPGPSPFIYNYAATETQLHDDPNVALFFLQKDLKPGNKMTLHFPRSADGATFLPRHV  225

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEA-PAMMGEEKLCATSLESMVDF  568
            A  IPFS+     IL RFSL+P+S EA V+K+T++ECE   A+ GEEK CATSLESMVDF
Sbjct  226  ASSIPFSSADFSTILRRFSLAPESDEAAVVKQTIKECERNDAVSGEEKYCATSLESMVDF  285

Query  569  SVSQLG  586
            +V++LG
Sbjct  286  AVTRLG  291


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHA--ALSPETYWKSVIPNTPMPGAVKDSL  187
            MEF+L  +F + S+  +  HA   LSPE YWK V+PNTPMP A+ DSL
Sbjct  1    MEFRLPILFFICSILSLGSHADRTLSPEMYWKKVLPNTPMPKAITDSL  48



>emb|CAH59196.1| BURP-domain containing protein [Plantago major]
Length=348

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 120/229 (52%), Gaps = 56/229 (24%)
 Frame = +2

Query  62   LLGIFSLLSVAVVA--CHAALSP-ETYWKSVIPNTPMPGAVKDSLSTAGGVG--------  208
            ++ ++ +L VA+V   C  ALSP E YWK+V+PN+PMP AVK  L T  GVG        
Sbjct  1    MILVYLVLQVAIVVIRCDGALSPSERYWKAVLPNSPMPQAVKVLLPTPTGVGVDAANGRI  60

Query  209  ---KVGVTPNA-------------------------------ILFIYTDA---------A  259
                 G T  A                               I+ IY  A          
Sbjct  61   ERHAAGRTIYAAAANGKIERHAAAYTIYAAAANGRIVRHAAPIILIYAAATNGRIERANV  120

Query  260  TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILS  439
            T  QLHDDP  +LFF + D+  G +MKL F KTSN ATFLPR  A  IPFS+ + P+IL 
Sbjct  121  TGTQLHDDPTASLFFLEKDMHAGTKMKLQFVKTSNQATFLPRQVADSIPFSSKRFPEILR  180

Query  440  RFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            +F   P S EA +MK T+++CE   + GEEK CATSLESM+DF  S+LG
Sbjct  181  KF--KPTSDEADIMKDTIKDCEDEGIKGEEKFCATSLESMIDFCTSKLG  227



>ref|XP_006450615.1| hypothetical protein CICLE_v10008742mg [Citrus clementina]
 gb|ESR63855.1| hypothetical protein CICLE_v10008742mg [Citrus clementina]
Length=360

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 4/127 (3%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV+P    F Y  AA E+QLHDDPN ALFF + DL  G +M LHFT+TSN ATFL R A
Sbjct  120  VGVSP----FNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQA  175

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A   PFS+ KLP+I ++FS+ P S EA++M+ T++ECE P + GE+K CATSLESM+DFS
Sbjct  176  AKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTIKECEDPGIKGEQKYCATSLESMIDFS  235

Query  572  VSQLGKN  592
             S+LGK+
Sbjct  236  TSKLGKS  242


 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 8/69 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF+LL I + LS+A+VA HAA+SPE YWK+V+PN+PMP AVKD L        ST+  V
Sbjct  1    MEFRLLPILAFLSLALVASHAAISPELYWKTVLPNSPMPKAVKDLLQPDVLEDKSTSVNV  60

Query  206  GKVGVTPNA  232
            GK GV  +A
Sbjct  61   GKGGVNVDA  69



>ref|XP_006476150.1| PREDICTED: dehydration-responsive protein RD22-like [Citrus sinensis]
 gb|KDO79704.1| hypothetical protein CISIN_1g018131mg [Citrus sinensis]
Length=360

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 4/127 (3%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV+P    F Y  AA E+QLHDDPN ALFF + DL  G +M LHFT+TSN ATFL R A
Sbjct  120  VGVSP----FNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQA  175

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A   PFS+ KLP+I ++FS+ P S EA++M+ T++ECE P + GE+K CATSLESM+DFS
Sbjct  176  AKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTIKECEDPGIKGEQKYCATSLESMIDFS  235

Query  572  VSQLGKN  592
             S+LGK+
Sbjct  236  TSKLGKS  242


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 8/69 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF LL I + LS+A+VA HA +SPE YWK+V+PN+PMP AVKD L        ST+  V
Sbjct  1    MEFHLLPILAFLSLALVASHADISPELYWKTVLPNSPMPKAVKDLLQPDVLEDKSTSVNV  60

Query  206  GKVGVTPNA  232
            GK GV  +A
Sbjct  61   GKGGVNVDA  69



>ref|XP_011026571.1| PREDICTED: dehydration-responsive protein RD22-like [Populus 
euphratica]
Length=401

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F+Y  AATE QLH DP VALFF + D+  G  M L FT+ +N ATFLPR  
Sbjct  162  VGVHPGPNPFLYKYAATETQLHHDPTVALFFLEKDMHPGKMMNLQFTENTNTATFLPRQV  221

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+  LP+I   FS+ P S EA+VMK+T++ECE P + GEEK CATSLESM+DFS
Sbjct  222  ADSIPFSSNNLPEIYREFSVKPGSTEAEVMKETIKECENPGIEGEEKECATSLESMIDFS  281

Query  572  VSQLGKN  592
             S+LGKN
Sbjct  282  TSKLGKN  288


 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 8/69 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF +  I + L+ A+V  HAAL PE YWK+V+PNTPMP +V+D L        STA  V
Sbjct  1    MEFHVPCILAFLAFALVVSHAALPPELYWKNVLPNTPMPKSVRDLLHPDLVEDKSTAVAV  60

Query  206  GKVGVTPNA  232
            GK GV  +A
Sbjct  61   GKGGVNVDA  69



>gb|ABK95182.1| unknown [Populus trichocarpa]
Length=421

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F+Y  AATE QLH DP VALFF + D+  G  M L FT+ +N ATFLPR  
Sbjct  183  VGVHPGPSPFLYKYAATETQLHHDPTVALFFLEKDMHPGKMMNLQFTENTNTATFLPRQV  242

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
               IPFS+  LP+I S FS+ P S EA+VMK+T++ECE P + GEEK CATSLESM+DFS
Sbjct  243  TDSIPFSSNNLPEIYSEFSVKPGSTEAEVMKETIKECENPGIEGEEKECATSLESMIDFS  302

Query  572  VSQLGKN  592
             S+LGKN
Sbjct  303  TSKLGKN  309


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 8/65 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF +  I + L+ A+V  HAAL PE YWK+V+PNTPMP +V+D L        ST+  V
Sbjct  1    MEFHVPRILAFLAFALVVSHAALPPELYWKNVLPNTPMPKSVRDLLHPDLVEDKSTSVAV  60

Query  206  GKVGV  220
            GK GV
Sbjct  61   GKGGV  65



>ref|XP_002516581.1| Dehydration-responsive protein RD22 precursor, putative [Ricinus 
communis]
 gb|EEF45922.1| Dehydration-responsive protein RD22 precursor, putative [Ricinus 
communis]
Length=379

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = +2

Query  227  NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIP  406
            N   FIY  AATE QLH DPNVALFF + D+     M LHFT+  N A FLPR  A  IP
Sbjct  145  NVAPFIYNYAATETQLHHDPNVALFFLEKDMYPRKTMNLHFTENPNTAMFLPRQVAKSIP  204

Query  407  FSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            FS+ +LP+I ++FS+ P S EA++MK T++ECEAP + GEEKLCATSLESM+DFS S LG
Sbjct  205  FSSKELPEIYNQFSVKPGSMEAELMKNTIKECEAPGIEGEEKLCATSLESMIDFSTSVLG  264

Query  587  KN  592
            KN
Sbjct  265  KN  266


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 40/69 (58%), Gaps = 8/69 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF L  I   L++A+   HAAL PE YWKSV+PNT MP AV D L        ST+  V
Sbjct  6    MEFSLPCILVFLTIALATSHAALPPEVYWKSVLPNTQMPKAVTDLLQSGFMDDKSTSVSV  65

Query  206  GKVGVTPNA  232
            GK  V  NA
Sbjct  66   GKGSVNVNA  74



>gb|KHN15366.1| Dehydration-responsive protein RD22 [Glycine soja]
Length=350

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 124/235 (53%), Gaps = 55/235 (23%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVA-CHAALSPETYWKSVIPNTPMPGAVKDSLS------------  190
            MEF +L I + L + V     AAL P  YWKS +P TPMP A+ D L             
Sbjct  1    MEFHILPIITFLMLVVATNADAALPPAFYWKSKLPTTPMPKAITDLLQPDWKEEKDTSVD  60

Query  191  ----------------------------------TAGGVGK---VGVTPNAILFIYTDAA  259
                                                G  GK   VGV P++  F Y  AA
Sbjct  61   VGKGGVNVGVEKGNQGPGDGTDVNVGGGDGGVNVHTGPKGKPVHVGVGPHSP-FDYNYAA  119

Query  260  TEDQLHDDPNVALFFKKNDLQQGNQMKLHFT--KTSNA-ATFLPRSAAGKIPFSAVKLPQ  430
            +E QLHDDPNVALFF + DL  G ++ LHFT   TSN  ATFLPRS +  IPFS+ K+  
Sbjct  120  SETQLHDDPNVALFFLEKDLHHGTKLNLHFTIYYTSNGDATFLPRSVSDSIPFSSNKVND  179

Query  431  ILSRFSLSPDSKEAQVMKKTL-EECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            +L++FS+   S EA+ +K T+ +ECE P + GEEK C TSLESMVDF+ ++LG N
Sbjct  180  VLNKFSIKDGSDEAKTVKNTINDECEVPGIKGEEKRCVTSLESMVDFATTKLGSN  234



>ref|XP_009367928.1| PREDICTED: BURP domain-containing protein 3-like [Pyrus x bretschneideri]
Length=406

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGVTP    F+Y  AATE QLH DPNVA+FF + D++ G  MKLHFT  SN  TF+PR  
Sbjct  162  VGVTPGPNPFVYKYAATETQLHQDPNVAIFFLEKDMRPGTTMKLHFTTNSNTQTFVPREI  221

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+I ++FS+   S EA ++K T+ ECE PA+ GEEK CATSLESM+DFS
Sbjct  222  AESIPFSSNKLPEIFNQFSVKSGSVEADIIKGTILECENPAIRGEEKYCATSLESMIDFS  281

Query  572  VSQLG  586
             S+LG
Sbjct  282  TSKLG  286


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTA  196
            M F L  I + L++ +VACHAAL P+ YW SV+PN+ MP A+ + L  A
Sbjct  1    MGFCLPHILAFLTLTLVACHAALPPQLYWNSVLPNSKMPKAISELLQPA  49



>gb|KDP33666.1| hypothetical protein JCGZ_07237 [Jatropha curcas]
Length=317

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 121/205 (59%), Gaps = 25/205 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLST------------  193
            MEF  + +  +L+   VA +   +PE YW+S+ PNTPMP A++D L +            
Sbjct  1    MEFHFV-LTLILTWLPVAINQVQTPEVYWQSLSPNTPMPKALRDLLPSEQKSFEDNAISI  59

Query  194  --------AGGVGKVGVTP----NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQM  337
                     G    V V P    +A  F+YT  A+E +L  + NV LFF   DL  G +M
Sbjct  60   DIGGVGVDVGKGVSVDVQPPFIQDAKPFLYTYGASEYELITNRNVTLFFLYKDLHPGTKM  119

Query  338  KLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAM  517
             L+FTK +    FLPR  A  IPFS+ K  ++L +FS+ P+S +A++M+KT+EECE PA+
Sbjct  120  NLYFTKFAAKTKFLPRQVAQMIPFSSNKFSEVLHKFSIKPNSTKAEIMRKTIEECEEPAL  179

Query  518  MGEEKLCATSLESMVDFSVSQLGKN  592
            +GE+K CATSLE+MVDF +  LGKN
Sbjct  180  LGEDKYCATSLEAMVDFGILTLGKN  204



>emb|CDP16148.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 116/190 (61%), Gaps = 13/190 (7%)
 Frame = +2

Query  56   FQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG--GVGKVGVTPN  229
             +LL   + +S+ + A HA L  E YWKS +PNTPMP AV+D +      GVG +  +P 
Sbjct  38   LKLLCFLTSVSLGIAAEHADL--EVYWKSKLPNTPMPKAVRDIIQNGKPPGVGALSASPP  95

Query  230  AI--------LFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKT-SNAATFLP  382
            AI        +  Y    TE QL +  N+ +FF K DL  G+ M L F     N A FLP
Sbjct  96   AIPIRFPRYGVIRYGGNPTEGQLRNHQNLTVFFLKMDLHGGSIMNLQFVNILDNTAAFLP  155

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  IPFS+  +P+IL++FS++P+S +A+ +K+ + +CE P + GE+K CATSLESMV
Sbjct  156  RQVADSIPFSSKSVPEILNKFSVNPNSVQAEAIKELIADCEEPGIEGEDKYCATSLESMV  215

Query  563  DFSVSQLGKN  592
            DF+ S+LG N
Sbjct  216  DFTTSKLGNN  225



>gb|ADD54599.1| dehydration-responsive protein RD22 precursor [Linum usitatissimum]
Length=190

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = +2

Query  197  GGVGK---VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNA  367
            G  GK   VGV+P    F+Y  AAT+DQLHD    A+FF + D+  G  M L FT+T   
Sbjct  2    GHKGKPVYVGVSPGKNPFLYNYAATQDQLHDHTTAAIFFLEKDMHPGKVMNLDFTETPQR  61

Query  368  ATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATS  547
            ATFLPR  A  IPFS+ KLP+I + F ++P S+E + MK T++ECE+P + GEEK CATS
Sbjct  62   ATFLPRKVADSIPFSSEKLPEIFNEFEVNPKSQEGETMKNTIKECESPVIRGEEKHCATS  121

Query  548  LESMVDFSVSQLGKN  592
            LESM+DFS S+LG N
Sbjct  122  LESMIDFSTSRLGTN  136



>emb|CDP16146.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 115/196 (59%), Gaps = 19/196 (10%)
 Frame = +2

Query  56   FQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG--GVGKVGVTPN  229
             +LL     +S+ V A HA L  E YWKS +PNTPMP AV+D +      GVG +  +P 
Sbjct  40   LKLLCFLISVSLGVAAKHADL--EVYWKSKLPNTPMPKAVRDIIQNGKPPGVGGLSASPQ  97

Query  230  AI-------LFIYTDAA-------TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKT-SN  364
            AI        F Y           TE QL +  NV +FF K DL  G+ M L F     N
Sbjct  98   AIPIRFGRRYFTYGHGVVRDGKNPTEAQLRNHQNVTVFFLKRDLHWGSIMNLQFVNLLDN  157

Query  365  AATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCAT  544
             A FLPR  A  IPFS+  +P+IL++FS++PDS +A+ +K+ + +CE P +  E+K CAT
Sbjct  158  TAAFLPRQVADSIPFSSKSVPEILNKFSVNPDSVQAEAIKELIADCEEPVIEVEDKYCAT  217

Query  545  SLESMVDFSVSQLGKN  592
            SLESMVDF+ S+LGKN
Sbjct  218  SLESMVDFTTSKLGKN  233



>ref|XP_009367927.1| PREDICTED: dehydration-responsive protein RD22-like [Pyrus x 
bretschneideri]
Length=385

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    FIY  AATE QLH DPNVA+FF + D++ G  MKLHFT  SN  TF+PR  
Sbjct  141  VGVKPGESPFIYKYAATETQLHQDPNVAIFFLEKDMRPGTTMKLHFTTNSNTQTFVPRET  200

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+I ++FS+   S EA ++  T++ECE PA+ GEEK CATSLESM+DFS
Sbjct  201  AESIPFSSNKLPEIFNQFSVKSGSVEADIITGTIQECENPAIRGEEKYCATSLESMIDFS  260

Query  572  VSQLG  586
             S+LG
Sbjct  261  TSKLG  265


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTA  196
            M F L  I + L++ +VACHAAL P+ YW SV+PN+ MP A+ + L  A
Sbjct  1    MGFCLPHILAFLTLTLVACHAALPPQLYWNSVLPNSKMPKAISELLQPA  49



>ref|XP_010924753.1| PREDICTED: BURP domain-containing protein 3-like [Elaeis guineensis]
Length=367

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            V V P    F Y  AATE QLHDDPNVALFF + DL+ G +M LHFT+T++ ATFL R  
Sbjct  124  VNVRPGNSPFSYIYAATETQLHDDPNVALFFLEKDLRPGAKMNLHFTQTNSGATFLSRQE  183

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP IL +FS+  DS EA+ MKKTL+ECE PA+  E+K CATSLESM DFS
Sbjct  184  ADSIPFSSSKLPAILHQFSIESDSIEAEAMKKTLKECEEPAVGSEKKYCATSLESMADFS  243

Query  572  VSQLGKN  592
             S LG +
Sbjct  244  TSTLGTH  250



>ref|XP_011019672.1| PREDICTED: dehydration-responsive protein RD22-like [Populus 
euphratica]
Length=409

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F Y  AATE QLHDDPNVA+FF + D+  G  M + FT+ +  ATFLPR  
Sbjct  170  VGVHPGPDPFNYLYAATETQLHDDPNVAVFFLEKDMHPGKIMNMQFTENTKTATFLPRQV  229

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+I S FS+ P S EA  M+ T++ECE+P + GEEK CATSLESM+DFS
Sbjct  230  ADSIPFSSDKLPEIYSEFSVKPGSMEAAEMENTIKECESPGIKGEEKYCATSLESMIDFS  289

Query  572  VSQLGKN  592
             S+LGKN
Sbjct  290  TSKLGKN  296


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 8/69 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF L  I + LS A+V  HAAL PE YW SV+PNTPMP +V+D L        ST+  V
Sbjct  9    MEFHLTHILAFLSFALVVSHAALPPELYWNSVLPNTPMPQSVRDLLHPDLVEDKSTSVAV  68

Query  206  GKVGVTPNA  232
            GK GV  +A
Sbjct  69   GKGGVNVDA  77



>ref|XP_002284368.1| PREDICTED: dehydration-responsive protein RD22 [Vitis vinifera]
Length=297

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 115/189 (61%), Gaps = 10/189 (5%)
 Frame = +2

Query  50   MEF-QLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTP  226
            MEF + L I + LSV VV  HA+L  E YWK V+P+TPMP AVKD L    GV     + 
Sbjct  1    MEFLRPLPILAFLSVVVVVSHASLPSEGYWKLVLPHTPMPKAVKDHLQP--GVTSFNASA  58

Query  227  NAI-LFIYT------DAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPR  385
             A  L IY             Q  D  N+  FF + DL  G +M L   +T+N A FLPR
Sbjct  59   AAFCLGIYYGFNKIPQPFHAKQAQDGLNIGNFFLQTDLHPGTKMVLQLPQTTNEAMFLPR  118

Query  386  SAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVD  565
              A  IPFS+ KLP+IL+R S+   S EA++MKK +E+CE PAM GE + CATSLES++D
Sbjct  119  QVADSIPFSSKKLPEILNRLSVKEKSAEAELMKKEIEKCEEPAMDGESRFCATSLESLID  178

Query  566  FSVSQLGKN  592
            FS S+LG+N
Sbjct  179  FSTSKLGRN  187



>ref|XP_009367929.1| PREDICTED: dehydration-responsive protein RD22-like [Pyrus x 
bretschneideri]
Length=406

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGVTP    F Y  AATE QLH DPNVA+FF + D++ G  MKLHFT  SN  TF+PR  
Sbjct  162  VGVTPGKSPFSYLYAATETQLHQDPNVAIFFLEKDMRPGTTMKLHFTTNSNTQTFVPRET  221

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+I ++FS+   S EA ++  T++ECE PA+ GEEK CATSLESM+DFS
Sbjct  222  AESIPFSSNKLPEIFNQFSVKSGSVEADIITGTIQECENPAIRGEEKYCATSLESMIDFS  281

Query  572  VSQLG  586
             S+LG
Sbjct  282  TSKLG  286


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTA  196
            M F L  I + L++ +VACHAAL P+ YW SV+PN+ MP A+ + L  A
Sbjct  1    MGFFLPHILAFLTLTLVACHAALPPQLYWNSVLPNSKMPKAISELLQPA  49



>emb|CDP21613.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 122/218 (56%), Gaps = 39/218 (18%)
 Frame = +2

Query  50   MEF-QLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTA--GGVGKVGV  220
            M+F +LL   + +S+ VVA HA L  + YWKS +PNTPMP  V++ +      G G    
Sbjct  1    MDFLKLLYFLTFVSLGVVATHADL--DGYWKSKLPNTPMPKVVRELVHNGKTSGSGSFSK  58

Query  221  TPNAILFIYT----------------DAA-----------------TEDQLHDDPNVALF  301
             P+A   +YT                DAA                 T+DQL++D  + +F
Sbjct  59   LPDAGFQVYTRKSQVNGHSSSFSKLPDAAFQVYNRKSQVNSHGTNPTKDQLYNDKTITIF  118

Query  302  FKKNDLQQGNQMKLHFTKTSNAAT-FLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQV  478
            F   DL  G+ M L F ++    T FLPR  A  IPFS+  +P+IL++FSL P S+EA+ 
Sbjct  119  FLGKDLHSGSSMNLEFVESLKITTLFLPRQVADSIPFSSKSVPEILNKFSLKPQSEEAET  178

Query  479  MKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            +KKT+ ECE P   GE+K CATSLESM+DF+ S+LGK+
Sbjct  179  IKKTIAECEMPGTKGEDKYCATSLESMIDFTTSKLGKD  216



>emb|CBI20911.3| unnamed protein product [Vitis vinifera]
Length=330

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 115/189 (61%), Gaps = 10/189 (5%)
 Frame = +2

Query  50   MEF-QLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTP  226
            MEF + L I + LSV VV  HA+L  E YWK V+P+TPMP AVKD L    GV     + 
Sbjct  1    MEFLRPLPILAFLSVVVVVSHASLPSEGYWKLVLPHTPMPKAVKDHLQP--GVTSFNASA  58

Query  227  NAI-LFIYT------DAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPR  385
             A  L IY             Q  D  N+  FF + DL  G +M L   +T+N A FLPR
Sbjct  59   AAFCLGIYYGFNKIPQPFHAKQAQDGLNIGNFFLQTDLHPGTKMVLQLPQTTNEAMFLPR  118

Query  386  SAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVD  565
              A  IPFS+ KLP+IL+R S+   S EA++MKK +E+CE PAM GE + CATSLES++D
Sbjct  119  QVADSIPFSSKKLPEILNRLSVKEKSAEAELMKKEIEKCEEPAMDGESRFCATSLESLID  178

Query  566  FSVSQLGKN  592
            FS S+LG+N
Sbjct  179  FSTSKLGRN  187



>ref|XP_009338717.1| PREDICTED: BURP domain-containing protein 3-like isoform X3 [Pyrus 
x bretschneideri]
Length=406

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGVTP    F+Y  AATE QLH DPNVA+FF + D++ G  MKLHFT  S   TF+PR  
Sbjct  162  VGVTPGPNPFVYKYAATETQLHQDPNVAIFFLEKDMRPGTTMKLHFTTNSKTQTFVPRET  221

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+I ++FS+   S EA ++K T+ ECE PA+ GEEK CATSLESM+DFS
Sbjct  222  AESIPFSSNKLPEIFNQFSVKSGSVEADIIKGTILECENPAIRGEEKYCATSLESMIDFS  281

Query  572  VSQLG  586
             S+LG
Sbjct  282  TSKLG  286


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 9/70 (13%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL---------STAGG  202
            M F L  I + L++ +VACHAAL P+ YW SV+PN+ MP A+ + L         ST+  
Sbjct  1    MGFCLPHILAFLTLTLVACHAALPPQLYWNSVLPNSKMPKAISELLQPADFTEDKSTSVA  60

Query  203  VGKVGVTPNA  232
            VGK GV  +A
Sbjct  61   VGKGGVNVDA  70



>ref|XP_008378221.1| PREDICTED: LOW QUALITY PROTEIN: dehydration-responsive protein 
RD22 [Malus domestica]
Length=424

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 99/148 (67%), Gaps = 7/148 (5%)
 Frame = +2

Query  164  PGAVKDSLSTAGGV----GK---VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQ  322
            PG   +  +  GGV    GK   VGV P    F Y  AATE QLH DPNVA+FF + D+Q
Sbjct  157  PGKRTNVGAGKGGVSGHKGKLVYVGVKPGPNPFDYRYAATETQLHQDPNVAIFFLEKDMQ  216

Query  323  QGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEEC  502
            +G  M LHFT  SN ATF+ R  A  IPFS+ KLP+IL++FS+ P S E+ ++K T++EC
Sbjct  217  RGTTMNLHFTTNSNTATFVSRETAESIPFSSNKLPEILNQFSVKPGSVESDIIKXTIQEC  276

Query  503  EAPAMMGEEKLCATSLESMVDFSVSQLG  586
            E P + GE+K C TSLESM+DFS S+LG
Sbjct  277  ENPGIRGEDKYCPTSLESMIDFSTSKLG  304



>ref|XP_003588556.1| Dehydration-responsive protein RD22 [Medicago truncatula]
 gb|AES58807.1| dehydration-responsive protein RD22 [Medicago truncatula]
Length=330

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 120/215 (56%), Gaps = 34/215 (16%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAA-LSPETYWKSVIPNTPMPGAVKDSLSTAGGVGK-----  211
            MEF L  I + L + +V  +AA L P+ YW+S++PN+PMP A  + L  AG   K     
Sbjct  1    MEFHLFHIITFLMLVLVGTNAAMLPPQLYWQSMLPNSPMPKAFTNLLHPAGYWSKEKARD  60

Query  212  -------VGVTPN--------------AILFIYTDA----ATEDQLHDDPNVALFFKKND  316
                   VGV                  +++ Y        ++ QL D  NV LFF K D
Sbjct  61   ASNGGLDVGVRKGYEGGGTYLNDEKIIPLIYFYPIPIPLNESQIQLDDKQNVTLFFLKKD  120

Query  317  LQQGNQMKLHFTKTS---NAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKK  487
            L  G ++ L F +T+   N   FLPR  A  IPFS+ K+  IL++FS+   SKEA+++K+
Sbjct  121  LHHGTKLNLQFKETTSNNNGTKFLPREVANSIPFSSNKMENILNKFSIKEGSKEAEIVKR  180

Query  488  TLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            T+ ECEA  + GEEKLC TSLESMVDF++S+LG N
Sbjct  181  TISECEANGIKGEEKLCVTSLESMVDFTISKLGNN  215



>ref|XP_007211648.1| hypothetical protein PRUPE_ppa008862mg [Prunus persica]
 gb|EMJ12847.1| hypothetical protein PRUPE_ppa008862mg [Prunus persica]
Length=316

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 120/194 (62%), Gaps = 23/194 (12%)
 Frame = +2

Query  71   IFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL------STAGGVGKVGVTPNA  232
            ++ +L V V A    +S ETYW+S +P TP+P AV++ L       T G     G++ +A
Sbjct  13   LYVILLVGVFASED-VSWETYWQSALPKTPIPQAVQELLHPENWPGTEGKRTYTGISKDA  71

Query  233  ILF---------------IYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNA  367
            +                  Y  AAT  ++  + +V  FF + DL  G +M LHF KT+N 
Sbjct  72   LNINTIQSGSAFPTAGPESYAKAAT-GKIPVEQDVTTFFFEKDLHLGKKMTLHFPKTTNN  130

Query  368  ATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATS  547
            A FLPR  A   PFS+ KLP+IL+RFSL P+S EA+++K+T+EECE P++ GE+K CATS
Sbjct  131  AKFLPRLVARAQPFSSSKLPEILNRFSLKPESAEAEIVKQTIEECEEPSIEGEDKYCATS  190

Query  548  LESMVDFSVSQLGK  589
            LES+VDFSVS+LGK
Sbjct  191  LESLVDFSVSKLGK  204



>ref|XP_002514311.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF48265.1| polygalacturonase, putative [Ricinus communis]
Length=324

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 117/211 (55%), Gaps = 30/211 (14%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG----------  199
            MEF  L +  L S+ +   HA  S E YW+S++P T MP  + D L +            
Sbjct  1    MEFHFLVVLFLTSLQLAKTHAVTSQEIYWQSMLPTTLMPKVLHDLLPSEQKSDASMNFED  60

Query  200  -----GVGKV-------GVTPN--------AILFIYTDAATEDQLHDDPNVALFFKKNDL  319
                  VG +       GVT +        A  F++   A+ D+LH + NV  FF   DL
Sbjct  61   SGVDVDVGNIVSVDIGNGVTVDVEPPFFSGASPFLFNYGASRDELHSNQNVTPFFLDKDL  120

Query  320  QQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEE  499
              G +M ++FTK +  A FLPR  A  IPFS+ K  +I+ +F + P+S +A++MKKT+EE
Sbjct  121  HPGTKMNVYFTKIAADAKFLPRKVAKIIPFSSNKFSEIMRKFLVKPNSTKAEIMKKTMEE  180

Query  500  CEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            CE PA   E+K CATSLE+MVDFS S+LGK+
Sbjct  181  CEEPAFEDEDKYCATSLEAMVDFSTSKLGKD  211



>ref|XP_010049078.1| PREDICTED: dehydration-responsive protein RD22 [Eucalyptus grandis]
 gb|KCW81526.1| hypothetical protein EUGRSUZ_C02887 [Eucalyptus grandis]
 gb|KCW81527.1| hypothetical protein EUGRSUZ_C02887 [Eucalyptus grandis]
 gb|KCW81528.1| hypothetical protein EUGRSUZ_C02887 [Eucalyptus grandis]
Length=360

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = +2

Query  209  KVGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRS  388
            +VGV P    F Y  AATE QL DD NVALFF + DL+ G  M LHFTKTSN+ATFLPR 
Sbjct  120  RVGVKPGPNPFDYVYAATETQLRDDRNVALFFLEKDLKPGTTMSLHFTKTSNSATFLPRE  179

Query  389  AAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDF  568
             A  +PFS+ K+  IL  FS++P S EA++MK T++ECE P + GEEK C TSLESM+D+
Sbjct  180  EAKTLPFSSDKISDILDHFSVAPGSVEAEMMKDTIKECEEPGIKGEEKYCTTSLESMIDY  239

Query  569  SVSQLGKN  592
            +  +LG N
Sbjct  240  TSIRLGNN  247


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL  187
            MEF LL + + L+V +   HAAL+PE YWKS +PNT MP ++KD L
Sbjct  1    MEFILLRVLASLTVILATSHAALTPELYWKSKLPNTQMPKSIKDML  46



>ref|XP_003588549.1| BURP domain-containing protein [Medicago truncatula]
Length=305

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 108/176 (61%), Gaps = 9/176 (5%)
 Frame = +2

Query  83   LSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGG-----VGKVGVTPNAILFIY  247
            L +A+VA HAAL PE YWKS +P T +P A+ D L    G     VGK       +LFIY
Sbjct  20   LGLALVATHAALPPELYWKSKLPTTQIPKAITDILHPRKGGTSMDVGKARRM-QPLLFIY  78

Query  248  TDA-ATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKL  424
                A+  QLHD  N+ LFF + DL  G ++ + FTKT   ATFLPR  A  IPFS+ K+
Sbjct  79   WPYDASVTQLHDYQNLDLFFFEKDLHNGTKLNMQFTKT--GATFLPREVANSIPFSSNKV  136

Query  425  PQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
              IL+ FS+   S E++ +K+ +  CE P + GEEK C TSLESMVDF+ S+LG N
Sbjct  137  ENILNYFSIKQGSAESENLKQAIGYCETPTIEGEEKSCVTSLESMVDFTTSKLGNN  192



>ref|XP_009338715.1| PREDICTED: BURP domain-containing protein 3-like isoform X1 [Pyrus 
x bretschneideri]
Length=406

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGVTP    F Y  AATE QLH DPNVA+FF + D++ G  MKLHFT  S   TF+PR  
Sbjct  162  VGVTPGKSPFSYLYAATETQLHQDPNVAIFFLEKDMRPGTTMKLHFTTNSKTQTFVPRET  221

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+I ++FS+   S EA ++K T+ ECE PA+ GEEK CATSLESM+DFS
Sbjct  222  AESIPFSSNKLPEIFNQFSVKSGSVEADIIKGTILECENPAIRGEEKYCATSLESMIDFS  281

Query  572  VSQLG  586
             S+LG
Sbjct  282  TSKLG  286


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTA  196
            M F L  I + L++ +VACHAAL P+ YW SV+PN+ MP A+ + L  A
Sbjct  1    MGFFLPHILAFLTLTLVACHAALPPQLYWNSVLPNSKMPKAISELLQPA  49



>ref|XP_009338716.1| PREDICTED: dehydration-responsive protein RD22-like isoform X2 
[Pyrus x bretschneideri]
Length=406

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGVTP    F Y  AATE QLH DPNVA+FF + D++ G  MKLHFT  S   TF+PR  
Sbjct  162  VGVTPGKSPFSYLYAATETQLHQDPNVAIFFLEKDMRPGTTMKLHFTTNSKTQTFVPRET  221

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+I ++FS+   S EA ++K T+ ECE PA+ GEEK CATSLESM+DFS
Sbjct  222  AESIPFSSNKLPEIFNQFSVKSGSVEADIIKGTILECENPAIRGEEKYCATSLESMIDFS  281

Query  572  VSQLG  586
             S+LG
Sbjct  282  TSKLG  286


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTA  196
            M F L  I + L++ +VACHAAL P+ YW SV+PN+ MP A+ + L  A
Sbjct  1    MGFCLPHILAFLTLTLVACHAALPPQLYWNSVLPNSKMPKAISELLQPA  49



>ref|XP_002281750.2| PREDICTED: dehydration-responsive protein RD22-like isoform X5 
[Vitis vinifera]
Length=271

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 102/156 (65%), Gaps = 14/156 (9%)
 Frame = +2

Query  161  MPGAVKDSLS---TAGGV----------GKVGVTP-NAILFIYTDAATEDQLHDDPNVAL  298
            MP AVK+SL    + GGV          G VGVT     +F Y  AATEDQLH  P+VAL
Sbjct  1    MPQAVKNSLRPGVSKGGVSVSTGHEEKPGYVGVTKAKKPIFFYRYAATEDQLHAHPSVAL  60

Query  299  FFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQV  478
            FF + D++ G +M L F K +N ATFLP   A  IPFS+ KLP+IL + S+ P+S EA+ 
Sbjct  61   FFLEKDMRLGTKMNLDFMKNTNEATFLPHQVATSIPFSSDKLPEILDQLSVKPESVEAET  120

Query  479  MKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            +K T+ +C+ P + GEEK CATSLESM+DFS S+LG
Sbjct  121  IKNTIIDCDRPGIKGEEKYCATSLESMIDFSTSKLG  156



>ref|NP_001044161.1| Os01g0733500 [Oryza sativa Japonica Group]
 sp|Q942D4.1|BURP3_ORYSJ RecName: Full=BURP domain-containing protein 3; Short=OsBURP03; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAB68072.1| putative BURP domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAB89935.1| putative BURP domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF06075.1| Os01g0733500 [Oryza sativa Japonica Group]
 dbj|BAG89485.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97527.1| unnamed protein product [Oryza sativa Japonica Group]
Length=429

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  227  NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIP  406
            N   FIY  AATE QLHDDPNVALFF + DL  G  M +HFT T+    FLPRS A  +P
Sbjct  189  NVAPFIYNYAATETQLHDDPNVALFFLEKDLHPGKTMAVHFTATTAGEKFLPRSEADAMP  248

Query  407  FSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            FS+ K+P+ILSRFS+ P S EA  M +TL +CEAP   GE K CATSLESMVDF+ S LG
Sbjct  249  FSSEKVPEILSRFSVKPGSVEAAEMAQTLRDCEAPPAQGERKACATSLESMVDFATSSLG  308



>gb|AAT66913.1| dehydration-induced protein RD22-like protein 2 [Gossypium arboreum]
Length=376

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +2

Query  218  VTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAG  397
            V  N   F+Y  AA+E Q+HDDPNVALFF + DL  G  M LHFT+ +  + FLP   A 
Sbjct  139  VNVNVSPFLYQYAASETQIHDDPNVALFFLEKDLHPGATMSLHFTENTEKSAFLPYQTAQ  198

Query  398  KIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVS  577
            KIPFS+ +LP+I ++FS+ P S +A++MK T++ECE PA+ GEEK CATSLESM+D+S+S
Sbjct  199  KIPFSSNELPEIFNKFSVKPGSVKAEMMKNTIKECEQPAIEGEEKYCATSLESMIDYSIS  258

Query  578  QLGK  589
            +LGK
Sbjct  259  KLGK  262


 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  71   IFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL  187
            I + L++AVVA HAALSPE YW   +PNTPMP AVK+ L
Sbjct  7    ILACLALAVVASHAALSPEQYWSYKLPNTPMPKAVKEIL  45



>ref|XP_008380463.1| PREDICTED: dehydration-responsive protein RD22-like [Malus domestica]
Length=359

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 124/236 (53%), Gaps = 55/236 (23%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVAC------HAALSPETYWKSVIPNTPMPGAV------------  175
            M F L   FSLL++AVV        H  L  E YW SV+PNT MP A+            
Sbjct  1    MAFHLPFFFSLLNMAVVVALASQDAHPPLPHELYWNSVLPNTQMPKAISQLLQPDFMIKE  60

Query  176  -------------------KDSLSTAGG-----VGKVGVTPNAI---------LFIYTDA  256
                               +++   AGG     VGK G  P  +         L+ Y   
Sbjct  61   DMRIAVELGKGSCFDLIAGEENPRPAGGTNVDLVGKDGTKPAYVGVAQERVPFLYRYHAH  120

Query  257  ATED--QLH--DDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKL  424
            AT +  QLH  D+P   LFF    ++ G  M L+FT+ SN A FL R  A  IPFS+ +L
Sbjct  121  ATHENHQLHKDDNPQATLFFLDKGMRPGTTMNLNFTRNSNTANFLLRKTAELIPFSSNEL  180

Query  425  PQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            P+I ++FS+  +S EA ++K+T+EECEAP + GEEK CATSLESM+DF+ S+LG+N
Sbjct  181  PEIFNQFSVKSESVEANIIKQTIEECEAPGIRGEEKYCATSLESMIDFTTSKLGRN  236



>ref|XP_009373565.1| PREDICTED: dehydration-responsive protein RD22-like isoform X4 
[Pyrus x bretschneideri]
Length=359

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/236 (39%), Positives = 125/236 (53%), Gaps = 55/236 (23%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVAC------HAALSPETYWKSVIPNTPMPGAV------------  175
            M F L   FSL+ +AVV        H  L  E YW SV+PNT MP A+            
Sbjct  1    MAFHLALFFSLVKMAVVVALASQDAHPPLPHELYWNSVLPNTQMPKAISQLLQPDFMIKE  60

Query  176  -------------------KDSLSTAGG-----VGKVGVTP---------NAILFI--YT  250
                               +++   AGG     VGK G  P         NA++++  + 
Sbjct  61   DMRIPVELGKGTGFDLIAGEENPRPAGGTNVDLVGKDGTKPAYVGVAQEGNALVYLSHHA  120

Query  251  DAATEDQLH--DDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKL  424
             A  E+QLH  D+P   LFF + D++ G  M L+FT+  N A FL R  A  IPFS+ KL
Sbjct  121  HATHENQLHKDDNPQATLFFLEKDMRPGTTMNLNFTRNLNTANFLLRKTAELIPFSSNKL  180

Query  425  PQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            P+I ++FS+  +S EA ++K+T+EECEA  + GEEK C TSLESM+DF+ S+LG+N
Sbjct  181  PEIFNQFSVKSESVEANIIKQTIEECEAAGIRGEEKYCTTSLESMIDFTTSKLGRN  236



>ref|XP_007227268.1| hypothetical protein PRUPE_ppa017769mg [Prunus persica]
 gb|EMJ28467.1| hypothetical protein PRUPE_ppa017769mg [Prunus persica]
Length=335

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 120/212 (57%), Gaps = 33/212 (16%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAAL-SPETYWKSVIPNTPMPGAVK-----DSLS-------  190
            M F L  IF++LS+A V  HAA  +P+ YW SV+PNT MP ++      DS +       
Sbjct  1    MGFHLPLIFAILSLAAVGNHAAQPAPQLYWNSVLPNTQMPRSISVLLHPDSTNEEKSTYM  60

Query  191  --TAGGVGKVGVTP------------------NAILFIYTDAATEDQLHDDPNVALFFKK  310
                 G GK  + P                  N   +      +++QL    ++A+FF +
Sbjct  61   NAVGNGKGKPEIFPLGIRRYVQKRYGGGIRRYNQERYGKGPPPSDNQLLHYKDLAIFFFE  120

Query  311  NDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKT  490
             D++ G  MK  F + SN ATFLPR +A  IPFS+ KL +I + FS+ P S EA+ +K+T
Sbjct  121  KDMRPGATMKFQFPRNSNTATFLPRESAQSIPFSSNKLSEIFNHFSVKPTSVEAKTIKQT  180

Query  491  LEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            ++ECEAP + GEEK CATSLESMVDFS S+LG
Sbjct  181  IQECEAPGLKGEEKYCATSLESMVDFSTSKLG  212



>gb|KJB54854.1| hypothetical protein B456_009G052100 [Gossypium raimondii]
Length=396

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +2

Query  218  VTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAG  397
            V  N   F+Y  AA+E Q+H+DPNVALFF + D+  G  M LHFT+ +  + FLP   A 
Sbjct  159  VNVNVSPFVYNYAASETQIHEDPNVALFFLEKDMHPGATMSLHFTENTEKSAFLPYQTAQ  218

Query  398  KIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVS  577
            KIPFS+ KLP+I ++FS+ P S +A++MK T++ECE PA+ GEEK CATSLESM+D+S+S
Sbjct  219  KIPFSSDKLPEIFNKFSVKPGSLKAEMMKNTIKECEQPAIEGEEKYCATSLESMIDYSIS  278

Query  578  QLGK  589
            +LGK
Sbjct  279  KLGK  282


 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  71   IFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL  187
            I + L++AVVA HAALSPE YW   +PNTPMP AVK+ L
Sbjct  7    ILACLALAVVASHAALSPEQYWSYKLPNTPMPKAVKEIL  45



>ref|XP_010648550.1| PREDICTED: dehydration-responsive protein RD22-like isoform X4 
[Vitis vinifera]
Length=275

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 102/160 (64%), Gaps = 18/160 (11%)
 Frame = +2

Query  161  MPGAVKDSLS-------TAGGV----------GKVGVTP-NAILFIYTDAATEDQLHDDP  286
            MP AVK+SL        + GGV          G VGVT     +F Y  AATEDQLH  P
Sbjct  1    MPQAVKNSLRPGTDIGVSKGGVSVSTGHEEKPGYVGVTKAKKPIFFYRYAATEDQLHAHP  60

Query  287  NVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSK  466
            +VALFF + D++ G +M L F K +N ATFLP   A  IPFS+ KLP+IL + S+ P+S 
Sbjct  61   SVALFFLEKDMRLGTKMNLDFMKNTNEATFLPHQVATSIPFSSDKLPEILDQLSVKPESV  120

Query  467  EAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            EA+ +K T+ +C+ P + GEEK CATSLESM+DFS S+LG
Sbjct  121  EAETIKNTIIDCDRPGIKGEEKYCATSLESMIDFSTSKLG  160



>ref|XP_008220021.1| PREDICTED: dehydration-responsive protein RD22-like [Prunus mume]
Length=364

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F+Y  AATE QLH++ N A+FF + D++ G  M L F+  SN A F+PR  
Sbjct  122  VGVKPGGSPFVYKYAATETQLHENRNAAIFFLEKDIRPGTSMTLTFSGNSNTAAFVPRET  181

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+I S+FS+ P+S EA ++K T+EECE+  + GEEK CATSLESMVDFS
Sbjct  182  ADSIPFSSNKLPEIFSQFSVKPESVEADIIKGTIEECESSGIRGEEKYCATSLESMVDFS  241

Query  572  VSQLGKN  592
             S+LG N
Sbjct  242  TSKLGGN  248


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL  187
            M F+L  IF+ L++ +VA HAAL P+ YW SV+PNT MP ++ + L
Sbjct  1    MGFRLPHIFAFLTLTLVASHAALPPQLYWNSVLPNTQMPKSISELL  46



>gb|EMS48341.1| hypothetical protein TRIUR3_05844 [Triticum urartu]
Length=322

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 104/177 (59%), Gaps = 16/177 (9%)
 Frame = +2

Query  110  AALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAI--------LFIYTDAATE  265
             A +PE YWKS +P+TPMP ++   L+T+         P  I         F + DA   
Sbjct  23   GAPTPEQYWKSALPDTPMPSSLSQLLNTSSASVGEHRKPRGIAVGIWAFHYFDHYDATET  82

Query  266  DQLH--DDPNVALFFKKNDLQQGNQMK-----LHFTKTSNAA-TFLPRSAAGKIPFSAVK  421
              LH  DDP  ALFF + DL+     +     LHF  TS A   FLPRS AG IPFS+ +
Sbjct  83   HLLHMTDDPAAALFFLEKDLRMHTSRRKLTKVLHFMATSGAGERFLPRSEAGAIPFSSGE  142

Query  422  LPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            +P+ILSRFS+ PDS EA  M +TL  CEAPA  GE+K CATSLESMVDF+ S LG +
Sbjct  143  VPEILSRFSVMPDSVEAAEMARTLHVCEAPAAEGEKKWCATSLESMVDFTTSSLGTS  199



>gb|EAZ13440.1| hypothetical protein OsJ_03360 [Oryza sativa Japonica Group]
Length=429

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  227  NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIP  406
            N   FIY  AATE QLHDDPNVALFF + DL  G  M +HFT T+    FLPRS A  +P
Sbjct  189  NVAPFIYNYAATETQLHDDPNVALFFLEKDLHPGKTMAVHFTATTAGEKFLPRSEADAMP  248

Query  407  FSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            FS+ K+P+ILSRFS+ P S EA  M +TL +CEAP   G+ K CATSLESMVDF+ S LG
Sbjct  249  FSSEKVPEILSRFSVKPGSVEAAEMAQTLRDCEAPPAQGKRKACATSLESMVDFATSSLG  308



>dbj|BAK06506.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=536

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 91/137 (66%), Gaps = 8/137 (6%)
 Frame = +2

Query  200  GVGKVGVTP-------NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKT  358
            G GK G  P       N   FIY  AATE QLHDDP+ ALFF + DL  G +M +HF  T
Sbjct  280  GYGKPGGKPRGKPVHVNVSPFIYNYAATETQLHDDPSAALFFLEKDLHAGKKMSVHFMAT  339

Query  359  SNAA-TFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKL  535
              A   FLPRS A  IPFS+ K P+ILSRFS++PDS EA  MK+TL ECEA A  GE+K 
Sbjct  340  PGAGGKFLPRSEADAIPFSSEKAPEILSRFSVAPDSAEAAEMKQTLRECEAAAGKGEKKS  399

Query  536  CATSLESMVDFSVSQLG  586
            CATSLESMVDF+ S LG
Sbjct  400  CATSLESMVDFATSSLG  416



>ref|XP_008244952.1| PREDICTED: BURP domain-containing protein 3-like [Prunus mume]
Length=316

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 121/202 (60%), Gaps = 25/202 (12%)
 Frame = +2

Query  56   FQLLGIFSLLSVAV---VACHAALSPETYWKSVIPNTPMPGAVKDSL-----------ST  193
            F+L+ + S L V +   V     +S ETYW+S +P TP+P AV++ L           ST
Sbjct  4    FRLIFLSSFLYVILLVGVFASEDVSWETYWQSALPKTPIPQAVQELLHPENWPGTEGKST  63

Query  194  AGGVGKVGVTPNAI----LFI------YTDAATEDQLHDDPNVALFFKKNDLQQGNQMKL  343
              G+ K  +  N I     F       Y  AAT  ++  +  V  FF + DL  G +M L
Sbjct  64   YTGISKDALNINTIQSGSAFTTAGPESYAKAAT-GKIPVEQGVTTFFFEKDLHLGKKMTL  122

Query  344  HFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMG  523
            HF KT+N A  LP   A  +PFS+ KLP+IL+RF L P+S EA+++K+T+EECE P++ G
Sbjct  123  HFPKTTNNAKLLPLRVAKSLPFSSSKLPEILNRFLLKPESAEAEIVKQTIEECEEPSIEG  182

Query  524  EEKLCATSLESMVDFSVSQLGK  589
            E+K CATSLES+VDFSVS+LGK
Sbjct  183  EDKYCATSLESLVDFSVSKLGK  204



>gb|EAY75726.1| hypothetical protein OsI_03637 [Oryza sativa Indica Group]
Length=429

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  227  NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIP  406
            N   FIY  AATE QLHDDPNVALFF + DL  G  M +HFT  +    FLPR  A  +P
Sbjct  189  NVAPFIYNYAATETQLHDDPNVALFFLEKDLHPGKTMAVHFTAATAGEKFLPRREADAMP  248

Query  407  FSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            FS+ K+P+ILSRFS+ P S EA  M +TL +CEAP   GE K CATSLESMVDF+ S LG
Sbjct  249  FSSEKVPEILSRFSVKPGSVEAAEMAQTLRDCEAPPAQGERKACATSLESMVDFATSSLG  308



>ref|NP_001274155.1| uncharacterized protein LOC101767742 precursor [Setaria italica]
 gb|AGY78338.1| hypothetical protein [Setaria italica]
Length=460

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +2

Query  227  NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAAT-FLPRSAAGKI  403
            N   F Y  AATE QLHDDP+VALFF++ DL  G ++ + FT T+ A T FLPRS A  I
Sbjct  219  NVSPFRYNYAATETQLHDDPSVALFFQEKDLHAGKKVTVQFTGTAGAGTKFLPRSEAEAI  278

Query  404  PFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
            PFS+ K+P+ILSRFS++PDS EA  M +TL +CEAPA  GE+K CATS ESMVDF+ S L
Sbjct  279  PFSSEKVPEILSRFSVNPDSVEAAEMAQTLRDCEAPAARGEKKACATSHESMVDFATSSL  338

Query  584  G  586
            G
Sbjct  339  G  339



>gb|KJB54857.1| hypothetical protein B456_009G052200 [Gossypium raimondii]
 gb|KJB54865.1| hypothetical protein B456_009G052200 [Gossypium raimondii]
Length=286

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +2

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAV  418
            F Y  AA+E Q+H+DPNVALFF + D+  G  M LHFT+ +  + FLP   A KIPFS+ 
Sbjct  56   FNYLYAASETQIHEDPNVALFFLEKDMHPGATMSLHFTENTEKSAFLPYQTAQKIPFSSD  115

Query  419  KLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            KLP+I ++FS+ P S +A++MK T+ ECE PA+ GEEK CATSLESM+D+S+S+LGK
Sbjct  116  KLPEIFNKFSVKPGSLKAEMMKNTITECEQPAIEGEEKYCATSLESMIDYSISKLGK  172



>gb|KDP46064.1| hypothetical protein JCGZ_06575 [Jatropha curcas]
Length=308

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 114/196 (58%), Gaps = 18/196 (9%)
 Frame = +2

Query  53   EFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLS--------------  190
             F LL +F+LL V +   +A L  E YW+S++PNTP+P A+++ L               
Sbjct  3    HFHLLPVFALLCVFIRGSNAILPAELYWESMLPNTPLPNALQELLEPAEAAGNRSSFSES  62

Query  191  --TAGGVGKVGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN  364
               AG  G   VT     +  + +  ++   +     ++F   DL  G +M L FTK++N
Sbjct  63   ELQAGNQGGRRVTYGVGYWAESKSFKKNDTFN--TTTIYFLNKDLVSGKKMNLVFTKSTN  120

Query  365  AATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCAT  544
             + FLP   A  IPFS+ +LP+IL  FS+ P SKEA++MK+T+ ECEAP + GE+K CA 
Sbjct  121  GSNFLPHEIAKIIPFSSKRLPEILKHFSIKPMSKEAEIMKQTIIECEAPGITGEDKNCAI  180

Query  545  SLESMVDFSVSQLGKN  592
            SLES+VD+ +++ GKN
Sbjct  181  SLESLVDYVIAKFGKN  196



>gb|KJB54858.1| hypothetical protein B456_009G052200 [Gossypium raimondii]
Length=305

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +2

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAV  418
            F Y  AA+E Q+H+DPNVALFF + D+  G  M LHFT+ +  + FLP   A KIPFS+ 
Sbjct  75   FNYLYAASETQIHEDPNVALFFLEKDMHPGATMSLHFTENTEKSAFLPYQTAQKIPFSSD  134

Query  419  KLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            KLP+I ++FS+ P S +A++MK T+ ECE PA+ GEEK CATSLESM+D+S+S+LGK
Sbjct  135  KLPEIFNKFSVKPGSLKAEMMKNTITECEQPAIEGEEKYCATSLESMIDYSISKLGK  191



>ref|XP_007224966.1| hypothetical protein PRUPE_ppa020936mg [Prunus persica]
 gb|EMJ26165.1| hypothetical protein PRUPE_ppa020936mg [Prunus persica]
Length=353

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 124/230 (54%), Gaps = 51/230 (22%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVAC--HAAL-SPETYWKSVIPNTPMPGAV----------KDSLS  190
            M F L  IF++LS+AVVA   HAA  +P+ YW SV+PNT MP ++          ++++ 
Sbjct  1    MGFHLPLIFAILSLAVVALANHAAQPAPQLYWNSVLPNTQMPRSISELLHPDSTNEENIV  60

Query  191  TAGGVGK-----------------VGV---------------TPNAILFIYTDA------  256
             A G GK                  GV                P  I F           
Sbjct  61   NAVGNGKRKPEIFPLRNINYVQSHYGVLNRNYVQSHYKKRPPPPENIPFANRKKYALGSP  120

Query  257  ATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQIL  436
             +++QL     +A+FF + D++ G  MK  F + SN ATFLPR +A  IPFS+ KLP+I 
Sbjct  121  PSDNQLLHYKELAIFFFEKDMRPGATMKFQFPRNSNTATFLPRESAQSIPFSSNKLPEIF  180

Query  437  SRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            + FS+ P S EA+ +K+T+EECEAP   GEEK CATSLESMVDFS S+LG
Sbjct  181  NHFSVKPTSVEAKTIKQTIEECEAPGTKGEEKYCATSLESMVDFSTSKLG  230



>ref|XP_006644664.1| PREDICTED: BURP domain-containing protein 3-like [Oryza brachyantha]
Length=428

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +2

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAV  418
            FIY  AATE Q HDDPNVALFF + DL  G  M +HFT T+  A FLP+S A  +PFS+ 
Sbjct  194  FIYNYAATETQPHDDPNVALFFLEKDLHPGKTMTVHFTPTTAGAKFLPQSEADTMPFSSE  253

Query  419  KLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            K+ +ILSRFS++P S EA  M +TL +CEAPA  GE+K CATSLESMVDF+ S LG
Sbjct  254  KVSEILSRFSVNPGSVEAAEMARTLRDCEAPAAKGEKKACATSLESMVDFATSSLG  309



>gb|KJB54861.1| hypothetical protein B456_009G052200 [Gossypium raimondii]
 gb|KJB54862.1| hypothetical protein B456_009G052200 [Gossypium raimondii]
Length=325

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +2

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAV  418
            F Y  AA+E Q+H+DPNVALFF + D+  G  M LHFT+ +  + FLP   A KIPFS+ 
Sbjct  95   FNYLYAASETQIHEDPNVALFFLEKDMHPGATMSLHFTENTEKSAFLPYQTAQKIPFSSD  154

Query  419  KLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            KLP+I ++FS+ P S +A++MK T+ ECE PA+ GEEK CATSLESM+D+S+S+LGK
Sbjct  155  KLPEIFNKFSVKPGSLKAEMMKNTITECEQPAIEGEEKYCATSLESMIDYSISKLGK  211



>ref|NP_001141101.1| hypothetical protein precursor [Zea mays]
 ref|XP_008672417.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF85396.1| unknown [Zea mays]
 tpg|DAA57766.1| TPA: hypothetical protein ZEAMMB73_383806 [Zea mays]
Length=456

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +2

Query  206  GKVGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAAT-FLP  382
            GK  V  N   FIYT AA+E QLHDDP+VALFF++ DL+ G +M + F  T    T FLP
Sbjct  207  GKKPVHVNVSPFIYTYAASETQLHDDPSVALFFQETDLRPGKKMTVQFASTGTTGTKFLP  266

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            RS A  IPFS+ K+P+IL+R S+ PDS EA  M +TL +CEAPA  GE+K CATSLESMV
Sbjct  267  RSEAEAIPFSSQKVPEILARLSVDPDSVEAAEMAQTLRDCEAPAAKGEKKACATSLESMV  326

Query  563  DFSVSQLG  586
            DF+ + LG
Sbjct  327  DFATASLG  334


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 36/64 (56%), Gaps = 7/64 (11%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVK---DSLSTAGG----VG  208
            ME  + G+   L VA V  HAA +P+ YWKS +PNTPMP ++    D+    GG    VG
Sbjct  1    MERLIAGLLGFLLVASVGSHAARAPDQYWKSALPNTPMPTSLSQLLDAAPAGGGTTVNVG  60

Query  209  KVGV  220
              GV
Sbjct  61   WGGV  64



>ref|XP_010519915.1| PREDICTED: dehydration-responsive protein RD22 [Tarenaya hassleriana]
Length=396

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 89/131 (68%), Gaps = 4/131 (3%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNA----ATFL  379
            VGV P    F+Y  AA E QLHDDPNVA+FF + DL+ G  M + F +T +     A FL
Sbjct  149  VGVKPGPNPFVYNYAAKESQLHDDPNVAMFFLEKDLRPGQDMTVRFGRTDDGYGGGAVFL  208

Query  380  PRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESM  559
            PR  +  +PF + +  ++L+RF + P S EA++MKKT+EECE   + GEEK CATSLESM
Sbjct  209  PRGVSETVPFGSERFSEVLNRFGVEPGSDEAKMMKKTVEECEGRGISGEEKYCATSLESM  268

Query  560  VDFSVSQLGKN  592
            VDF VS+LGK+
Sbjct  269  VDFCVSKLGKD  279



>gb|KDP46071.1| hypothetical protein JCGZ_06582 [Jatropha curcas]
Length=308

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 113/194 (58%), Gaps = 14/194 (7%)
 Frame = +2

Query  53   EFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKV------  214
             F LL +F+LL V +   +A L  E YW+S++PNTP+P A+++ L  A   G        
Sbjct  3    HFHLLPVFALLCVFIRGSNAILPAELYWESMLPNTPLPNALQELLEPAEAAGNRSSFSES  62

Query  215  --------GVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAA  370
                    G+     +  ++++    +        ++F   DL  G +M + FTK++N +
Sbjct  63   ELQIGNIGGIRATYGVGYWSESKNFKKNETFNTTTIYFLNKDLVAGKRMNIVFTKSTNGS  122

Query  371  TFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSL  550
             FLP   A  IPFS+ +L +IL  FS+ P SKEA++MK+T++ECEAP + GE+K CA SL
Sbjct  123  NFLPHEIAKIIPFSSKRLLEILKHFSIKPMSKEAEIMKQTIKECEAPGITGEDKYCAISL  182

Query  551  ESMVDFSVSQLGKN  592
            ES+VD+ +++ GKN
Sbjct  183  ESLVDYVIAKFGKN  196



>gb|AAL26909.1|AF319165_1 dehydration-responsive protein RD22 [Prunus persica]
Length=349

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F Y  AATE QLH + N A+FF + D++ G  M L F+  SN A F+PR  
Sbjct  107  VGVKPGPNPFNYVYAATETQLHGNRNAAIFFLEKDIRPGTSMTLTFSGNSNTAAFVPRKT  166

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+I S+FS+ P+S EA ++K T+EECE+  + GEEK CATSLESMVDFS
Sbjct  167  ADSIPFSSNKLPEIFSQFSVKPESVEADIIKGTIEECESSGIRGEEKYCATSLESMVDFS  226

Query  572  VSQLGKN  592
             S+LG N
Sbjct  227  TSKLGGN  233



>ref|XP_004136300.1| PREDICTED: dehydration-responsive protein RD22-like [Cucumis 
sativus]
 ref|XP_004163504.1| PREDICTED: dehydration-responsive protein RD22-like [Cucumis 
sativus]
 gb|KGN60198.1| hypothetical protein Csa_3G888570 [Cucumis sativus]
Length=370

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTK-TSNAATFLPRS  388
            VGV P +  F+Y  AATE Q+HDDPN  LFF + DL   ++  LHF K T+    FLPR 
Sbjct  128  VGVKPGSSPFVYKYAATETQVHDDPNTVLFFLEKDLHPRSKFTLHFPKQTTTTTKFLPRR  187

Query  389  AAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDF  568
             A  +PFS+ KLPQIL+ FS+ P S EA+ ++ T+++CEAP ++ E+K CATSLESMVDF
Sbjct  188  VAKSLPFSSQKLPQILTHFSIPPTSLEAESIRNTIDQCEAPGIVSEDKFCATSLESMVDF  247

Query  569  SVSQLGK  589
            S S++GK
Sbjct  248  STSKMGK  254



>emb|CDM84063.1| unnamed protein product [Triticum aestivum]
Length=453

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = +2

Query  227  NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAA-TFLPRSAAGKI  403
            N   F+Y  AATE Q+HDDP+ ALFF + DL  G +M +HF  T  A   FLPRS A  I
Sbjct  215  NVSPFMYNYAATETQMHDDPSAALFFLEKDLHAGKKMNVHFMATPGAGEKFLPRSEADTI  274

Query  404  PFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
            PFS+ K+P+ILSRFS++PDS EA  MK+TL ECEA A  GE+K CATSLESMVDF+ S L
Sbjct  275  PFSSEKVPEILSRFSVAPDSVEAAEMKQTLRECEAAADNGEKKSCATSLESMVDFATSSL  334

Query  584  G  586
            G
Sbjct  335  G  335


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 7/58 (12%)
 Frame = +2

Query  68   GIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVK---DSLSTAGG----VGKVGV  220
            GI   L +A V  HAA +PE YWKS +PNTPMP ++    ++ +TAGG    +G  GV
Sbjct  8    GILGFLLIASVGSHAARAPEQYWKSALPNTPMPSSLSQLLNNQATAGGTSVNIGSGGV  65



>ref|XP_008466264.1| PREDICTED: dehydration-responsive protein RD22 isoform X2 [Cucumis 
melo]
Length=370

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = +2

Query  152  NTPMPGAVKDSLSTA-GGV-------GK---VGVTPNAILFIYTDAATEDQLHDDPNVAL  298
            NTP P     S++   GGV       GK   VGV P    F Y  AATE Q+HDDPN AL
Sbjct  95   NTPKPKQGGTSVNVGKGGVNVHTGRKGKPVYVGVKPGYSPFNYVYAATETQVHDDPNTAL  154

Query  299  FFKKNDLQQGNQMKLHFTK--TSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEA  472
            FF + DL   ++  LHF K  T+    FLPR  A  +PFS+ KLPQIL+ FS+ P S EA
Sbjct  155  FFLEKDLNPNSKFTLHFPKQTTTTTTKFLPRRVAKSLPFSSQKLPQILTHFSIPPASLEA  214

Query  473  QVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            + ++ T+++CEAP ++GE+K CATSLESMVDFS S+LGK
Sbjct  215  ESIRNTIDQCEAPGIVGEDKFCATSLESMVDFSTSKLGK  253



>ref|XP_002522982.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF39412.1| polygalacturonase, putative [Ricinus communis]
Length=305

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 115/194 (59%), Gaps = 16/194 (8%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSP-ETYWKSVIPNTPMPGAVKDSLSTAG---------  199
            MEF LL IF L    +     +  P E YW+S++PNTP+P ++ + +             
Sbjct  1    MEFPLLPIFLLFCFLLKGSDTSQLPAEMYWQSMLPNTPIPKSLYNLIQPGTQSNFSEVEI  60

Query  200  GVGKVGVTPN----AILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNA  367
             VG++G  P      + ++  DA  +  + +   V  +F  NDL  G +M L FTK++N 
Sbjct  61   DVGRLGQVPRRADYGVGYVNNDAHQKSNVENSTTV--YFLYNDLFPGKKMMLIFTKSTNG  118

Query  368  ATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATS  547
            + FLPR  A  IPFS+ K  +IL+ FS+ P SK++Q++K+T+EECE P + GEEK CATS
Sbjct  119  SNFLPRKIAETIPFSSNKFSEILNYFSIEPASKQSQIVKQTIEECETPGVKGEEKYCATS  178

Query  548  LESMVDFSVSQLGK  589
            LES+VDF V++ GK
Sbjct  179  LESLVDFVVAKFGK  192



>ref|XP_008245112.1| PREDICTED: dehydration-responsive protein RD22-like [Prunus mume]
Length=339

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 118/218 (54%), Gaps = 39/218 (18%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAAL---SPETYWKSVIPNTPMPGAVKD-----------SL  187
            M F L  IF++LS+A VA        +P+ YW SV+PNT MP ++ +           S 
Sbjct  1    MGFHLPLIFAILSLAAVALANHAAQPAPQLYWNSVLPNTQMPRSISELLHPDSKNEEKST  60

Query  188  STAGGVGKVGVTP------------------------NAILFIYTDAAT-EDQLHDDPNV  292
            +    VGK  + P                          I   Y   A+  D L    N+
Sbjct  61   NMVNAVGKPEIFPLGNKHYVQKHYGRGEPEIFPLGNKRYIQKHYGKGASPSDNLLHYKNI  120

Query  293  ALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEA  472
            A+FF + D++ G  +   F + SN ATFLPR +A  IPFS+ KLP+I + FS+ P S EA
Sbjct  121  AIFFLEKDMRPGTTLNYQFLRNSNTATFLPRESAQSIPFSSNKLPEIFNHFSVKPTSVEA  180

Query  473  QVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            + +K+T+EECEAP +MGEEK CATSLESMVDFS S+LG
Sbjct  181  KTIKETIEECEAPGLMGEEKYCATSLESMVDFSTSKLG  218



>ref|XP_008466262.1| PREDICTED: dehydration-responsive protein RD22 isoform X1 [Cucumis 
melo]
Length=391

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = +2

Query  152  NTPMPGAVKDSLSTA-GGV-------GK---VGVTPNAILFIYTDAATEDQLHDDPNVAL  298
            NTP P     S++   GGV       GK   VGV P    F Y  AATE Q+HDDPN AL
Sbjct  116  NTPKPKQGGTSVNVGKGGVNVHTGRKGKPVYVGVKPGYSPFNYVYAATETQVHDDPNTAL  175

Query  299  FFKKNDLQQGNQMKLHFTK--TSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEA  472
            FF + DL   ++  LHF K  T+    FLPR  A  +PFS+ KLPQIL+ FS+ P S EA
Sbjct  176  FFLEKDLNPNSKFTLHFPKQTTTTTTKFLPRRVAKSLPFSSQKLPQILTHFSIPPASLEA  235

Query  473  QVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            + ++ T+++CEAP ++GE+K CATSLESMVDFS S+LGK
Sbjct  236  ESIRNTIDQCEAPGIVGEDKFCATSLESMVDFSTSKLGK  274



>gb|KHF97444.1| Dehydration-responsive RD22 -like protein [Gossypium arboreum]
Length=299

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +2

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAV  418
            F Y  AA+E Q+H+DPNVALFF + D+  G  M LHF + +  + FLP   A KIPFS+ 
Sbjct  69   FNYLYAASETQIHEDPNVALFFLEKDMHPGATMSLHFIENTEKSAFLPYQTAQKIPFSSD  128

Query  419  KLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            KLP+I ++FS+ P S +A++MK T++ECE PA+ GEEK CATSLESM+D+S+S+LGK
Sbjct  129  KLPEIFNKFSVKPGSVKAEMMKNTIKECEQPAIEGEEKYCATSLESMIDYSISKLGK  185



>gb|EPS58650.1| hypothetical protein M569_16161, partial [Genlisea aurea]
Length=279

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDL-QQGNQMKLHFTK--TSNAATFLP  382
            VGV P    F Y  AA+E Q+HDDPNVALFF + DL  +G  M L F++    N   F+P
Sbjct  34   VGVHPGPDPFNYEYAASETQIHDDPNVALFFLEGDLYTKGKTMNLDFSRGEEENQPAFIP  93

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  IPFS+ KLP+IL  FS+ PDSKEA+ M+KTL  CE     GE K CATSLESM+
Sbjct  94   RRVADSIPFSSEKLPEILKEFSVKPDSKEAESMRKTLRNCEDKPARGEAKFCATSLESML  153

Query  563  DFSVSQLGK  589
            DFSVS+LGK
Sbjct  154  DFSVSRLGK  162



>ref|XP_007221784.1| hypothetical protein PRUPE_ppa005699mg [Prunus persica]
 gb|EMJ22983.1| hypothetical protein PRUPE_ppa005699mg [Prunus persica]
Length=447

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F Y  AATE QLH + N A+FF + D++ G  M L F+  SN A F+PR+ 
Sbjct  205  VGVKPGPNPFNYVYAATETQLHGNRNAAIFFLEKDIRPGTSMTLTFSGNSNTAAFVPRTT  264

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS+ KLP+I S+FS+ P+S EA ++K T+EECE+  + GEEK CATSLESMVDFS
Sbjct  265  ADSIPFSSNKLPEIFSQFSVKPESVEADIIKGTIEECESSGIRGEEKYCATSLESMVDFS  324

Query  572  VSQLGKN  592
             S+LG N
Sbjct  325  TSKLGGN  331


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  47   SMEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL  187
            SM F+L  IF+ L++ +VA HAAL P+ YW SV+PNT MP ++ + L
Sbjct  83   SMGFRLPHIFAFLTLTLVASHAALPPQLYWNSVLPNTQMPKSISELL  129



>ref|XP_007227242.1| hypothetical protein PRUPE_ppa018182mg [Prunus persica]
 gb|EMJ28441.1| hypothetical protein PRUPE_ppa018182mg [Prunus persica]
Length=297

 Score =   141 bits (355),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 100/162 (62%), Gaps = 12/162 (7%)
 Frame = +2

Query  119  SPETYWKSVIPNTPMPGAVKD-----SLSTAGGVGKVGVTPNAILFIYT--DAATEDQLH  277
            +P+ YW SV+PNT MP A+ +      ++T   +  +   P    F Y   D  T++QLH
Sbjct  17   APQLYWNSVLPNTQMPRAISELLHPVRMATYSQMCHLARRP----FSYKSDDRPTDNQLH  72

Query  278  DDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSP  457
               NVA+FF + D++ G  M   F + SN ATFLP   A  IPFS+ KLP+I + FS+ P
Sbjct  73   YK-NVAIFFLEKDMRPGTTMSFQFPRNSNTATFLPPERAQSIPFSSNKLPEIFNHFSVKP  131

Query  458  DSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
             S EA+ +K+T+EECEAP + GEE  CATSLESMVDFS S  
Sbjct  132  TSVEAKTIKQTIEECEAPGIKGEEIYCATSLESMVDFSTSNF  173



>dbj|BAH56805.1| AT5G25610 [Arabidopsis thaliana]
Length=365

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAA---TFLP  382
            VGV P A  F+Y  AA E QLHDDPN ALFF + DL +G +M + F           FLP
Sbjct  120  VGVKPGANPFVYNYAAKETQLHDDPNAALFFLEKDLVRGKEMNVRFNAEDGYGGKTAFLP  179

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  + L RFS+   S+EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  180  RGEAETVPFGSEKFSETLKRFSVDAGSEEAEMMKKTIEECEARKVSGEEKYCATSLESMV  239

Query  563  DFSVSQLGK  589
            DFSVS+LGK
Sbjct  240  DFSVSKLGK  248



>ref|XP_008226517.1| PREDICTED: dehydration-responsive protein RD22-like [Prunus mume]
Length=326

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 105/177 (59%), Gaps = 23/177 (13%)
 Frame = +2

Query  119  SPETYWKSVIPNTPMPGAV-----------KDSLSTAGGVGKVGVT---------PNAIL  238
            +P+ YW S++PNT MP A+           K S +    VG    T         P A++
Sbjct  27   APQIYWNSILPNTQMPRAISELLHPDSTNEKKSTNIMNAVGNGKPTDHKGKPENIPLALI  86

Query  239  FIYT--DAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFS  412
            F     D  T++QLH   NVA+FF + D++ G  M   F + SN  TFLPR +A  IPFS
Sbjct  87   FYNREYDHPTDNQLHYK-NVAIFFLEKDMRPGATMNFQFPRNSNTDTFLPRKSAQSIPFS  145

Query  413  AVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
            + KL +I + FS+ P S EA+ +K+T+EECEAP + GEEK CATSLESM+DFS S+L
Sbjct  146  SNKLSEIFNHFSVKPTSVEAKTIKQTIEECEAPGIKGEEKYCATSLESMIDFSTSKL  202



>ref|XP_009345258.1| PREDICTED: BURP domain-containing protein 3-like [Pyrus x bretschneideri]
Length=298

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 116/193 (60%), Gaps = 23/193 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALS--PETYWKSVIPNTPMPGAVKDSLS-TAGGVGK--V  214
            M F L  I +  ++ +V  HAAL   PE YW SV+PNTPMP  + + +   +GG      
Sbjct  1    MGFILSRILAFFTLTLVRVHAALPLPPELYWNSVLPNTPMPKTLSELIQPESGGTATNFA  60

Query  215  GVTPNA------ILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTK-TSNAAT  373
            G  P +      + F+Y  +A+           LFF +  ++ G  MK  F++ TS  A 
Sbjct  61   GYNPQSFMASRLLFFLYNRSAS-----------LFFLEEAVRPGITMKYSFSRNTSTPAM  109

Query  374  FLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLE  553
            FLPR  A  +PFS+ KLP+IL+RFSL P S +A +MK+TL+ CE+ A+ GE++ CATSLE
Sbjct  110  FLPREIAESVPFSSSKLPEILNRFSLKPGSVQADIMKQTLQTCESTAIPGEQRYCATSLE  169

Query  554  SMVDFSVSQLGKN  592
            S+VD++ ++LG+N
Sbjct  170  SLVDYATAKLGRN  182



>ref|XP_010667747.1| PREDICTED: dehydration-responsive protein RD22-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010667751.1| PREDICTED: dehydration-responsive protein RD22-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=407

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VGV P    F Y  AA+E QL+DDP  ALFF + D++ GN M LHFT T NAATFLPR  
Sbjct  167  VGVHPGPNPFGYNYAASEAQLNDDPTRALFFLEKDMKTGNSMNLHFTSTINAATFLPREV  226

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  + FS+ K+  IL  FS++P+S+EA+++++T++ECEA  + GE+K CATSLESM+D++
Sbjct  227  AKSLDFSSDKISAILKEFSITPNSEEAKMIEETIKECEAKGIQGEQKHCATSLESMIDYA  286

Query  572  VSQLGKN  592
             + LGKN
Sbjct  287  KNTLGKN  293


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 9/66 (14%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL---------STAGG  202
            ME  +L I + LSVA+V C AAL PE YWK ++PNT MP AVK SL         ST+  
Sbjct  1    MELHILPILTFLSVALVVCQAALPPEIYWKKMLPNTDMPKAVKISLPKPEYMEDKSTSVN  60

Query  203  VGKVGV  220
            VGK GV
Sbjct  61   VGKGGV  66



>ref|NP_197943.1| dehydration-responsive protein RD22 [Arabidopsis thaliana]
 sp|Q08298.1|RD22_ARATH RecName: Full=Dehydration-responsive protein RD22; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA01546.1| rd22 [Arabidopsis thaliana]
 gb|AAL31189.1| AT5g25610/T14C9_150 [Arabidopsis thaliana]
 gb|AAL90908.1| AT5g25610/T14C9_150 [Arabidopsis thaliana]
 gb|AAP88331.1| At5g25610/T14C9_150 [Arabidopsis thaliana]
 gb|AED93472.1| dehydration-responsive protein RD22 [Arabidopsis thaliana]
 prf||1913421A rd22 gene
Length=392

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAA---TFLP  382
            VGV P A  F+Y  AA E QLHDDPN ALFF + DL +G +M + F           FLP
Sbjct  147  VGVKPGANPFVYNYAAKETQLHDDPNAALFFLEKDLVRGKEMNVRFNAEDGYGGKTAFLP  206

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  + L RFS+   S+EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  207  RGEAETVPFGSEKFSETLKRFSVEAGSEEAEMMKKTIEECEARKVSGEEKYCATSLESMV  266

Query  563  DFSVSQLGK  589
            DFSVS+LGK
Sbjct  267  DFSVSKLGK  275



>gb|EMT06192.1| hypothetical protein F775_17404 [Aegilops tauschii]
Length=266

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 107/176 (61%), Gaps = 17/176 (10%)
 Frame = +2

Query  110  AALSPETYWKSVIPNTPMPGAVKDSLST----AGGVGKVGVTPNAIL-FIYTDA--ATED  268
             A +PE YWKS +P+TPMP ++   LST    AG   K G T   I  F Y D   ATE 
Sbjct  22   GAPTPEQYWKSALPDTPMPSSLSQLLSTSSASAGEHRKPGGTAVGIWAFHYFDHYDATET  81

Query  269  QLH---DDPNVALFFKKNDLQQGNQMK------LHFTKTSNAA-TFLPRSAAGKIPFSAV  418
             L    DDP+ ALFF + DLQ     +      LHF  TS A   FLPRS A  IPFS+ 
Sbjct  82   HLQHIADDPSAALFFLEKDLQMHYTGRKKLTKVLHFMATSGAGERFLPRSEADAIPFSSG  141

Query  419  KLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            ++P+ILSRFS+ P+S EA  M +TL  CEAPA  GE+K CATSLESMVDF+ S LG
Sbjct  142  QVPEILSRFSVKPNSPEAAGMARTLHVCEAPAAEGEKKWCATSLESMVDFATSSLG  197



>ref|XP_002456304.1| hypothetical protein SORBIDRAFT_03g033760 [Sorghum bicolor]
 gb|EES01424.1| hypothetical protein SORBIDRAFT_03g033760 [Sorghum bicolor]
Length=502

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 2/122 (2%)
 Frame = +2

Query  227  NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQ-GNQMKLHFTKTSNA-ATFLPRSAAGK  400
            NA  F Y  AA+E QLHDDP+VALFF++ DLQQ G ++ + F  T+ A A FLPRS A  
Sbjct  260  NAGPFQYLYAASETQLHDDPSVALFFQEKDLQQPGKKVTVQFANTATAGAKFLPRSDAEA  319

Query  401  IPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQ  580
            IPFS+ K+P+ILSRFS+ PDS EA  M +TL +CEAPA  GE+K CATSLESMVDF+ + 
Sbjct  320  IPFSSEKVPEILSRFSVDPDSVEAAEMAQTLRDCEAPAAKGEKKACATSLESMVDFATTS  379

Query  581  LG  586
            LG
Sbjct  380  LG  381


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGV  220
            ME  + G+   L +A V  HAA +P+ YWKS +P+TPMP ++   L+T  G   V V
Sbjct  1    MERLIAGLLGFLLIASVGSHAARAPDQYWKSALPDTPMPTSLSQLLNTPAGGTTVNV  57



>gb|ACU20207.1| unknown [Glycine max]
Length=367

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTK---TSNAATFLP  382
            VGV P++  F Y  AA+E Q HDDPNVALFF + DL  G ++ LHFT+   +S  A+FLP
Sbjct  123  VGVGPHS-PFDYNYAASETQWHDDPNVALFFLEKDLHYGTKLNLHFTRYFTSSVDASFLP  181

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            RS A  IPFS+ K+ ++L++FS+   S EAQ +K T+ ECE P + GEEK C TSLESMV
Sbjct  182  RSVADSIPFSSNKVNEVLNKFSIKEGSDEAQTVKNTISECEVPGIKGEEKRCVTSLESMV  241

Query  563  DFSVSQLGKN  592
            DF+ ++LG N
Sbjct  242  DFATTKLGSN  251


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 9/70 (13%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHA-ALSPETYWKSVIPNTPMPGAVKDSL--------STAGG  202
            M F LL IF+LL++AVVA HA  L PE YWKS +P TPMP A+ D L        ST+  
Sbjct  1    MVFPLLSIFALLNLAVVATHAETLPPEVYWKSKLPTTPMPKAITDILHPDLAEDKSTSVA  60

Query  203  VGKVGVTPNA  232
            VGK GV  NA
Sbjct  61   VGKGGVNVNA  70



>gb|KHN15367.1| Dehydration-responsive protein RD22 [Glycine soja]
Length=367

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTK---TSNAATFLP  382
            VGV P++  F Y  AA+E Q HDDPNVALFF + DL  G ++ LHFT+   +S  A+FLP
Sbjct  123  VGVGPHS-PFDYNYAASETQWHDDPNVALFFLEKDLHYGTKLNLHFTRYFTSSVDASFLP  181

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            RS A  IPFS+ K+ ++L++FS+   S EAQ +K T+ ECE P + GEEK C TSLESMV
Sbjct  182  RSVADSIPFSSNKVNEVLNKFSIKEGSDEAQTVKNTISECEVPGIKGEEKRCVTSLESMV  241

Query  563  DFSVSQLGKN  592
            DF+ ++LG N
Sbjct  242  DFATTKLGSN  251


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 9/70 (13%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHA-ALSPETYWKSVIPNTPMPGAVKDSL--------STAGG  202
            M F LL IF+LL++AVVA HA  L PE YWKS +P TPMP A+ D L        ST+  
Sbjct  1    MVFPLLSIFALLNLAVVATHAETLPPEVYWKSKLPTTPMPKAITDILHPDLAEDKSTSVA  60

Query  203  VGKVGVTPNA  232
            VGK GV  NA
Sbjct  61   VGKGGVNVNA  70



>ref|NP_001132751.1| hypothetical protein precursor [Zea mays]
 gb|ACF81734.1| unknown [Zea mays]
 gb|AFW85142.1| hypothetical protein ZEAMMB73_186505 [Zea mays]
Length=375

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +2

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNA-ATFLPRSAAGKIPFSA  415
            F Y  AA+E QLHDDP+VALFF++ DLQ G +  + F  T+ A A FLPRS A  IPFS+
Sbjct  142  FQYEYAASETQLHDDPSVALFFREEDLQPGKKTTVQFANTAMAGAKFLPRSDAEAIPFSS  201

Query  416  VKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
             K+P+IL RFS+ PDS EA  M +TL +CEAPA  GE K CATSLESMVDF+ + LG
Sbjct  202  EKVPEILGRFSVDPDSVEAAEMAQTLHDCEAPAARGERKACATSLESMVDFATASLG  258



>ref|XP_008356193.1| PREDICTED: LOW QUALITY PROTEIN: dehydration-responsive protein 
RD22-like [Malus domestica]
Length=369

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 94/144 (65%), Gaps = 4/144 (3%)
 Frame = +2

Query  167  GAVKDSLS-TAGGVGK---VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQ  334
            G  K+ +S   G  GK   VGV     LF Y  AAT+ QLH D NVA+FF + D++ G  
Sbjct  122  GVGKEGMSVNIGHKGKPVYVGVKLGPDLFNYXYAATKTQLHQDSNVAIFFLEKDIRPGTT  181

Query  335  MKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPA  514
            M LHFT  SN  TF+P   A  IP S+ KLP+I ++FS+   S EA ++K T++ECE PA
Sbjct  182  MNLHFTTNSNTQTFMPHETAKSIPLSSNKLPEIFNQFSMKSGSVEADIIKGTIQECENPA  241

Query  515  MMGEEKLCATSLESMVDFSVSQLG  586
            + GEEK CATSLESM+DFS S+LG
Sbjct  242  IRGEEKYCATSLESMIDFSTSKLG  265



>ref|XP_004306762.1| PREDICTED: dehydration-responsive protein RD22-like [Fragaria 
vesca subsp. vesca]
Length=316

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 117/198 (59%), Gaps = 18/198 (9%)
 Frame = +2

Query  53   EFQLLGIFSLLSVAVVAC--------HAALSPETYWKSVIPNTPMP-GAVKDSLSTAG--  199
            +F+LL +FS+  VA V          + A S   YW S +P +P+P  AV+  L+  G  
Sbjct  3    QFRLLCMFSIFYVASVVVGIGYANKVNDAKSWMFYWNSALPKSPLPTKAVQQVLNPVGER  62

Query  200  ---GVGKVGVTPNAILFIYTDAA--TEDQLHDDPNVALFFKKNDLQQ-GNQMKLHFTK-T  358
               G+G+  + P     +Y   +  + ++ + +P +  FF+ NDLQ  G  + + F K T
Sbjct  63   SYAGIGRDAINPAVSCLVYHSHSIGSAEEFNVEPGLTTFFQGNDLQHSGKTVTMRFLKPT  122

Query  359  SNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLC  538
            SN A  LPR  A  IPFS+ KLP+IL+ F + P S  A++MKKT+E CE PA+  E+K C
Sbjct  123  SNKAALLPRQVAKSIPFSSSKLPEILTYFRVKPKSGYAEIMKKTIEGCEKPAIKAEDKYC  182

Query  539  ATSLESMVDFSVSQLGKN  592
            ATSLES++DF VS+LGK+
Sbjct  183  ATSLESLIDFMVSKLGKH  200



>ref|XP_010925837.1| PREDICTED: BURP domain-containing protein 3-like isoform X2 [Elaeis 
guineensis]
Length=254

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  245  YTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKL  424
            Y  AAT+ Q+ D P+ A++F + DL  G +M  HF +T   AT LPR AA  IPFS+ KL
Sbjct  26   YRTAATQSQIQD-PSEAIYFLEKDLHPGARMTFHFIRTITGATLLPRQAADSIPFSSAKL  84

Query  425  PQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            P+ILSR S++P+S EA+ MKKTL+ECE PAM GE K CATS+E+MVDFS S LG
Sbjct  85   PEILSRLSITPNSIEAEAMKKTLQECEKPAMEGETKYCATSVEAMVDFSTSSLG  138



>emb|CDY54896.1| BnaC02g48560D [Brassica napus]
Length=387

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN---AATFLP  382
            VGVTP    F+Y  AA+E QLHDDP  ALFF + D+  G  M L F           FLP
Sbjct  142  VGVTPGPNPFVYNYAASETQLHDDPKAALFFLEKDMVPGKAMNLRFNAEDGYDGKTAFLP  201

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  +IL+ FS+ P S+EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  202  RGEAETVPFGSEKFSEILNTFSVKPGSEEAEMMKKTIEECEAKRVGGEEKYCATSLESMV  261

Query  563  DFSVSQLGK  589
            DFSVS+LGK
Sbjct  262  DFSVSKLGK  270



>ref|XP_009129951.1| PREDICTED: dehydration-responsive protein RD22-like [Brassica 
rapa]
Length=387

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN---AATFLP  382
            VGVTP    F+Y  AA+E QLHDDP  ALFF + D+  G  M L F           FLP
Sbjct  142  VGVTPGPNPFVYNYAASETQLHDDPKAALFFLEKDMVPGKAMNLRFNAEDGYDGKTAFLP  201

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  +IL+ FS+ P S+EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  202  RGEAETVPFESEKFSEILNTFSVKPGSEEAEMMKKTIEECEAKRVGGEEKYCATSLESMV  261

Query  563  DFSVSQLGK  589
            DFSVS+LGK
Sbjct  262  DFSVSKLGK  270



>ref|XP_008226515.1| PREDICTED: dehydration-responsive protein RD22-like [Prunus mume]
Length=326

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 107/177 (60%), Gaps = 23/177 (13%)
 Frame = +2

Query  119  SPETYWKSVIPNTPMPGAVKD-------------SLSTAGG-------VGKVGVTPNAIL  238
            +P+ YW SV+PNT MP A+ +             +++ A G        GK    P A++
Sbjct  27   APQLYWNSVLPNTQMPRAISELLLPDSTNEEKSTNITNAVGNGKPTDHKGKPENIPLALI  86

Query  239  FI--YTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFS  412
            F     D  T++QL D  NVA+FF + D++ G      F + SN ATFLPR +A  IPFS
Sbjct  87   FYNRRYDLPTDNQL-DYKNVAIFFLEKDMRPGATTNFQFPRNSNTATFLPRKSAQSIPFS  145

Query  413  AVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
            + KL +I + FS+ P S EA+ +K+T+EECEAP + GEEK CATSLESMVDFS S+L
Sbjct  146  SNKLLEIFNHFSVKPTSVEAKTIKQTIEECEAPGVKGEEKYCATSLESMVDFSTSKL  202



>emb|CDY05501.1| BnaA02g31900D [Brassica napus]
Length=387

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN---AATFLP  382
            VGVTP    F+Y  AA+E QLHDDP  ALFF + D+  G  M L F           FLP
Sbjct  142  VGVTPGPNPFVYNYAASETQLHDDPKAALFFLEKDMVPGKAMNLRFNAEDGYDGKTAFLP  201

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  +IL+ FS+ P S+EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  202  RGEAETVPFQSEKFSEILNTFSVKPGSEEAEMMKKTIEECEAKRVGGEEKYCATSLESMV  261

Query  563  DFSVSQLGK  589
            DFSVS+LGK
Sbjct  262  DFSVSKLGK  270



>ref|XP_010910127.1| PREDICTED: BURP domain-containing protein 6-like [Elaeis guineensis]
Length=347

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 98/177 (55%), Gaps = 20/177 (11%)
 Frame = +2

Query  107  HAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTP-----------------NAI  235
            HAA   E YW  V+P TPMP A++D L+  G    V V+                  +A 
Sbjct  57   HAASPAEVYWHEVLPKTPMPRAIRDILAEEGARTAVNVSKGGLKFNISKDNIAVRDNHAY  116

Query  236  LFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSA  415
            ++ Y   ATE Q   D    +FF + DL  G    ++F +TS+    LPR  A  IPFS+
Sbjct  117  IYNYRSRATEIQ---DRFATIFFLQKDLLPGANKTIYFIRTSSGTPLLPRRMADSIPFSS  173

Query  416  VKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
             KLP+I +R S+ P+S EA+ MKK LE+CE P + GE K CATSLESMVDFS   LG
Sbjct  174  SKLPEIFARLSIKPNSVEAESMKKALEDCEEPPVDGETKYCATSLESMVDFSTWTLG  230



>ref|XP_003569738.1| PREDICTED: BURP domain-containing protein 3-like [Brachypodium 
distachyon]
Length=524

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 85/121 (70%), Gaps = 1/121 (1%)
 Frame = +2

Query  227  NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAA-TFLPRSAAGKI  403
            N   FIY  AATE Q+HDDP+ ALFF + DL  G ++ +HF  T+ A   FLPRS A  I
Sbjct  285  NVSPFIYNYAATETQVHDDPSAALFFLEKDLHAGKKLAVHFMATTGAGEKFLPRSEADAI  344

Query  404  PFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
            PFS+ K+P+ILSRFS+ PDS EA  M +TL +CE  A  GE+K CATSLESMVDF+ S L
Sbjct  345  PFSSEKVPEILSRFSVKPDSTEAAQMTQTLHDCEEAAAKGEKKSCATSLESMVDFATSSL  404

Query  584  G  586
            G
Sbjct  405  G  405



>ref|XP_008226516.1| PREDICTED: dehydration-responsive protein RD22-like [Prunus mume]
Length=326

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 109/178 (61%), Gaps = 25/178 (14%)
 Frame = +2

Query  119  SPETYWKSVIPNTPMPGAVKD-------------SLSTAGGVGKV--------GVTPNAI  235
            +P+ YW SV+PNT MP A+ +             ++ +A G GK          +  + +
Sbjct  27   APQLYWNSVLPNTQMPRAISELLLPGSTNEEKSTNIMSAVGNGKPTDHKGKPENIPLSNV  86

Query  236  LF--IYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPF  409
            L+  +Y D  T++QLH   N+A+FF + D++ G      F + SN ATFLPR +A  IPF
Sbjct  87   LYNNVY-DPPTDNQLHYK-NIAIFFLEKDMRPGATTNFQFARNSNTATFLPRESAQSIPF  144

Query  410  SAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
            S+ KL +I + FS+ P S EA+ +K+T+EECEAP + GEEK CATSLESMVDFS S+L
Sbjct  145  SSNKLLEIFNHFSVKPTSVEAKTIKQTIEECEAPGIKGEEKYCATSLESMVDFSTSKL  202



>ref|NP_001238316.1| BURP domain-containing protein precursor [Glycine max]
 gb|ACD49739.1| BURP domain-containing protein [Glycine max]
Length=367

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTK---TSNAATFLP  382
            VGV P++  F Y  AA+E Q HDDPNVALFF + DL  G ++ LHFT+   +S  A+FLP
Sbjct  123  VGVGPHS-PFDYNYAASETQWHDDPNVALFFLEKDLHYGTKLNLHFTRYFTSSVDASFLP  181

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            RS A  IPFS+ K+ ++L++FS+   S EAQ +K T+ ECE P + GEEK C TSLESMV
Sbjct  182  RSVADSIPFSSNKVNEVLNKFSIKEGSDEAQTVKNTISECEVPGIKGEEKRCVTSLESMV  241

Query  563  DFSVSQLG  586
            DF+ ++LG
Sbjct  242  DFATTKLG  249


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 9/70 (13%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHA-ALSPETYWKSVIPNTPMPGAVKDSL--------STAGG  202
            M F LL IF+LL++AVVA HA  L PE YWKS +P TPMP A+ D L        ST+  
Sbjct  1    MVFPLLSIFALLNLAVVATHAETLPPEVYWKSKLPTTPMPKAITDILHPDLAEDKSTSVA  60

Query  203  VGKVGVTPNA  232
            VGK GV  NA
Sbjct  61   VGKGGVNVNA  70



>ref|XP_003579027.1| PREDICTED: BURP domain-containing protein 3-like [Brachypodium 
distachyon]
Length=327

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 99/167 (59%), Gaps = 13/167 (8%)
 Frame = +2

Query  125  ETYWKSVIPN-TPMPGA----VKDSLSTAGGVGKVGVTPN-----AILFIYTDAATEDQL  274
            E YWKS +PN TPMP +    ++   S   G  K            I   Y  +ATE+Q+
Sbjct  37   EEYWKSALPNNTPMPASLSRLIRGRSSVNNGYDKSATKAQLRKACGIYNRYEKSATEEQM  96

Query  275  --HDDPNVALFFKKNDLQQGNQMKLHFTKTSNAA-TFLPRSAAGKIPFSAVKLPQILSRF  445
              H    VALFF ++D+Q G ++ LHF     A   FLPR  A  IPFS+ K+P+ILSRF
Sbjct  97   QQHHAAGVALFFLESDIQPGKKLTLHFMPAYVAGEKFLPRGEADAIPFSSDKIPEILSRF  156

Query  446  SLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            SLSP S EA  + +TL +CE PA  GE K CATSLESMVDF+VS LG
Sbjct  157  SLSPGSAEAAEVAETLRDCERPAAKGERKACATSLESMVDFAVSGLG  203



>ref|XP_009151093.1| PREDICTED: dehydration-responsive protein RD22 [Brassica rapa]
Length=387

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 87/130 (67%), Gaps = 3/130 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTS--NAAT-FLP  382
            VGV P    F+Y  AA+E QLHDDP  ALFF + D+  G  M L F      N  T FLP
Sbjct  142  VGVKPGHNPFVYNYAASETQLHDDPKAALFFLEKDMVPGKAMNLRFNAEDGYNGKTAFLP  201

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  +IL+ FS+ P S EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  202  RGEAETVPFGSEKFSEILNTFSVKPGSGEAEMMKKTIEECEAKRVGGEEKYCATSLESMV  261

Query  563  DFSVSQLGKN  592
            DFSVS+LGK+
Sbjct  262  DFSVSKLGKD  271



>gb|KJB55408.1| hypothetical protein B456_009G074700 [Gossypium raimondii]
Length=256

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 107/188 (57%), Gaps = 23/188 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVAC--HAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVT  223
            MEF+ + IF++  V  V    H AL  E YW SV PNTPMP A+++ L          + 
Sbjct  1    MEFRYVPIFAMALVLAVGATRHVALPAEMYWTSVFPNTPMPKALQNLL----------IP  50

Query  224  PNAILFIYTDAATEDQLHDDPNVA----LFFKKNDLQQGNQMKLH-FTKTSNAATFLPRS  388
            P A       A    Q   D N+A    +FF ++ L+ G +M L   T  ++   FLPR 
Sbjct  51   PAAA------AGNSKQEFGDGNMATNKDVFFFESKLRPGTKMNLKVLTSKASKTAFLPRP  104

Query  389  AAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDF  568
             A  IPFS  K  Q+L  FS+ P S E++++KKT+E+CE P + GEEK CATSLES VDF
Sbjct  105  VADSIPFSTKKFAQVLKYFSVQPRSAESKILKKTIEDCETPTIEGEEKFCATSLESFVDF  164

Query  569  SVSQLGKN  592
             VS+LGK+
Sbjct  165  GVSKLGKD  172



>ref|XP_006394816.1| hypothetical protein EUTSA_v10004736mg [Eutrema salsugineum]
 gb|ESQ32102.1| hypothetical protein EUTSA_v10004736mg [Eutrema salsugineum]
Length=282

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 86/130 (66%), Gaps = 3/130 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTS--NAAT-FLP  382
            VGV P    F+Y  AA++ QLHDDP  ALFF + D+  G  M L F      N  T FLP
Sbjct  142  VGVKPGPNPFVYNYAASKTQLHDDPKAALFFLEKDMVPGKVMSLRFNAEDGYNGKTAFLP  201

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  +IL  FS+ P S EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  202  RGEAETVPFGSEKFSEILKTFSVKPGSGEAEMMKKTIEECEAKRVGGEEKYCATSLESMV  261

Query  563  DFSVSQLGKN  592
            DFSVS+LGK+
Sbjct  262  DFSVSKLGKD  271



>emb|CDX80529.1| BnaC07g29150D [Brassica napus]
Length=387

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 85/130 (65%), Gaps = 3/130 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN---AATFLP  382
            VGV P    F+Y  AA+E QLHDDP  ALFF + D+  G  M L F           FLP
Sbjct  142  VGVKPGHNPFVYNYAASETQLHDDPKAALFFLEKDMVPGKAMNLRFNAEDGYDGKTAFLP  201

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  +IL+ FS+ P S EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  202  RGEAETVPFGSEKFSEILNTFSVKPGSGEAEMMKKTIEECEAKRVGGEEKYCATSLESMV  261

Query  563  DFSVSQLGKN  592
            DFSVS+LGK+
Sbjct  262  DFSVSKLGKD  271



>ref|XP_002874271.1| hypothetical protein ARALYDRAFT_489420 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50530.1| hypothetical protein ARALYDRAFT_489420 [Arabidopsis lyrata subsp. 
lyrata]
Length=392

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAA---TFLP  382
            VGV P A  F+Y  AA E QLHDDPN ALFF + DL  G  M + F           FLP
Sbjct  147  VGVKPGANPFVYNYAAKETQLHDDPNAALFFLEKDLVPGKAMNVRFNAEDGYGGKTAFLP  206

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  + L RFS+   S+EA++MKKT++ECEA  + GEEK CATSLESMV
Sbjct  207  RGEAETVPFGSEKFSETLKRFSVEAGSEEAEMMKKTIDECEAKKVGGEEKYCATSLESMV  266

Query  563  DFSVSQLGK  589
            DFSVS+LGK
Sbjct  267  DFSVSKLGK  275



>emb|CDY19799.1| BnaA09g04520D [Brassica napus]
Length=387

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 86/130 (66%), Gaps = 3/130 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN---AATFLP  382
            VGV P    F+Y  AA++ QLHDDP  ALFF + D+  G +M L F          +FLP
Sbjct  142  VGVKPGPNPFVYNYAASKTQLHDDPKAALFFLEKDMVPGKEMNLRFNAEDGYHGKTSFLP  201

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  +IL  FS+ P S EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  202  RGEAETVPFGSEKFSEILKTFSVKPGSGEAEMMKKTIEECEAKRVGGEEKYCATSLESMV  261

Query  563  DFSVSQLGKN  592
            DFSVS+LGK+
Sbjct  262  DFSVSKLGKD  271



>ref|XP_009111670.1| PREDICTED: dehydration-responsive protein RD22-like [Brassica 
rapa]
Length=387

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 86/130 (66%), Gaps = 3/130 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN---AATFLP  382
            VGV P    F+Y  AA++ QLHDDP  ALFF + D+  G +M L F          +FLP
Sbjct  142  VGVKPGPNPFVYNYAASKTQLHDDPKAALFFLEKDMVPGKEMNLRFNAEDGYHGKTSFLP  201

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  +IL  FS+ P S EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  202  RGEAETVPFGSEKFSEILKTFSVKPGSGEAEMMKKTIEECEAKRVGGEEKYCATSLESMV  261

Query  563  DFSVSQLGKN  592
            DFSVS+LGK+
Sbjct  262  DFSVSKLGKD  271



>ref|XP_004498543.1| PREDICTED: dehydration-responsive protein RD22-like [Cicer arietinum]
Length=381

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 88/128 (69%), Gaps = 5/128 (4%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTS-NAATFLPRS  388
            VG +P    F Y  AA+E QLHD+PN ALFF + DL QG ++ + FTKTS N A  LPR 
Sbjct  144  VGNSP----FNYNYAASETQLHDNPNAALFFLEKDLHQGTKLNMQFTKTSDNEAKILPRE  199

Query  389  AAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDF  568
             A  IPFS+ K+  IL+ FS+   S+E++++K T+ ECE   + GEEKLC TSLESMVDF
Sbjct  200  VANSIPFSSNKIETILNHFSIKEGSEESEIVKTTINECEETGIKGEEKLCVTSLESMVDF  259

Query  569  SVSQLGKN  592
            + S+LG N
Sbjct  260  TTSKLGNN  267


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 8/69 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF  L IF  L++A+VA HAA+ PE YWKS +P T MP ++ D L        ST+  V
Sbjct  1    MEFPYLSIFISLNLALVATHAAIPPELYWKSKLPTTQMPKSITDLLHYDWTEDKSTSVNV  60

Query  206  GKVGVTPNA  232
            GK GV  +A
Sbjct  61   GKGGVNVDA  69



>ref|XP_010493823.1| PREDICTED: dehydration-responsive protein RD22 isoform X1 [Camelina 
sativa]
Length=392

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAA---TFLP  382
            VGV P    F+Y  AA E QLHDDPN A+FF + DL  G  M + F           FLP
Sbjct  147  VGVKPGPNPFVYNYAAKETQLHDDPNAAIFFLEKDLVPGKAMNVRFNAEDGYGGKTAFLP  206

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  + L+RFS+   S+EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  207  RGEAETVPFGSEKFSETLNRFSVEAGSEEAEMMKKTIEECEAKKVGGEEKYCATSLESMV  266

Query  563  DFSVSQLGK  589
            DFSVS+LGK
Sbjct  267  DFSVSKLGK  275



>ref|XP_010910075.1| PREDICTED: BURP domain-containing protein 3-like [Elaeis guineensis]
Length=257

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = +2

Query  245  YTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKL  424
            +  A TEDQ+ D P+V  +F + DL  G  M +HF +T   AT LPR AA  IPFS+ KL
Sbjct  29   WGKAVTEDQIQD-PSVTNYFFEKDLHPGANMTMHFVRTITGATLLPRQAADSIPFSSAKL  87

Query  425  PQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            P+ILSR S++P+S EA+ MKKTL++CE PA+ GE K CATS+E+MVDFS S LG
Sbjct  88   PEILSRLSITPNSIEAKAMKKTLQDCEEPAIEGETKYCATSVEAMVDFSTSSLG  141



>sp|Q0JEP3.2|BURP5_ORYSJ RecName: Full=BURP domain-containing protein 5; Short=OsBURP05; 
Flags: Precursor [Oryza sativa Japonica Group]
Length=324

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 102/173 (59%), Gaps = 18/173 (10%)
 Frame = +2

Query  107  HAALSPETYWKSVIPN-TPMPGAVKDSL------STAGGVGKVG------VTPNAILFIY  247
            HAA+SPE YW+S++P+ TPMP ++   L      S A G+ K G        PN    IY
Sbjct  37   HAAMSPEQYWRSILPDSTPMPISISQLLGDGYPYSPAVGLPKRGDRVQIRYGPN----IY  92

Query  248  TDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLP  427
              AA++ Q   DP + LFF + +LQ    +KLHF        FLPR  A  +PFS+  L 
Sbjct  93   GLAASQ-QFFKDPTMGLFFLETNLQSSKSIKLHFANMMAGTKFLPRGEADAVPFSSKDLQ  151

Query  428  QILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            +IL+RF + P S +A V+K TL ECE PA  GE+K CATSLESMVDF  S LG
Sbjct  152  EILARFGVRPGSVDASVVKNTLLECELPANKGEKKACATSLESMVDFVASSLG  204



>ref|XP_007211649.1| hypothetical protein PRUPE_ppa008874mg [Prunus persica]
 gb|EMJ12848.1| hypothetical protein PRUPE_ppa008874mg [Prunus persica]
Length=316

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 103/177 (58%), Gaps = 23/177 (13%)
 Frame = +2

Query  119  SPETYWKSVIPNTPMPGAVKD-----------SLSTAGGVGKVGVT---------PNAIL  238
            +P+ YW SV+PNT MP A+ +           S +    VG    T         P A++
Sbjct  17   APQLYWNSVLPNTQMPRAISELLHPDSTNEEKSTNIMNAVGNGKPTDHKGKPENIPLALI  76

Query  239  FI--YTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFS  412
            F     D  T++QLH   NVA+FF + D++ G      F + SN A FL R +A  IPFS
Sbjct  77   FYNKRYDHPTDNQLHYK-NVAIFFLEKDMRPGATTNFQFPRNSNTAAFLSRESAQSIPFS  135

Query  413  AVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
            + KL +I + FS+ P S EA+ +K+T+EECEAP + GEEK CATSLESMVDFS S+L
Sbjct  136  SNKLSEIFNHFSVKPTSVEAKTIKQTIEECEAPGVKGEEKYCATSLESMVDFSTSKL  192



>emb|CDX87079.1| BnaC09g03940D [Brassica napus]
Length=387

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 85/130 (65%), Gaps = 3/130 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSN---AATFLP  382
            VGV P    F+Y  AA++ QLHDDP  ALFF + D+  G +M L F           FLP
Sbjct  142  VGVKPGPNPFVYNYAASKTQLHDDPKAALFFLEKDMVPGKEMNLRFNAEDGYDGKTAFLP  201

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  +IL  FS+ P S EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  202  RGEAETMPFESEKFSEILKTFSVKPGSGEAEMMKKTIEECEAKRVGGEEKYCATSLESMV  261

Query  563  DFSVSQLGKN  592
            DFSVS+LGK+
Sbjct  262  DFSVSKLGKD  271



>ref|XP_007015182.1| Polygalacturonase, putative [Theobroma cacao]
 gb|EOY32801.1| Polygalacturonase, putative [Theobroma cacao]
Length=305

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 114/194 (59%), Gaps = 14/194 (7%)
 Frame = +2

Query  50   MEFQLLGIFSL-LSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTP  226
            MEF+ L IF+L L +A+   HAAL  E YW+SV PNT MP A+++ L  A  V K  +T 
Sbjct  1    MEFRFLPIFALSLVLALAVSHAALPAEMYWRSVFPNTAMPKALRNLLLPAA-VNKNMLTD  59

Query  227  NAIL----------FIYTDAATEDQLHDDP-NVALFFKKNDLQQGNQMKL-HFTKTSNAA  370
             A            + Y++ + E    + P N  ++F +++L  G +MKL    K  + A
Sbjct  60   MAKSKDKMVDAFGNYGYSNPSKEFPDGNTPTNNDVYFFESELHPGRKMKLKELAKKVSKA  119

Query  371  TFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSL  550
            TF+PR  A  IPFS  K P+IL  FSL   S EA ++K+T+E CE PA+ GEEK CA SL
Sbjct  120  TFVPRPVAESIPFSIQKFPEILKYFSLEAKSAEANLLKQTVENCERPAIDGEEKYCAASL  179

Query  551  ESMVDFSVSQLGKN  592
            ES +D  VS+ GKN
Sbjct  180  ESFIDSGVSKFGKN  193



>ref|XP_009763757.1| PREDICTED: BURP domain-containing protein 5-like [Nicotiana sylvestris]
Length=327

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 119/220 (54%), Gaps = 46/220 (21%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVAC--HAALSPETYWKSVIPNTPMPGAVKDSLSTAG--------  199
            M+FQLL   S+  +A VAC  +AA+SPE YWK  +P++P+P  +KD L  +         
Sbjct  1    MKFQLLYSLSIFLLAFVACVCYAAISPEVYWKVKLPHSPIPKVIKDLLPQSEDDVHTKEK  60

Query  200  ---GVGKVGVTPNAILFIYTDAATEDQLHD----DPNV----------------------  292
               G+ + G       +I+ D ATED++ +     PNV                      
Sbjct  61   VYYGLHQHGA------WIFHD-ATEDEIREIKKQSPNVNELQHVNEGSNANSHFQDNLLY  113

Query  293  ALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEA  472
              +F + DL++G  +     K  N A FLPR     IPFS+ KLP+IL+ FS+   SK+A
Sbjct  114  KPYFLEKDLEKGRVINFPSLKNKNEAPFLPRQYVESIPFSSKKLPEILNHFSIDSSSKDA  173

Query  473  QVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            Q +++T++ CE PAM GE + C TSLESMVDFS+S LG N
Sbjct  174  QTIEETVKVCEEPAMKGERRKCPTSLESMVDFSLSMLGTN  213



>gb|AAQ57584.1| BURP domain-containing protein [Brassica napus]
Length=387

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 86/130 (66%), Gaps = 3/130 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTS--NAAT-FLP  382
            VGV P    F Y  AA+E QLHDDP  ALFF + D+  G  M L F      N  T FLP
Sbjct  142  VGVKPGHNPFAYNYAASETQLHDDPKAALFFLEKDMVPGKAMNLRFNAEDGYNGKTAFLP  201

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  +IL+ FS+ P S EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  202  RGEAETVPFGSEKSSEILNTFSVKPGSGEAEMMKKTIEECEAKRVGGEEKYCATSLESMV  261

Query  563  DFSVSQLGKN  592
            DFSVS+LGK+
Sbjct  262  DFSVSKLGKD  271



>emb|CAN83032.1| hypothetical protein VITISV_006147 [Vitis vinifera]
Length=296

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 114/190 (60%), Gaps = 13/190 (7%)
 Frame = +2

Query  50   MEF-QLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGG  202
            MEF + L I + LSV VV  HA+L  E YWK V+P+TPMP AVKD L        ++A G
Sbjct  1    MEFLRPLPILAFLSVVVVVSHASLPSEGYWKLVLPHTPMPKAVKDHLRPGVTSFNASAAG  60

Query  203  VGKVGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLP  382
               +    N I   +     +D L    N   FF + DL  G +M L   +T N A FLP
Sbjct  61   CFGIHNQFNKIPQPFHAKQAQDGL----NTGNFFLQTDLHPGTKMMLQLPQTRNEAMFLP  116

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  IPFS+ KLP+IL+R S+   S EA++MK+ +EECE  AM GE + CATSLES++
Sbjct  117  RQVADSIPFSSKKLPEILNRLSVKEKSAEAELMKEEIEECEEDAMDGESRFCATSLESLI  176

Query  563  DFSVSQLGKN  592
            DFS S+LG+N
Sbjct  177  DFSTSKLGRN  186



>ref|XP_003588551.1| BURP domain-containing protein [Medicago truncatula]
 gb|AES58802.1| dehydration-responsive protein RD22 [Medicago truncatula]
Length=385

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +2

Query  239  FIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTS--NAATFLPRSAAGKIPFS  412
            F+Y  AA+E QLHD PNVALFF + DL QG ++ L FTKT+  + A FLP+  A  IPFS
Sbjct  151  FLYNYAASETQLHDKPNVALFFLEKDLHQGTKLNLQFTKTNSNDDAKFLPKEVANSIPFS  210

Query  413  AVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            + K+  IL+ FS+   ++E++++K T+ ECE   + GEEKLC TSLESMVDF+ S+LG N
Sbjct  211  SSKVENILNLFSIKEGTEESEIVKNTISECEENGIKGEEKLCVTSLESMVDFTTSKLGNN  270


 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 42/66 (64%), Gaps = 8/66 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL--------STAGGV  205
            MEF+ L IF +L++A+VA HAAL PE YWKS +P T MP A+ D L        ST+  V
Sbjct  1    MEFRHLSIFIVLNLALVATHAALPPEVYWKSKLPTTQMPKAITDLLHLDWTEEKSTSVAV  60

Query  206  GKVGVT  223
            GK GV 
Sbjct  61   GKGGVN  66



>ref|XP_009598995.1| PREDICTED: BURP domain-containing protein 3-like [Nicotiana tomentosiformis]
Length=328

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 116/214 (54%), Gaps = 33/214 (15%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVAC--HAALSPETYWKSVIPNTPMPGAVKDSLSTAG--------  199
            M+ QLL   ++  +A VAC  +AA+SPE YWK  +PNTP+P  +KD L  A         
Sbjct  1    MKLQLLYSLTIFLLAFVACICYAAISPEVYWKVKLPNTPIPKVIKDLLPQAEDEVYTKEK  60

Query  200  ---GVGKVGV------TPNAILFIYTDAATEDQL------------HDDPNVAL--FFKK  310
               G+ + G       T + I  I   +   D+L            H   N+    +F +
Sbjct  61   VYYGLHQHGAWIFHDATEDEIREIKKQSPNRDELQHVNEGSNNAKSHFQDNLLYKPYFLE  120

Query  311  NDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKT  490
             DL++G  +     K  N A FLPR     IPFS+ KLP+IL+ FS+   SK+A+ +++T
Sbjct  121  KDLEKGRVINFPSLKNKNEAPFLPRQLVESIPFSSKKLPEILNHFSIDSSSKDAKTIEET  180

Query  491  LEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            ++ CE PAM GE + CATSLESMVDFS+S LG N
Sbjct  181  VKVCEEPAMKGERRKCATSLESMVDFSLSMLGTN  214



>ref|XP_010493824.1| PREDICTED: dehydration-responsive protein RD22 isoform X2 [Camelina 
sativa]
Length=392

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAA---TFLP  382
            VGV P    F+Y  AA E QLHDDPN A+FF + DL  G  M + F           FLP
Sbjct  147  VGVKPGPNPFVYNYAAKETQLHDDPNAAIFFLEKDLVPGKAMNVRFNAEDGYGGKTAFLP  206

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  + L+RFS+   S+EA++MKKT+EECEA  + GE+K CATSLESMV
Sbjct  207  RGEAETVPFGSEKFSETLNRFSVEAGSEEAEMMKKTIEECEAKKVGGEDKYCATSLESMV  266

Query  563  DFSVSQLGK  589
            DFSVS+LGK
Sbjct  267  DFSVSKLGK  275



>ref|XP_006833278.1| hypothetical protein AMTR_s00109p00021460 [Amborella trichopoda]
 gb|ERM98556.1| hypothetical protein AMTR_s00109p00021460 [Amborella trichopoda]
Length=377

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHF---TKTSNAATFLP  382
            V V P    F Y  AATEDQ HDDPN ALFF + DL+ G    + F          TFLP
Sbjct  131  VTVKPGKNPFAYNYAATEDQAHDDPNTALFFSEKDLKAGKHFTVDFGIKVTQEPMPTFLP  190

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PFS+ KL  IL+RFS++P S EA+ MK+TL ECE PA+ GE K CATSLESMV
Sbjct  191  RLVADALPFSSSKLTNILNRFSVTPGSVEAEAMKQTLAECEEPAITGEAKHCATSLESMV  250

Query  563  DFSVSQLGK  589
            DF+  +LGK
Sbjct  251  DFATMRLGK  259



>ref|XP_010925840.1| PREDICTED: BURP domain-containing protein 3-like [Elaeis guineensis]
Length=246

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +2

Query  227  NAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIP  406
            +++   +  AAT+ Q+ D P V +FF + DL  G  M  HFT+T+  AT LPR  A  IP
Sbjct  2    DSVCAFFRYAATQSQIQD-PTVTVFFLEKDLHPGANMTFHFTRTTTGATLLPRELADSIP  60

Query  407  FSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            FS+ KLP+ILSR S++PDS +A+ MKK L ECE PA+ GE + CATS+ESMVDFS S LG
Sbjct  61   FSSAKLPEILSRLSIAPDSVQAETMKKILLECEEPAIDGEIRYCATSVESMVDFSTSCLG  120



>ref|NP_001052280.1| Os04g0225700 [Oryza sativa Japonica Group]
 dbj|BAF14194.1| Os04g0225700 [Oryza sativa Japonica Group]
Length=330

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 102/173 (59%), Gaps = 18/173 (10%)
 Frame = +2

Query  107  HAALSPETYWKSVIPN-TPMPGAVKDSL------STAGGVGKVG------VTPNAILFIY  247
            HAA+SPE YW+S++P+ TPMP ++   L      S A G+ K G        PN    IY
Sbjct  43   HAAMSPEQYWRSILPDSTPMPISISQLLGDGYPYSPAVGLPKRGDRVQIRYGPN----IY  98

Query  248  TDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLP  427
              AA++ Q   DP + LFF + +LQ    +KLHF        FLPR  A  +PFS+  L 
Sbjct  99   GLAASQ-QFFKDPTMGLFFLETNLQSSKSIKLHFANMMAGTKFLPRGEADAVPFSSKDLQ  157

Query  428  QILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            +IL+RF + P S +A V+K TL ECE PA  GE+K CATSLESMVDF  S LG
Sbjct  158  EILARFGVRPGSVDASVVKNTLLECELPANKGEKKACATSLESMVDFVASSLG  210



>ref|XP_007222322.1| hypothetical protein PRUPE_ppa008080mg [Prunus persica]
 gb|EMJ23521.1| hypothetical protein PRUPE_ppa008080mg [Prunus persica]
Length=346

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 105/197 (53%), Gaps = 41/197 (21%)
 Frame = +2

Query  119  SPETYWKSVIPNTPMPGAV--------KDSLSTAGGVGKVGVTPNAILFIYTD-------  253
            +P+ YW SV+PNT MP ++        K+   +   VGK    P      Y+        
Sbjct  27   APQLYWNSVLPNTQMPRSISELLHPDSKNEEKSTNDVGKPETFPLGNKRYYSQKRYGRGN  86

Query  254  --------------------------AATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTK  355
                                      + +++QL    ++A+FF + D+  G  MK  F +
Sbjct  87   KSYRSQKRYGRGNKSYSVQKNYGRGASPSDNQLLHYKDLAIFFLEKDMSPGTTMKFQFPR  146

Query  356  TSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKL  535
             SN ATFLPR +A  IPFS+ KLP+I + FS+ P S+EA+ +K+T+EECEAP + GEE  
Sbjct  147  NSNTATFLPRESAQSIPFSSNKLPEIFNHFSVKPTSEEAKTIKQTIEECEAPGLKGEEIY  206

Query  536  CATSLESMVDFSVSQLG  586
            CATSLESMVDFS S+LG
Sbjct  207  CATSLESMVDFSTSKLG  223



>ref|XP_007222614.1| hypothetical protein PRUPE_ppa008481mg [Prunus persica]
 gb|EMJ23813.1| hypothetical protein PRUPE_ppa008481mg [Prunus persica]
Length=330

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 114/206 (55%), Gaps = 28/206 (14%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAAL---SPETYWKSVIPNTPMPGAVKD-----------SL  187
            M F L  IF++LS+A VA        + + YW SV+PNT MP  + +           S 
Sbjct  1    MGFHLPLIFAILSLAAVALANHAAQPAAQLYWNSVLPNTQMPRTISELLHPDSTNEEKST  60

Query  188  STAGGVGKVGVTPN-------AILFIYTDAA-------TEDQLHDDPNVALFFKKNDLQQ  325
            +    VG    T +       A+   YT          +++QL    N+ +FF   D++ 
Sbjct  61   NIMNAVGNGKPTDHNGKPKMKALFSGYTIQVQYAGVPNSDNQLQYYKNMTIFFLGKDMRL  120

Query  326  GNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECE  505
            G  M   FT+ SN ATFLPR +A  IPFS+ KL +I + FS+ P S EA+ +KKT+EECE
Sbjct  121  GATMNFQFTRNSNTATFLPRESAQSIPFSSNKLSEIFNHFSVKPTSVEAKTIKKTIEECE  180

Query  506  APAMMGEEKLCATSLESMVDFSVSQL  583
            AP + GEE+ CATSLESMVDFS S+L
Sbjct  181  APGIKGEERYCATSLESMVDFSTSKL  206



>gb|KFK27813.1| hypothetical protein AALP_AA8G433300 [Arabis alpina]
Length=389

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 86/130 (66%), Gaps = 5/130 (4%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKT---SNAATFLP  382
            VGVTP    F+Y  AA++ QLHDDPN ALFF + DL  G  M + F           FLP
Sbjct  147  VGVTPGPNPFVYNYAASKTQLHDDPNAALFFLEKDLVPGKAMNVRFNAEDGYGGKTAFLP  206

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R     +PF + K  +IL+  S+ P S+EA++MKKT+EECEA  + GEEK CATSLESMV
Sbjct  207  RGET--VPFGSEKFSEILNTLSVRPGSEEAEMMKKTIEECEAKRVGGEEKYCATSLESMV  264

Query  563  DFSVSQLGKN  592
            DFSVS+LGK+
Sbjct  265  DFSVSKLGKD  274



>gb|EPS61992.1| hypothetical protein M569_12801, partial [Genlisea aurea]
Length=289

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 103/172 (60%), Gaps = 15/172 (9%)
 Frame = +2

Query  119  SPETYWKSVIPNTPMPGAVKDSLST---AGGVGKVGVTPNAILFI---------YTDAA-  259
            +PE YWK+ +PN+P+P  ++D LS    A G    G       ++         +  A  
Sbjct  1    TPENYWKANLPNSPIPPFLQDLLSDHRLAAGESVPGEPHRTTTWLPGGKTVTKTWLPAGK  60

Query  260  --TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQI  433
              T D    +  ++L F + DL+ G  M L+F K S+ A FLPR  A  IPFS+  LPQI
Sbjct  61   LTTTDSSDRESQMSLIFIEKDLRVGKLMNLNFWKPSDMAHFLPRHLADSIPFSSNNLPQI  120

Query  434  LSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            L +FSL+P S E+QV+K TL+ECEA  + GEE  CATSLESMVD+S+S+LGK
Sbjct  121  LHKFSLNPHSVESQVLKATLQECEAKPVEGEENFCATSLESMVDYSLSKLGK  172



>emb|CDY62417.1| BnaA06g39340D [Brassica napus]
Length=388

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 85/131 (65%), Gaps = 4/131 (3%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVA-LFFKKNDLQQGNQMKLHFTKTSN---AATFL  379
            VGV P    F+Y  AA+E QLHDDP  A LFF + D+  G  M L F           FL
Sbjct  142  VGVKPGHNPFVYNYAASETQLHDDPKAAPLFFLEKDMVPGKAMNLRFNAEDGYDGKTAFL  201

Query  380  PRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESM  559
            PR  A  +PF + K  +IL+ FS+ P S EA++MKKT+EECEA  + GEEK CATSLESM
Sbjct  202  PRGEAETVPFGSEKFSEILNTFSVKPGSGEAEMMKKTIEECEAKRVGGEEKYCATSLESM  261

Query  560  VDFSVSQLGKN  592
            VDFSVS+LGK+
Sbjct  262  VDFSVSKLGKD  272



>emb|CDP16140.1| unnamed protein product [Coffea canephora]
Length=266

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 98/150 (65%), Gaps = 6/150 (4%)
 Frame = +2

Query  161  MPGAVKDSLSTAG----GVGKVGVTPNAILF-IYTDAATEDQLHDDPNVALFFKKNDLQQ  325
            MP AV+D L        G  ++    +  +F  Y    TED+L  DP V +FF K DL +
Sbjct  1    MPKAVRDLLKDGKWPERGNFRLKTYDDQCIFKRYCGNPTEDELQIDPKVKVFFLKMDLNR  60

Query  326  GNQMKLHFTKTSNAAT-FLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEEC  502
            G+ M + F ++  + T FLPR  A  IPFS+  +P+IL+++SL+P S++A ++K+T+ EC
Sbjct  61   GSSMNIKFVESVKSTTGFLPRQVANSIPFSSKSVPEILNKYSLNPQSQDAGIIKETIAEC  120

Query  503  EAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            E PAM GE+K CATSLESMVDF+ S+LGK+
Sbjct  121  EVPAMKGEDKYCATSLESMVDFTTSKLGKD  150



>ref|XP_008219790.1| PREDICTED: dehydration-responsive protein RD22-like isoform X3 
[Prunus mume]
Length=334

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 113/211 (54%), Gaps = 32/211 (15%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAAL---SPETYWKSVIPNTPMPGAV---------------  175
            M F L  IF++LS+A VA        +P+ YW SV+PNT MP A+               
Sbjct  1    MGFHLPLIFAILSLAAVALANHAAQPAPQLYWNSVLPNTQMPRAISELLHPDSTNEEKSK  60

Query  176  --------KDSLSTAGGVGKV------GVTPNAILFIYTDAATEDQLHDDPNVALFFKKN  313
                    K+ L    G GK          P    +      +++QL     +A+FF + 
Sbjct  61   PENFPLANKNYLQQGYGKGKPVQKGYGKGKPVQKGYGKRSPPSDNQLLHYKELAIFFFEK  120

Query  314  DLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTL  493
            D++ G  MK  F + SN ATFL R +A  IPFS+ KLP+I + FS+ P S EAQ +K+T+
Sbjct  121  DMRPGTTMKFQFPRNSNTATFLSRESAQSIPFSSNKLPEIFNHFSVKPTSVEAQTIKQTI  180

Query  494  EECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            E CEA  + GEEK CATSLESMVDFS S+LG
Sbjct  181  EGCEALGIKGEEKYCATSLESMVDFSTSKLG  211



>ref|XP_002522983.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF39413.1| polygalacturonase, putative [Ricinus communis]
Length=308

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 111/196 (57%), Gaps = 17/196 (9%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVAC-HAALSPETYWKSVIPNTPMPGAVKDSLS-TAGGVGKVGVT  223
            MEF LL IF+L  V V    + AL  E YWKS  P+TP+P A+++ L  TA  V K  + 
Sbjct  1    MEFHLLLIFALFLVVVNGSNYGALPGEMYWKSKFPSTPLPKALQELLQPTAAAVNKSSL-  59

Query  224  PNAILFIYTDAA---------TEDQLHDDPN-----VALFFKKNDLQQGNQMKLHFTKTS  361
            P   L     A          TE +   D N       ++F  NDL    +MKL FT++ 
Sbjct  60   PKVELIGSQRAKRATYGVGYWTELKTLFDKNAIYNKTTIYFLYNDLYPYKKMKLIFTESM  119

Query  362  NAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCA  541
            + + FLPR  A  IPFS  KL +IL+ FS+   SKEAQ+MK+T++ECEA  + GE+K CA
Sbjct  120  SGSKFLPRKIAQSIPFSNNKLQEILNYFSIESSSKEAQIMKQTIQECEAIGIRGEDKYCA  179

Query  542  TSLESMVDFSVSQLGK  589
            TS ES+ DF  ++ GK
Sbjct  180  TSFESLADFVTAKFGK  195



>ref|XP_010999727.1| PREDICTED: uncharacterized protein LOC105107486 [Populus euphratica]
Length=315

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 98/167 (59%), Gaps = 11/167 (7%)
 Frame = +2

Query  125  ETYWKSVIPNTPMPGAVK--------DSLST--AGGVGKVGVTPNAILFIYTDAATEDQL  274
            E YW S +PNTP+P A+          S+ST  A  +  V  +       Y     +  +
Sbjct  68   EKYWFSRLPNTPLPKALGYLPQPSHYPSISTEFANEIVSVAASQRTYKQGYRSVKHKTAI  127

Query  275  HDD-PNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSL  451
                P+  +F+  NDLQ G +M++HFT +    +FLPR  A  IPFS+ K+P+IL+ F+L
Sbjct  128  KSALPDSTIFYLYNDLQPGKRMRIHFTNSGTKVSFLPRQVAESIPFSSDKVPEILNYFAL  187

Query  452  SPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
              +SKEAQVM+  +  CE P M GEEK CATSLES++DFSV +LG N
Sbjct  188  QVNSKEAQVMRDEIGGCEEPNMEGEEKFCATSLESLIDFSVERLGLN  234



>ref|XP_008219471.1| PREDICTED: LOW QUALITY PROTEIN: dehydration-responsive protein 
RD22-like [Prunus mume]
Length=267

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 83/119 (70%), Gaps = 3/119 (3%)
 Frame = +2

Query  233  ILFIYT--DAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIP  406
            I F Y   D  T++QLH   NVA+FF + D++ G  M   F + SN ATFLPR +   IP
Sbjct  26   IPFFYRIYDHPTDNQLHYK-NVAIFFLEKDMRPGTTMNFQFPRNSNTATFLPRESTQSIP  84

Query  407  FSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
            FS+ KLP+IL+ FS+ P S EA+ +K+T+EECEAP + GEE  CATSLESMVDFS S+L
Sbjct  85   FSSNKLPEILNHFSVKPPSVEAKTIKQTIEECEAPGIKGEEIYCATSLESMVDFSTSKL  143



>ref|XP_009353316.1| PREDICTED: dehydration-responsive protein RD22-like [Pyrus x 
bretschneideri]
Length=315

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 110/196 (56%), Gaps = 24/196 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVV---ACHAA-----LSPETYWKSVIPNTPMPGAVKDSLSTAGGV  205
            M+F+   +F+ L++  +   A HAA     L   +YW SV+PNTPMP A  + +     V
Sbjct  1    MQFRFSKMFAFLTLTTLVAMASHAAAVRQPLPQLSYWNSVLPNTPMPKAFSELVHPGDLV  60

Query  206  GKVGVTPNAILFIYTDAATEDQLHD-----DPNVALFFKKNDLQQGNQMKLHFTK--TSN  364
             K  V P         A  E+QL        P   L   + DL+ G  +K  F +  TS 
Sbjct  61   SKNFVRP---------AGAENQLDKATDALGPCAGLVLMEKDLRPGKTVKYGFPRDTTSK  111

Query  365  AATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCAT  544
            ++ F+ R  A  IPFS+ K+ +IL RFSL P+S EA  +K+T++ CE PAM GEE+ CAT
Sbjct  112  SSRFVSRPTAESIPFSSNKMEEILRRFSLRPESAEANTIKETIDYCEMPAMKGEERYCAT  171

Query  545  SLESMVDFSVSQLGKN  592
            SLES+VDF+ S+LG N
Sbjct  172  SLESLVDFATSELGSN  187



>gb|EAY93150.1| hypothetical protein OsI_14956 [Oryza sativa Indica Group]
Length=270

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 99/170 (58%), Gaps = 18/170 (11%)
 Frame = +2

Query  116  LSPETYWKSVIPN-TPMPGAVKDSL------STAGGVGKVG------VTPNAILFIYTDA  256
            +SPE YW+S++P+ TPMP ++   L      S A G+ K G        PN    IY  A
Sbjct  1    MSPEQYWRSILPDSTPMPISISQLLGDGYPYSPAVGLPKRGDRVQIRYGPN----IYGLA  56

Query  257  ATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQIL  436
            A++ Q   DP + LFF + +LQ    +KLHF        FLPR  A  +PFS+  L +IL
Sbjct  57   ASQ-QFFKDPTMGLFFLETNLQSSKSIKLHFANMMAGTKFLPRGEADAVPFSSKDLQEIL  115

Query  437  SRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            +RF + P S +A V+K TL ECE PA  GE+K CATSLESMVDF  S LG
Sbjct  116  ARFGVRPGSVDASVVKNTLLECELPANKGEKKACATSLESMVDFVASSLG  165



>ref|XP_004233978.1| PREDICTED: BURP domain-containing protein 5-like [Solanum lycopersicum]
Length=325

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 114/209 (55%), Gaps = 36/209 (17%)
 Frame = +2

Query  53   EFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL-----STAGGV----  205
            +F  L  FS L  A V  HAA+SPE YWK  +PNT MP  +KD L     +  G +    
Sbjct  4    QFHYLISFSWL--AFVVSHAAISPEVYWKVKLPNTLMPKVIKDFLPHTDHNFNGNIVPWH  61

Query  206  ---------------GKVGVTPNAILFIYTDAATED--QLHDDPNVAL---FFKKNDLQQ  325
                           GK+G   + +L  Y  A  E+  +L DD N  +   FF +NDL +
Sbjct  62   HAATEEEIHELKVNRGKIG---SGMLHWYCAATEEEIRELKDDNNNFIYKPFFFENDLTK  118

Query  326  GNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECE  505
            GN +     K  N A FLPR +   IPFS+ K  +IL+ FS+  +S +AQ++K+T+  CE
Sbjct  119  GNIINFPSLKHKNDAPFLPRQST--IPFSSKKFTEILNHFSIDSNSNDAQIIKETIYLCE  176

Query  506  APAMMGEEKLCATSLESMVDFSVSQLGKN  592
             P +  E+K CATSLESMVDF +S+LG N
Sbjct  177  EPDLHKEKKFCATSLESMVDFMLSELGTN  205



>ref|XP_008378148.1| PREDICTED: dehydration-responsive protein RD22-like [Malus domestica]
Length=315

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 109/196 (56%), Gaps = 24/196 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVV---ACHAA-----LSPETYWKSVIPNTPMPGAVKDSLSTAGGV  205
            MEF+   +F+ L++  +   A HAA     L   +YW SV+PNTPMP A  + +     V
Sbjct  1    MEFRFSKMFAFLTLTTLVAMASHAAAVRQPLPQLSYWNSVLPNTPMPKAFSELVHPGDLV  60

Query  206  GKVGVTPNAILFIYTDAATEDQLHD-----DPNVALFFKKNDLQQGNQMKLHFTK--TSN  364
             K  + P         A  E+QL        P   L   + DL  G  +K  F +  TS 
Sbjct  61   SKNFLRP---------AGAENQLDKATDALGPCAGLVLMEKDLHPGKTVKYGFPRDTTSK  111

Query  365  AATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCAT  544
            ++ F+ R  A  IPFS+ K+ +IL RFSL P+S EA  +K+T++ CE PAM GEE+ CAT
Sbjct  112  SSRFVSRPTAESIPFSSNKMEEILKRFSLRPESAEANTIKETIDYCEMPAMKGEERYCAT  171

Query  545  SLESMVDFSVSQLGKN  592
            SLES+VDF+ S+LG N
Sbjct  172  SLESLVDFATSELGSN  187



>ref|XP_009353333.1| PREDICTED: BURP domain-containing protein 5-like [Pyrus x bretschneideri]
Length=315

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 110/196 (56%), Gaps = 24/196 (12%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVV---ACHAA-----LSPETYWKSVIPNTPMPGAVKDSLSTAGGV  205
            MEF+   +F+ L++  +   A HAA     L   +YW S++PNTPMP A  + +     V
Sbjct  1    MEFRFSKMFAFLTLTTLVAMASHAAAVRQPLPQLSYWNSILPNTPMPKAFSELVHPGDLV  60

Query  206  GKVGVTPNAILFIYTDAATEDQLHD-----DPNVALFFKKNDLQQGNQMKLHFTK--TSN  364
             K  + P         A  E+QL        P   L   + DL+ G  +K  F +  TS 
Sbjct  61   SKNFLRP---------AGAENQLEKATDALGPCAGLVLMEKDLRPGKTVKYGFPRDTTSK  111

Query  365  AATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCAT  544
            ++ F+ R  A  IPFS+ K+ +IL RFSL P+S EA  +K+T++ CE PAM GEE+ CAT
Sbjct  112  SSRFVSRPTAESIPFSSNKMEEILRRFSLRPESAEANTIKETIDYCEMPAMKGEERHCAT  171

Query  545  SLESMVDFSVSQLGKN  592
            SLES+VDF+ S+LG N
Sbjct  172  SLESLVDFATSELGSN  187



>ref|XP_007226272.1| hypothetical protein PRUPE_ppa019992mg [Prunus persica]
 gb|EMJ27471.1| hypothetical protein PRUPE_ppa019992mg [Prunus persica]
Length=317

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 97/173 (56%), Gaps = 20/173 (12%)
 Frame = +2

Query  125  ETYWKSVIPNTPMPGAVKD------SLSTAGGVGKVGVTP-------NAILFIYTDAA--  259
            + YW SV+PNT MP  + +      S +    VG    T        NA+   YT     
Sbjct  29   QLYWNSVLPNTQMPRTISELLHLEKSTNIMNAVGNGKPTDHKGKPEINALFSGYTIQVQY  88

Query  260  -----TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKL  424
                 +++QL    N+ +FF   D++ G  M   F + SN ATFLPR +A  IPFS+ KL
Sbjct  89   AGVPNSDNQLQYYKNITIFFLGKDMRLGATMNFQFPRNSNTATFLPRESAQSIPFSSNKL  148

Query  425  PQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
             +I   FS+ P S EA+ +KKT+EECEAP + G E+ CATSLESMVDFS S+L
Sbjct  149  SEIFKHFSVKPTSVEAKTIKKTIEECEAPGIKGGERYCATSLESMVDFSTSKL  201



>gb|KDP22142.1| hypothetical protein JCGZ_25973 [Jatropha curcas]
Length=345

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 109/214 (51%), Gaps = 51/214 (24%)
 Frame = +2

Query  98   VACHAALSPETYWKSVIPNTPMPGAVKD---------------------SLSTAGGV---  205
            V  HA+LSP  YW+SV+PN P+P  +++                     SL   GG    
Sbjct  20   VGSHASLSPMLYWESVLPNVPLPKTLQELLLQPENKGNSPNGFPYATVPSLRADGGTRIT  79

Query  206  ----------------------GKVG----VTPNAILFIYTDAATEDQLHDDPNVALFFK  307
                                  G+ G    V P   ++   + A +D    + +  +FF 
Sbjct  80   STGPKVYSRKVYSRKVYSRKVYGRKGYSRKVYPGRPIYG-KEQAQDDISKYNSSATIFFL  138

Query  308  KNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKK  487
             N+L+ GN   L FT   N  +FLPR  A  IPFS+ KLP+IL+RFS++  S EA  +++
Sbjct  139  YNNLRAGNSFSLIFTDLDNETSFLPRQVADSIPFSSDKLPEILNRFSINDTSIEANYIEQ  198

Query  488  TLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            TL+ECEAP M GE+K CATSLES VDF V++LGK
Sbjct  199  TLQECEAPIMNGEDKYCATSLESFVDFGVARLGK  232



>emb|CAD39857.2| OSJNBa0036B17.11 [Oryza sativa Japonica Group]
 gb|EAZ29834.1| hypothetical protein OsJ_13897 [Oryza sativa Japonica Group]
Length=285

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 99/170 (58%), Gaps = 18/170 (11%)
 Frame = +2

Query  116  LSPETYWKSVIPN-TPMPGAVKDSL------STAGGVGKVG------VTPNAILFIYTDA  256
            +SPE YW+S++P+ TPMP ++   L      S A G+ K G        PN    IY  A
Sbjct  1    MSPEQYWRSILPDSTPMPISISQLLGDGYPYSPAVGLPKRGDRVQIRYGPN----IYGLA  56

Query  257  ATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQIL  436
            A++ Q   DP + LFF + +LQ    +KLHF        FLPR  A  +PFS+  L +IL
Sbjct  57   ASQ-QFFKDPTMGLFFLETNLQSSKSIKLHFANMMAGTKFLPRGEADAVPFSSKDLQEIL  115

Query  437  SRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            +RF + P S +A V+K TL ECE PA  GE+K CATSLESMVDF  S LG
Sbjct  116  ARFGVRPGSVDASVVKNTLLECELPANKGEKKACATSLESMVDFVASSLG  165



>ref|XP_006366573.1| PREDICTED: BURP domain-containing protein 17-like [Solanum tuberosum]
Length=330

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 117/215 (54%), Gaps = 37/215 (17%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVAC-HAALSPETYWKSVIPNTPMPGAVKDSLSTA-GGVGKV---  214
            M+FQLL   ++  +A VA   AA+SPE YWK  +PNT MP  ++D L  A   VG     
Sbjct  1    MKFQLLYSLTICLLAFVASSDAAISPEVYWKIKMPNTRMPKVIRDFLPQAENDVGDTKEK  60

Query  215  ---GVTPNAILFIYTDAATEDQLHD----DPNVAL----------------------FFK  307
               G+  + IL     AAT++Q+HD     PN  L                      +F 
Sbjct  61   VYYGLHQHGILVF--SAATDEQIHDLKRETPNAHLRQVIQESIINSDFQDNNFLYKPYFL  118

Query  308  KNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKK  487
            +NDL++GN +     K  N A   PR     IPFS+ K+P+IL+ FS++  SK+AQ +K+
Sbjct  119  ENDLEKGNIVNFPSLKNKNEAPIWPRQFVESIPFSSKKIPEILNHFSIN-SSKDAQTIKE  177

Query  488  TLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            T++ CEAP   G+++ CATSLESMVDF +  LG N
Sbjct  178  TIKFCEAPGKKGQKQNCATSLESMVDFGIFMLGTN  212



>ref|XP_007225010.1| hypothetical protein PRUPE_ppa020264mg [Prunus persica]
 gb|EMJ26209.1| hypothetical protein PRUPE_ppa020264mg [Prunus persica]
Length=268

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +2

Query  251  DAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQ  430
            D  T++QLH   NVA+FF + D++ G  M   F + SN ATFLPR  A  IPFS+ KLP+
Sbjct  35   DRPTDNQLHYK-NVAIFFLEKDMRPGTTMSFQFPRNSNTATFLPRERAQSIPFSSNKLPE  93

Query  431  ILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
            I + FS+ P S EA+ +K+T+EECEAP + GEE  CATSLESMVDFS S+L
Sbjct  94   IFNHFSVKPTSVEAKTIKQTIEECEAPGIKGEEIYCATSLESMVDFSTSKL  144



>ref|XP_010454906.1| PREDICTED: dehydration-responsive protein RD22-like [Camelina 
sativa]
Length=392

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 82/129 (64%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKT---SNAATFLP  382
            VGV P    F+Y  AA E QLHDDPN A+FF + DL  G  M + F           FLP
Sbjct  147  VGVKPGPNPFMYNYAAKETQLHDDPNAAIFFLEKDLVPGKAMSVRFNAEDGYGGKTAFLP  206

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +P  + K  + L+RFS+   S+EA++MKKT+EECEA  +  EEK CATSLESMV
Sbjct  207  RGEAETVPLGSEKFLETLNRFSVEAGSEEAEMMKKTIEECEAKKVGAEEKYCATSLESMV  266

Query  563  DFSVSQLGK  589
            DFSVS+LGK
Sbjct  267  DFSVSKLGK  275



>ref|XP_006287907.1| hypothetical protein CARUB_v10001141mg [Capsella rubella]
 gb|EOA20805.1| hypothetical protein CARUB_v10001141mg [Capsella rubella]
Length=392

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 81/129 (63%), Gaps = 3/129 (2%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKT---SNAATFLP  382
            VGV P    F+Y  AA   QLHDDPN ALFF + DL  G  M + F           FLP
Sbjct  147  VGVKPGPNPFVYNYAAKATQLHDDPNAALFFLEKDLVPGKAMNVRFNAEDGYGGKTAFLP  206

Query  383  RSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMV  562
            R  A  +PF + K  + L RFS+   S+EA++MKKT+EECEA  +  E+K CATSLESMV
Sbjct  207  RGEAETVPFGSEKFSETLKRFSVEAGSEEAEMMKKTIEECEAKKVGEEDKYCATSLESMV  266

Query  563  DFSVSQLGK  589
            DFSVS+LGK
Sbjct  267  DFSVSKLGK  275



>gb|KDP22140.1| hypothetical protein JCGZ_25971 [Jatropha curcas]
Length=659

 Score =   132 bits (332),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 72/187 (39%), Positives = 102/187 (55%), Gaps = 15/187 (8%)
 Frame = +2

Query  77   SLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAILFIYTDA  256
            +L+ V +   +AAL  E YW S +PNT +P    + L    G   +        +I  D 
Sbjct  353  TLVVVVITGNNAALPAEVYWHSKLPNTTIPQEFLNLLQPDMGDKPIYWENLEKAYIKYDR  412

Query  257  ATEDQL---HDD------------PNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
              E+      DD            PN   FF  NDL  G +M+LH TK++N A  LPR  
Sbjct  413  RYENAFVGSRDDTREKFHKHNLNLPNSTGFFVYNDLHVGQKMRLHITKSTNKARILPRQV  472

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
            A  IPFS   LP IL RFS+ P+S +A+ +K+T+++CE+  + GE++ CATSLES+VDF+
Sbjct  473  ADSIPFSVDHLPAILQRFSVKPESPQAKFIKQTIKDCESSGIKGEDRYCATSLESLVDFT  532

Query  572  VSQLGKN  592
            V  +G N
Sbjct  533  VKHVGDN  539


 Score =   119 bits (299),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/104 (51%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  275  HDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLS  454
            H+ PN  +FF  NDL    +MKLH TK++N A  L R  A  IPFS  K  +IL  FS+ 
Sbjct  143  HNLPNSTVFFVYNDLHINRKMKLHITKSTNKARILSRQVANSIPFSTDKFSEILKCFSVK  202

Query  455  PDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
            P+S++A+V+K+T+E+CE+P + GE++ CATSLES+VDFSV  +G
Sbjct  203  PESQQAKVIKQTIEDCESPGIKGEDRYCATSLESLVDFSVKHVG  246


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAG  199
            MEF+ +   +LLSV V+  +AAL  E YW S +PNTP+P  + + L   G
Sbjct  1    MEFRFVATLALLSVVVIGSNAALPAEEYWHSKLPNTPIPQDLLNLLQPGG  50



>ref|XP_006367868.1| PREDICTED: BURP domain-containing protein 17-like [Solanum tuberosum]
Length=355

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 119/215 (55%), Gaps = 36/215 (17%)
 Frame = +2

Query  47   SMEFQLLGIFSLLSVAVVAC-HAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVT  223
            +M+FQLL   ++  +A VA   A +SPE YWK  +PNT MP  ++D LS A     VG T
Sbjct  18   TMKFQLLYSLTICVLAFVASSDAVISPEVYWKIKLPNTRMPKVIRDFLSQAEN--DVGDT  75

Query  224  PNAILF------IYT-DAATEDQLH----DDPNVAL---------------------FFK  307
               + +      I+   AAT++++H    + PN  L                     +F 
Sbjct  76   KEKVYYGLHQHGIWVFSAATDEEIHNLKRETPNAHLRQVIQESIDSDFQDNNFLYKPYFL  135

Query  308  KNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKK  487
            +NDL++GN +     K  N A   PR     IPFS+ K+P+IL+ FS++  SK+AQ +K+
Sbjct  136  ENDLEKGNIINFPSLKNKNEAPIWPRQFVESIPFSSKKIPEILNHFSIN-SSKDAQTIKE  194

Query  488  TLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            T++ CEAPA  G+++ CATSLESMVDF V  LG N
Sbjct  195  TIKFCEAPAKKGQKQNCATSLESMVDFIVFMLGTN  229



>dbj|BAC22501.1| resistant specific protein-3 [Vigna radiata]
Length=275

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 102/181 (56%), Gaps = 19/181 (10%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPN  229
            MEFQ L +F  L V ++A  AAL PE YW+ ++PNTP+P  ++   S  G +        
Sbjct  1    MEFQCLALFFSLIVILMAAQAALPPEVYWERMLPNTPIPKVIRQ-FSELGPI--------  51

Query  230  AILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPF  409
                           HD    + FF +  L++G ++ + F K + +   L R  A  +PF
Sbjct  52   ----------VNHHHHDHLKPSNFFSEERLRRGAKLDVLFRKRNFSTPLLTREIAEHLPF  101

Query  410  SAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
            S+ K+ +IL   ++ PDSK+A+ +++TL  CE PA+ GEEK CATS+ESMVDF  S+LG 
Sbjct  102  SSEKINEILEILAVKPDSKDAKNVEETLNHCEKPALKGEEKQCATSVESMVDFVTSKLGN  161

Query  590  N  592
            N
Sbjct  162  N  162



>ref|XP_010276358.1| PREDICTED: dehydration-responsive protein RD22-like [Nelumbo 
nucifera]
Length=362

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  257  ATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQIL  436
            A++D+ H DPNVA +F    L+QG +M L  T T N ATFLPR  A  IPFS+ KLP+IL
Sbjct  132  ASKDKFHLDPNVAYYFLDESLRQGTKMNLDITGTRNRATFLPRQVADSIPFSSNKLPEIL  191

Query  437  SRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGK  589
             RF +   S  A+ M++T++ CEAPA  GE K CATSLESM+DFS S+LGK
Sbjct  192  RRFRVKQHSVAAEAMEETIKVCEAPAQDGENKHCATSLESMIDFSTSKLGK  242



>ref|XP_008348420.1| PREDICTED: dehydration-responsive protein RD22-like [Malus domestica]
Length=303

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 18/151 (12%)
 Frame = +2

Query  194  AGG-----VGKVGVTPNAI---------LFIYTDAATED--QLH--DDPNVALFFKKNDL  319
            AGG     VGK G  P  +         L+ Y   AT +  QLH  D+P   LFF    +
Sbjct  30   AGGTNVDLVGKDGTKPAYVGVAQERVPFLYRYHAHATHENHQLHKDDNPQATLFFLDKGM  89

Query  320  QQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEE  499
            + G  M L+FT+ SN A FL R  A  IPFS+ +LP+I ++FS+  +S EA ++K+T+EE
Sbjct  90   RPGTTMNLNFTRNSNTANFLLRKTAELIPFSSNELPEIFNQFSVKSESVEANIIKQTIEE  149

Query  500  CEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            CEAP + GEEK CATSLESM+DF+ S+LG+N
Sbjct  150  CEAPGIRGEEKYCATSLESMIDFTTSKLGRN  180



>ref|XP_009373564.1| PREDICTED: dehydration-responsive protein RD22-like isoform X3 
[Pyrus x bretschneideri]
Length=397

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 97/153 (63%), Gaps = 18/153 (12%)
 Frame = +2

Query  188  STAGG-----VGKVGVTP---------NAILFI--YTDAATEDQLH--DDPNVALFFKKN  313
            +T GG     VGK G  P         NA++++  +  A  E+QLH  D+P   LFF + 
Sbjct  122  ATHGGTNVDLVGKDGTKPAYVGVAQEGNALVYLSHHAHATHENQLHKDDNPQATLFFLEK  181

Query  314  DLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTL  493
            D++ G  M L+FT+  N A FL R  A  IPFS+ KLP+I ++FS+  +S EA ++K+T+
Sbjct  182  DMRPGTTMNLNFTRNLNTANFLLRKTAELIPFSSNKLPEIFNQFSVKSESVEANIIKQTI  241

Query  494  EECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            EECEA  + GEEK C TSLESM+DF+ S+LG+N
Sbjct  242  EECEAAGIRGEEKYCTTSLESMIDFTTSKLGRN  274



>ref|XP_008219773.1| PREDICTED: dehydration-responsive protein RD22-like, partial 
[Prunus mume]
Length=289

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  260  TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILS  439
            ++ QL     +A+FF + D++ G  MK  F ++SN ATFLPR +A  IPFS+ KLP+I +
Sbjct  58   SDSQLLHYKELAIFFFEKDMRPGATMKFQFPRSSNTATFLPRESAQSIPFSSNKLPEIFN  117

Query  440  RFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
             FSL P S EA+ +K+T+EECEAP + GEEK CATSLESMVDFS S+LG
Sbjct  118  HFSLKPTSVEAKTIKETIEECEAPGLKGEEKYCATSLESMVDFSTSKLG  166



>ref|XP_007222162.1| hypothetical protein PRUPE_ppa005767mg [Prunus persica]
 gb|EMJ23361.1| hypothetical protein PRUPE_ppa005767mg [Prunus persica]
Length=444

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  260  TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILS  439
            ++ QL    ++A+FF + D++ G  MK  F + SN ATFLPR +A  IPFS+ KLP+I +
Sbjct  213  SDSQLKHYKDLAIFFFEKDMRPGTTMKFQFPRNSNTATFLPRESAQSIPFSSKKLPEIFN  272

Query  440  RFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
             FS+ P S+EA+ +K+T+EECEAP + GEEK CATSLESMVDFS S+LG
Sbjct  273  HFSVKPTSEEAKTIKQTIEECEAPGLKGEEKYCATSLESMVDFSTSKLG  321



>ref|XP_007223280.1| hypothetical protein PRUPE_ppa005535mg [Prunus persica]
 gb|EMJ24479.1| hypothetical protein PRUPE_ppa005535mg [Prunus persica]
Length=456

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +2

Query  260  TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILS  439
            ++ QL    ++A+FF + D++ G  MK  F + SN ATFLPR +A  IPFS+ KLP+I +
Sbjct  225  SDSQLKHYKDLAIFFFEKDMRPGTTMKFQFPRNSNTATFLPRESAQSIPFSSKKLPEIFN  284

Query  440  RFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
             FS+ P S+EA+ +K+T+EECEAP + GEEK CATSLESMVDFS S+LG
Sbjct  285  HFSVKPTSEEAKTIKQTIEECEAPGLKGEEKYCATSLESMVDFSTSKLG  333



>ref|XP_009373563.1| PREDICTED: dehydration-responsive protein RD22-like isoform X2 
[Pyrus x bretschneideri]
Length=422

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 97/153 (63%), Gaps = 18/153 (12%)
 Frame = +2

Query  188  STAGG-----VGKVGVTP---------NAILFI--YTDAATEDQLH--DDPNVALFFKKN  313
            +T GG     VGK G  P         NA++++  +  A  E+QLH  D+P   LFF + 
Sbjct  147  ATHGGTNVDLVGKDGTKPAYVGVAQEGNALVYLSHHAHATHENQLHKDDNPQATLFFLEK  206

Query  314  DLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTL  493
            D++ G  M L+FT+  N A FL R  A  IPFS+ KLP+I ++FS+  +S EA ++K+T+
Sbjct  207  DMRPGTTMNLNFTRNLNTANFLLRKTAELIPFSSNKLPEIFNQFSVKSESVEANIIKQTI  266

Query  494  EECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            EECEA  + GEEK C TSLESM+DF+ S+LG+N
Sbjct  267  EECEAAGIRGEEKYCTTSLESMIDFTTSKLGRN  299



>ref|XP_004308362.1| PREDICTED: dehydration-responsive protein RD22-like [Fragaria 
vesca subsp. vesca]
Length=313

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 110/194 (57%), Gaps = 39/194 (20%)
 Frame = +2

Query  128  TYWKSVIPNTPMPG-AVKDSLSTA------GGVGK-----------------VGVTPNAI  235
            +YW S +P +P+P  AV+  L+ A       G+GK                 V VTP++I
Sbjct  2    SYWNSALPKSPLPSKAVQQLLNLAEGERSYTGIGKDAVSLKPHSIKTGYADVVSVTPHSI  61

Query  236  LFIYTDA-------------ATEDQLHDDPNVALFFKKNDLQQ-GNQMKLHFTK-TSNAA  370
               Y DA             A  +++  + ++  FF+  DLQ  G  + L F K TSN A
Sbjct  62   KTGYADAVSVTPHSIKTGYAAFGEEVKLERDLTTFFQGKDLQDSGKTVTLRFLKLTSNKA  121

Query  371  TFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSL  550
            T LPR     IPFS+ K P+IL+ F ++P S  A+ MK+T+++CEAPA+ GEEK CATSL
Sbjct  122  TLLPRQVTQSIPFSSSKFPEILTYFGVNPKSAAAERMKRTIKDCEAPAIKGEEKYCATSL  181

Query  551  ESMVDFSVSQLGKN  592
            ES++DF+VS+LGKN
Sbjct  182  ESLIDFTVSKLGKN  195



>ref|XP_009373562.1| PREDICTED: dehydration-responsive protein RD22-like isoform X1 
[Pyrus x bretschneideri]
Length=435

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 97/153 (63%), Gaps = 18/153 (12%)
 Frame = +2

Query  188  STAGG-----VGKVGVTP---------NAILFI--YTDAATEDQLH--DDPNVALFFKKN  313
            +T GG     VGK G  P         NA++++  +  A  E+QLH  D+P   LFF + 
Sbjct  160  ATHGGTNVDLVGKDGTKPAYVGVAQEGNALVYLSHHAHATHENQLHKDDNPQATLFFLEK  219

Query  314  DLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTL  493
            D++ G  M L+FT+  N A FL R  A  IPFS+ KLP+I ++FS+  +S EA ++K+T+
Sbjct  220  DMRPGTTMNLNFTRNLNTANFLLRKTAELIPFSSNKLPEIFNQFSVKSESVEANIIKQTI  279

Query  494  EECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            EECEA  + GEEK C TSLESM+DF+ S+LG+N
Sbjct  280  EECEAAGIRGEEKYCTTSLESMIDFTTSKLGRN  312



>ref|XP_010916769.1| PREDICTED: BURP domain-containing protein 3-like [Elaeis guineensis]
Length=296

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 104/178 (58%), Gaps = 6/178 (3%)
 Frame = +2

Query  59   QLLGIFSLLS-VAVVACHAALSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAI  235
            + + I SLL  VA    +A L  E YW+ V+PNT MP  +   L      G V +  N  
Sbjct  3    RFVFILSLLVLVAASVGNATLPAELYWQKVLPNTLMPKIIMAQLHPDAKGGNVTII-NPY  61

Query  236  LFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMK--LHFTKTSNAATFLPRSAAGKIPF  409
              +Y   +TE Q   DP  ALFF + DL  G  M   L FT+T + A F+PR+ A  IPF
Sbjct  62   RPLYYSVSTELQFPSDP--ALFFLEKDLHPGAGMNPGLSFTRTLSGAAFIPRAQADAIPF  119

Query  410  SAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQL  583
            S+ K P+IL R ++ P+S+ A+ +KKTL +CE  A+ GE K CATSLESM+DF  S+L
Sbjct  120  SSDKFPEILHRLNVLPNSELAKEVKKTLGDCEEAAIEGEHKFCATSLESMLDFVTSKL  177



>emb|CDP18476.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 81/127 (64%), Gaps = 26/127 (20%)
 Frame = +2

Query  212  VGVTPNAILFIYTDAATEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSA  391
            VG  P    F+Y  AAT DQLHD+PNVALFF +N++ +G++M LHF KTS+ ATFLPR  
Sbjct  157  VGGRPGTSPFLYNYAATRDQLHDNPNVALFFLENNMTRGSKMNLHFFKTSHGATFLPR--  214

Query  392  AGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFS  571
                                    +EA+VMK T++ECE P + GEEK CATSLE+MVDF+
Sbjct  215  ------------------------QEAEVMKNTIKECEKPGIQGEEKFCATSLEAMVDFT  250

Query  572  VSQLGKN  592
             S+LGKN
Sbjct  251  TSKLGKN  257


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVKD  181
            MEF+ + +F  +++A V+ HAA   ETYWKSV+PN+PMP A++D
Sbjct  1    MEFRPVHLFIFVALACVSSHAAQPAETYWKSVLPNSPMPKAIED  44



>ref|XP_008219789.1| PREDICTED: dehydration-responsive protein RD22-like isoform X2 
[Prunus mume]
Length=344

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 113/221 (51%), Gaps = 42/221 (19%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAAL---SPETYWKSVIPNTPMPGAV---------------  175
            M F L  IF++LS+A VA        +P+ YW SV+PNT MP A+               
Sbjct  1    MGFHLPLIFAILSLAAVALANHAAQPAPQLYWNSVLPNTQMPRAISELLHPDSTNEEKSK  60

Query  176  --------KDSLSTAGGVGKV----------------GVTPNAILFIYTDAATEDQLHDD  283
                    K+ L    G GK                    P    +      +++QL   
Sbjct  61   PENFPLANKNYLQQGYGKGKPVQKGYGKGKPVQKGYGKGKPVQKGYGKRSPPSDNQLLHY  120

Query  284  PNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDS  463
              +A+FF + D++ G  MK  F + SN ATFL R +A  IPFS+ KLP+I + FS+ P S
Sbjct  121  KELAIFFFEKDMRPGTTMKFQFPRNSNTATFLSRESAQSIPFSSNKLPEIFNHFSVKPTS  180

Query  464  KEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
             EAQ +K+T+E CEA  + GEEK CATSLESMVDFS S+LG
Sbjct  181  VEAQTIKQTIEGCEALGIKGEEKYCATSLESMVDFSTSKLG  221



>ref|XP_007224167.1| hypothetical protein PRUPE_ppa016850mg [Prunus persica]
 gb|EMJ25366.1| hypothetical protein PRUPE_ppa016850mg [Prunus persica]
Length=277

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  260  TEDQLHDDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILS  439
            ++ QL    ++A+FF + D++ G+ MK  F + SN ATFLPR +A  IPFS  KLP+I +
Sbjct  54   SDSQLLHYKDIAIFFFEKDMRPGSTMKFQFPRNSNTATFLPRESAQSIPFSFNKLPEIFN  113

Query  440  RFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLG  586
             FS+ P S EA+ +K+T+EECEAP + G+EK CATSLESMVDFS S+LG
Sbjct  114  HFSVKPTSVEAKTIKQTIEECEAPGIKGDEKYCATSLESMVDFSTSKLG  162



>ref|XP_009367978.1| PREDICTED: dehydration-responsive protein RD22-like [Pyrus x 
bretschneideri]
Length=315

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 102/177 (58%), Gaps = 21/177 (12%)
 Frame = +2

Query  98   VACHAA-----LSPETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAILFIYTDAAT  262
            +A HAA     L   +YW SV+PNTP+P A ++ +     V K  + P         A T
Sbjct  20   MASHAAAVRQPLPQLSYWNSVLPNTPIPKAFRELIHPGDLVSKNFLRP---------AGT  70

Query  263  EDQLHD-----DPNVALFFKKNDLQQGNQMKLHFTK--TSNAATFLPRSAAGKIPFSAVK  421
            E+QL        P   L   + DL +G  +K  F +  TS ++ F+ R  A  IPFS+ K
Sbjct  71   ENQLDKATDALGPCAGLVLMEKDLHRGKTVKYGFPRDTTSKSSRFVSRLTAESIPFSSNK  130

Query  422  LPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            + +IL RFSL P+S EA  +K+T++ CE PAM GEE+ CATSLES+VDF+ S+LG N
Sbjct  131  MEEILKRFSLRPESSEANTIKETIDYCEMPAMKGEERYCATSLESLVDFATSELGSN  187



>ref|XP_006384368.1| hypothetical protein POPTR_0004s14410g [Populus trichocarpa]
 gb|ERP62165.1| hypothetical protein POPTR_0004s14410g [Populus trichocarpa]
Length=328

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 101/174 (58%), Gaps = 25/174 (14%)
 Frame = +2

Query  125  ETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAIL------FIYTDAATEDQLH--D  280
            E YW S +PNTP+P A++D+L       + G  P+ I        I  DA  +   H  +
Sbjct  46   EKYWFSRLPNTPLPKALRDTL-------QPGYYPSVIRDFANGEKISVDAREKYGKHYGE  98

Query  281  D----------PNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQ  430
            D          P+  +F+  NDL  G +MKL FT +    +FLPR  A  IPFS+ K P+
Sbjct  99   DSHKKTAKSALPDSTIFYLYNDLHPGKKMKLLFTNSGTKVSFLPRRVAESIPFSSDKFPE  158

Query  431  ILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            IL  FSL  +S+EA+++   +  CE+P M GEEK CATSLES++DF+V++LG+N
Sbjct  159  ILKYFSLQVNSEEAEIISDEIGYCESPNMEGEEKYCATSLESLIDFNVARLGQN  212



>gb|EPS64452.1| hypothetical protein M569_10329 [Genlisea aurea]
Length=306

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 101/183 (55%), Gaps = 13/183 (7%)
 Frame = +2

Query  80   LLSVAVVACHAALSPETYWKSVIPNTPMPGAVKDSL-STAGGVGKVGVTPNAILFIYTDA  256
            +L  A  A   + +PE YWK+ +PN+P+P  ++  L ST      +        + +   
Sbjct  8    ILVAAAAANEPSSTPEDYWKANLPNSPIPQFIRHLLTSTPSDESIIDEKRRTTSWSHAGE  67

Query  257  ATEDQLH------------DDPNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGK  400
                  H            D+P+++L F + DL+ G  M L+F K S+ A FLPR  A  
Sbjct  68   HVAGDKHGAHFNEDLSDQEDNPSLSLIFFQQDLRIGKSMNLNFRKPSDLAPFLPRHLADS  127

Query  401  IPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQ  580
            IPFS+    QIL +FSL PDS +A+V+K TL +CE  A+ GEE  C TSLESM+DF+ S+
Sbjct  128  IPFSSKNFSQILQKFSLVPDSPKARVLKTTLHDCEVKAVRGEEIFCPTSLESMIDFTFSR  187

Query  581  LGK  589
            LGK
Sbjct  188  LGK  190



>ref|XP_006388650.1| hypothetical protein POPTR_0129s00200g [Populus trichocarpa]
 gb|ERP47564.1| hypothetical protein POPTR_0129s00200g [Populus trichocarpa]
Length=328

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 101/174 (58%), Gaps = 25/174 (14%)
 Frame = +2

Query  125  ETYWKSVIPNTPMPGAVKDSLSTAGGVGKVGVTPNAIL------FIYTDAATEDQLH--D  280
            E YW S +PNTP+P A++D+L       + G  P+ I        I  DA  +   H  +
Sbjct  46   EKYWFSRLPNTPLPKALRDTL-------QPGYYPSVIRDFANGEKISVDAREKYGKHYGE  98

Query  281  D----------PNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQ  430
            D          P+  +F+  NDL  G +MKL FT +    +FLPR  A  IPFS+ K P+
Sbjct  99   DSHKKTAKSALPDSTIFYLYNDLHPGKKMKLLFTNSGTKVSFLPRRVAESIPFSSDKFPE  158

Query  431  ILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            IL  FSL  +S+EA+++   +  CE+P M GEEK CATSLES++DF+V++LG+N
Sbjct  159  ILKYFSLQVNSEEAEIISDEIGYCESPNMEGEEKYCATSLESLIDFNVARLGQN  212



>ref|XP_007012035.1| BURP domain-containing protein, putative [Theobroma cacao]
 gb|EOY29654.1| BURP domain-containing protein, putative [Theobroma cacao]
Length=283

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 104/217 (48%), Gaps = 50/217 (23%)
 Frame = +2

Query  50   MEFQLLGIFSLLSVAVVACHAALSPETYWKSVIPNTPMPGAVK------------DSLST  193
            MEF L  + + +++AVVA HA LSP   W  V+PNTPMP AVK             S + 
Sbjct  1    MEFHLSPVLAFIALAVVASHAVLSPGHCWNYVLPNTPMPKAVKVMLHPDFMENKGTSFNV  60

Query  194  AGG-----------------VGKVGVT-------PNAILFIYTDAATEDQLHDDPNVALF  301
             GG                 VGK GV+       P     +             P    F
Sbjct  61   GGGSVNVNTGKEKPGGTAVNVGKGGVSVNTGKRKPGGGTHVNVGGQGVGVNTGKPGGGTF  120

Query  302  FKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVM  481
                  +               ATFLPR  A KI FS+ KLP+IL++FS+ P S  A++M
Sbjct  121  VNVGGKE--------------TATFLPRHIAQKILFSSDKLPEILNKFSVKPGSAGAEIM  166

Query  482  KKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            K T++ECE P + GE+K C TSLESM+DFS S++GKN
Sbjct  167  KNTIKECEQPQIQGEDKYCVTSLESMIDFSTSKIGKN  203



>ref|XP_002325305.1| embryonic abundant family protein [Populus trichocarpa]
 gb|EEE99686.1| embryonic abundant family protein [Populus trichocarpa]
Length=348

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 96/170 (56%), Gaps = 14/170 (8%)
 Frame = +2

Query  125  ETYWKSVIPNTPMPGAVKDSL------STAGGVGKVGVTPNAILFIYTDAATEDQLHDD-  283
            E YW S +PNTP+P A++  L      S         V+   I  IY           D 
Sbjct  63   EKYWYSRLPNTPLPKALEYLLQPGHYPSITREFANENVSATVIQRIYRRVYKRGYKRGDK  122

Query  284  -------PNVALFFKKNDLQQGNQMKLHFTKTSNAATFLPRSAAGKIPFSAVKLPQILSR  442
                   P+  +F++ NDL  G ++K+ FT +    +FLPR  A  IPFS+ K+P+IL  
Sbjct  123  KSLKSALPDSTIFYQYNDLHPGKKLKILFTDSGTKVSFLPRQIAESIPFSSDKIPEILKY  182

Query  443  FSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCATSLESMVDFSVSQLGKN  592
            F+L  +SKEAQV+++ +  CE P M GE+K CATSLES++D+SV +LG+N
Sbjct  183  FTLEVNSKEAQVIREEIGGCEEPNMEGEDKYCATSLESLIDYSVERLGQN  232



>ref|XP_004306763.1| PREDICTED: BURP domain-containing protein 3-like [Fragaria vesca 
subsp. vesca]
Length=314

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 113/196 (58%), Gaps = 16/196 (8%)
 Frame = +2

Query  53   EFQLLGIFSLLSVAVVACHAALSPE--------TYWKSVIPNTPMPG-AVKDSLSTAGGV  205
            + +LL +FS+  VA V      +          +YW +  P +P+P  AV+  L+ AG  
Sbjct  3    QIRLLCLFSIFYVASVVVGIGYANGADDGKFRMSYWNTAFPKSPLPSKAVQQLLNLAGET  62

Query  206  GKVGVTPNAI-----LFIYTDAATEDQLHDDPNVALFFKKNDLQQ-GNQMKLHFTK-TSN  364
               G    A+     + I +  +++++   +P++  FF+  DLQQ G  + L   K TSN
Sbjct  63   SNTGFGKQALNLAPEIPINSYGSSKEETPAEPDLTTFFQGQDLQQKGKTVTLRLLKPTSN  122

Query  365  AATFLPRSAAGKIPFSAVKLPQILSRFSLSPDSKEAQVMKKTLEECEAPAMMGEEKLCAT  544
             AT L R  A  IPFS+ KLP+IL+ F + P+S  A +MK+T+EECEAPA+  E K C T
Sbjct  123  KATLLSRQVAKSIPFSSSKLPEILTYFGVKPNSLAAGLMKQTIEECEAPAIKREGKYCLT  182

Query  545  SLESMVDFSVSQLGKN  592
            SLES++DF+VS LGK+
Sbjct  183  SLESLIDFTVSNLGKD  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160