BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G17

Length=491
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP14130.1|  unnamed protein product                                298   2e-98   Coffea canephora [robusta coffee]
ref|XP_009782888.1|  PREDICTED: transcription initiation factor I...    296   9e-98   Nicotiana sylvestris
ref|XP_009595638.1|  PREDICTED: transcription initiation factor I...    295   3e-97   Nicotiana tomentosiformis
ref|XP_009597032.1|  PREDICTED: transcription initiation factor I...    294   1e-96   Nicotiana tomentosiformis
ref|XP_006351306.1|  PREDICTED: transcription initiation factor I...    293   2e-96   Solanum tuberosum [potatoes]
ref|XP_004249253.1|  PREDICTED: transcription initiation factor I...    293   2e-96   Solanum lycopersicum
ref|XP_004249217.1|  PREDICTED: transcription initiation factor I...    291   2e-95   Solanum lycopersicum
ref|XP_006351253.1|  PREDICTED: transcription initiation factor I...    291   2e-95   Solanum tuberosum [potatoes]
ref|XP_010312094.1|  PREDICTED: transcription initiation factor I...    291   2e-95   Solanum lycopersicum
ref|XP_006351254.1|  PREDICTED: transcription initiation factor I...    291   2e-95   Solanum tuberosum [potatoes]
ref|XP_009772113.1|  PREDICTED: transcription initiation factor I...    290   4e-95   Nicotiana sylvestris
ref|XP_011078912.1|  PREDICTED: transcription initiation factor I...    289   6e-95   Sesamum indicum [beniseed]
ref|XP_011075341.1|  PREDICTED: transcription initiation factor I...    286   9e-94   Sesamum indicum [beniseed]
gb|EYU18714.1|  hypothetical protein MIMGU_mgv1a010444mg                286   1e-93   Erythranthe guttata [common monkey flower]
gb|EYU20758.1|  hypothetical protein MIMGU_mgv1a010447mg                284   1e-92   Erythranthe guttata [common monkey flower]
ref|XP_006298174.1|  hypothetical protein CARUB_v10014225mg             253   4e-81   
ref|XP_002882661.1|  transcription initiation factor IIB-2              254   5e-81   
ref|XP_009135103.1|  PREDICTED: transcription initiation factor I...    254   6e-81   Brassica rapa
gb|KFK24868.1|  hypothetical protein AALP_AA8G035400                    253   9e-81   Arabis alpina [alpine rockcress]
ref|XP_010482840.1|  PREDICTED: transcription initiation factor I...    252   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006289549.1|  hypothetical protein CARUB_v10003094mg             252   2e-80   Capsella rubella
gb|KJB36009.1|  hypothetical protein B456_006G136100                    249   2e-80   Gossypium raimondii
emb|CAA84309.1|  AtTFIIB2                                               252   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006421305.1|  hypothetical protein CICLE_v10005479mg             249   3e-80   
ref|XP_008387306.1|  PREDICTED: transcription initiation factor I...    251   4e-80   Malus domestica [apple tree]
ref|XP_007145590.1|  hypothetical protein PHAVU_007G251400g             251   4e-80   Phaseolus vulgaris [French bean]
ref|XP_010269721.1|  PREDICTED: transcription initiation factor IIB     251   4e-80   Nelumbo nucifera [Indian lotus]
ref|XP_007015120.1|  Cyclin-like family protein                         251   4e-80   
emb|CAN74371.1|  hypothetical protein VITISV_004775                     251   4e-80   Vitis vinifera
ref|XP_004150610.1|  PREDICTED: transcription initiation factor I...    251   5e-80   Cucumis sativus [cucumbers]
ref|NP_187644.1|  transcription initiation factor IIB-2                 251   7e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304334.1|  PREDICTED: transcription initiation factor IIB     251   7e-80   Fragaria vesca subsp. vesca
ref|XP_002269045.1|  PREDICTED: transcription initiation factor I...    251   7e-80   Vitis vinifera
ref|XP_002284342.1|  PREDICTED: transcription initiation factor I...    251   7e-80   Vitis vinifera
ref|XP_009409174.1|  PREDICTED: transcription initiation factor I...    251   8e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788361.1|  PREDICTED: transcription initiation factor IIB     251   8e-80   Phoenix dactylifera
ref|XP_010920217.1|  PREDICTED: transcription initiation factor IIB     251   9e-80   Elaeis guineensis
ref|XP_006421304.1|  hypothetical protein CICLE_v10005479mg             250   1e-79   Citrus clementina [clementine]
ref|XP_009388781.1|  PREDICTED: transcription initiation factor I...    250   1e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB36008.1|  hypothetical protein B456_006G136100                    250   2e-79   Gossypium raimondii
ref|XP_007162169.1|  hypothetical protein PHAVU_001G130000g             250   2e-79   Phaseolus vulgaris [French bean]
ref|XP_007028688.1|  Cyclin-like family protein isoform 1               250   2e-79   Theobroma cacao [chocolate]
ref|XP_004516731.1|  PREDICTED: transcription initiation factor I...    250   2e-79   Cicer arietinum [garbanzo]
ref|XP_008785330.1|  PREDICTED: transcription initiation factor IIB     249   2e-79   
ref|XP_009355479.1|  PREDICTED: transcription initiation factor I...    249   3e-79   Pyrus x bretschneideri [bai li]
ref|XP_007202277.1|  hypothetical protein PRUPE_ppa008972mg             249   3e-79   Prunus persica
gb|KDP22116.1|  hypothetical protein JCGZ_25947                         249   3e-79   Jatropha curcas
ref|NP_001063775.1|  Os09g0534800                                       249   3e-79   
ref|XP_010312093.1|  PREDICTED: transcription initiation factor I...    248   3e-79   
ref|XP_002460572.1|  hypothetical protein SORBIDRAFT_02g031020          249   3e-79   Sorghum bicolor [broomcorn]
ref|XP_009772114.1|  PREDICTED: transcription initiation factor I...    249   3e-79   Nicotiana sylvestris
ref|XP_004957467.1|  PREDICTED: transcription initiation factor I...    249   4e-79   Setaria italica
ref|XP_006660890.1|  PREDICTED: transcription initiation factor I...    249   4e-79   Oryza brachyantha
ref|XP_009597031.1|  PREDICTED: transcription initiation factor I...    249   4e-79   Nicotiana tomentosiformis
ref|XP_004249237.1|  PREDICTED: transcription initiation factor I...    248   6e-79   Solanum lycopersicum
ref|XP_002534470.1|  transcription initiation factor iib, putative      248   6e-79   Ricinus communis
ref|XP_010941281.1|  PREDICTED: transcription initiation factor I...    248   7e-79   Elaeis guineensis
ref|XP_002513521.1|  transcription initiation factor iib, putative      248   7e-79   Ricinus communis
dbj|BAJ53205.1|  JHL06B08.6                                             248   7e-79   Jatropha curcas
ref|XP_010672876.1|  PREDICTED: transcription initiation factor I...    248   9e-79   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB14839.1|  hypothetical protein B456_002G146300                    248   9e-79   Gossypium raimondii
ref|XP_003578512.1|  PREDICTED: transcription initiation factor IIB     248   9e-79   Brachypodium distachyon [annual false brome]
dbj|BAK05040.1|  predicted protein                                      248   1e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010558141.1|  PREDICTED: transcription initiation factor I...    248   1e-78   Tarenaya hassleriana [spider flower]
gb|KJB14836.1|  hypothetical protein B456_002G146300                    248   1e-78   Gossypium raimondii
ref|XP_002277679.1|  PREDICTED: transcription initiation factor IIB     247   2e-78   Vitis vinifera
ref|XP_008392240.1|  PREDICTED: transcription initiation factor I...    247   3e-78   
ref|XP_010934192.1|  PREDICTED: transcription initiation factor I...    246   4e-78   Elaeis guineensis
ref|XP_008788640.1|  PREDICTED: transcription initiation factor I...    246   4e-78   Phoenix dactylifera
ref|XP_010935048.1|  PREDICTED: transcription initiation factor I...    246   5e-78   Elaeis guineensis
ref|XP_003519077.1|  PREDICTED: transcription initiation factor I...    246   6e-78   Glycine max [soybeans]
ref|XP_010554814.1|  PREDICTED: transcription initiation factor I...    246   7e-78   Tarenaya hassleriana [spider flower]
ref|XP_002308933.1|  Transcription initiation factor IIB-1 family...    245   9e-78   Populus trichocarpa [western balsam poplar]
ref|XP_009409510.1|  PREDICTED: transcription initiation factor IIB     245   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001238343.1|  transcription initiation factor IIB                245   2e-77   Glycine max [soybeans]
ref|XP_002322722.1|  Transcription initiation factor IIB-1 family...    244   2e-77   Populus trichocarpa [western balsam poplar]
ref|XP_011039445.1|  PREDICTED: transcription initiation factor I...    244   2e-77   Populus euphratica
ref|XP_008799413.1|  PREDICTED: transcription initiation factor I...    244   2e-77   Phoenix dactylifera
ref|NP_001149721.1|  transcription initiation factor IIB                244   2e-77   Zea mays [maize]
ref|XP_011075342.1|  PREDICTED: transcription initiation factor I...    246   2e-77   Sesamum indicum [beniseed]
tpg|DAA40631.1|  TPA: hypothetical protein ZEAMMB73_839050              244   3e-77   
gb|ACF81664.1|  unknown                                                 244   3e-77   Zea mays [maize]
ref|XP_011048084.1|  PREDICTED: transcription initiation factor I...    244   4e-77   Populus euphratica
ref|XP_011090131.1|  PREDICTED: transcription initiation factor I...    244   4e-77   Sesamum indicum [beniseed]
ref|XP_010523759.1|  PREDICTED: transcription initiation factor I...    243   6e-77   Tarenaya hassleriana [spider flower]
ref|XP_004493474.1|  PREDICTED: transcription initiation factor I...    243   8e-77   Cicer arietinum [garbanzo]
emb|CDP14131.1|  unnamed protein product                                242   2e-76   Coffea canephora [robusta coffee]
ref|XP_010056895.1|  PREDICTED: transcription initiation factor I...    242   2e-76   Eucalyptus grandis [rose gum]
ref|XP_003625123.1|  Transcription initiation factor IIB                241   4e-76   Medicago truncatula
gb|ABR16853.1|  unknown                                                 239   2e-75   Picea sitchensis
ref|XP_009380970.1|  PREDICTED: transcription initiation factor I...    239   3e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN07351.1|  Transcription initiation factor IIB-2                   238   6e-75   Glycine soja [wild soybean]
ref|XP_010517653.1|  PREDICTED: transcription initiation factor I...    238   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006294641.1|  hypothetical protein CARUB_v10023678mg             238   1e-74   Capsella rubella
ref|XP_002881787.1|  hypothetical protein ARALYDRAFT_903484             237   1e-74   Arabidopsis lyrata subsp. lyrata
gb|EPS61179.1|  hypothetical protein M569_13619                         233   3e-74   Genlisea aurea
ref|XP_010028570.1|  PREDICTED: transcription initiation factor I...    236   5e-74   Eucalyptus grandis [rose gum]
gb|EYU18713.1|  hypothetical protein MIMGU_mgv1a010428mg                236   5e-74   Erythranthe guttata [common monkey flower]
ref|XP_006411427.1|  hypothetical protein EUTSA_v10016972mg             236   5e-74   Eutrema salsugineum [saltwater cress]
ref|XP_010673685.1|  PREDICTED: transcription initiation factor I...    236   6e-74   
ref|XP_003521166.1|  PREDICTED: transcription initiation factor I...    235   7e-74   Glycine max [soybeans]
emb|CDY23840.1|  BnaC04g01970D                                          235   7e-74   Brassica napus [oilseed rape]
ref|XP_006476712.1|  PREDICTED: transcription initiation factor I...    234   2e-73   Citrus sinensis [apfelsine]
ref|XP_002322134.1|  Transcription initiation factor IIB-1 family...    233   6e-73   
ref|NP_181694.1|  transcription initiation factor IIB-1                 233   7e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006439685.1|  hypothetical protein CICLE_v10021272mg             233   1e-72   Citrus clementina [clementine]
gb|KDO75998.1|  hypothetical protein CISIN_1g021438mg                   233   1e-72   Citrus sinensis [apfelsine]
ref|XP_011028679.1|  PREDICTED: transcription initiation factor I...    232   1e-72   Populus euphratica
gb|EMS56891.1|  Transcription initiation factor IIB                     233   2e-72   Triticum urartu
gb|KDO75999.1|  hypothetical protein CISIN_1g021438mg                   231   2e-72   Citrus sinensis [apfelsine]
gb|KEH33433.1|  transcription initiation factor IIB                     232   2e-72   Medicago truncatula
ref|XP_009133502.1|  PREDICTED: transcription initiation factor I...    231   2e-72   Brassica rapa
ref|XP_010934190.1|  PREDICTED: transcription initiation factor I...    232   4e-72   Elaeis guineensis
gb|KFK37005.1|  hypothetical protein AALP_AA4G200000                    226   2e-70   Arabis alpina [alpine rockcress]
ref|XP_010413000.1|  PREDICTED: uncharacterized protein LOC104699385    231   4e-69   
ref|XP_006605212.1|  PREDICTED: transcription initiation factor I...    223   5e-69   Glycine max [soybeans]
gb|KEH41632.1|  transcription initiation factor IIB                     221   3e-68   Medicago truncatula
ref|XP_001772159.1|  predicted protein                                  221   4e-68   
ref|XP_002961186.1|  hypothetical protein SELMODRAFT_266576             219   2e-67   
ref|XP_002966817.1|  hypothetical protein SELMODRAFT_87129              219   2e-67   Selaginella moellendorffii
ref|XP_008239669.1|  PREDICTED: transcription initiation factor I...    218   4e-67   Prunus mume [ume]
gb|EMT25381.1|  Transcription initiation factor IIB                     214   6e-67   
gb|KDP31182.1|  hypothetical protein JCGZ_11558                         217   1e-66   Jatropha curcas
ref|XP_007210181.1|  hypothetical protein PRUPE_ppa020307mg             216   3e-66   Prunus persica
ref|XP_006853036.1|  hypothetical protein AMTR_s00038p00018470          215   6e-66   Amborella trichopoda
ref|XP_011090132.1|  PREDICTED: transcription initiation factor I...    214   1e-65   
gb|ACF84713.1|  unknown                                                 210   2e-65   Zea mays [maize]
ref|XP_009369381.1|  PREDICTED: transcription initiation factor I...    207   9e-63   Pyrus x bretschneideri [bai li]
ref|XP_006421303.1|  hypothetical protein CICLE_v10005479mg             204   1e-62   
gb|KJB14838.1|  hypothetical protein B456_002G146300                    202   5e-62   Gossypium raimondii
gb|KJB14837.1|  hypothetical protein B456_002G146300                    202   6e-62   Gossypium raimondii
gb|KEH33477.1|  transcription initiation factor IIB                     207   8e-62   Medicago truncatula
gb|KJB14835.1|  hypothetical protein B456_002G146300                    201   1e-61   Gossypium raimondii
gb|KFK38412.1|  hypothetical protein AALP_AA3G110000                    202   4e-61   Arabis alpina [alpine rockcress]
gb|KCW90140.1|  hypothetical protein EUGRSUZ_A02331                     196   2e-59   Eucalyptus grandis [rose gum]
ref|XP_008374507.1|  PREDICTED: transcription initiation factor I...    198   3e-59   
ref|XP_006477530.1|  PREDICTED: transcription initiation factor I...    194   4e-59   
gb|KDO76000.1|  hypothetical protein CISIN_1g021438mg                   192   2e-57   Citrus sinensis [apfelsine]
ref|XP_007028689.1|  Cyclin-like family protein isoform 2               189   1e-56   
ref|XP_008351835.1|  PREDICTED: transcription initiation factor I...    184   1e-53   
ref|XP_001758790.1|  predicted protein                                  178   1e-51   
gb|KEH33482.1|  transcription initiation factor IIB                     176   2e-51   Medicago truncatula
ref|XP_004961337.1|  PREDICTED: transcription initiation factor I...    159   3e-44   Setaria italica
ref|XP_002440177.1|  hypothetical protein SORBIDRAFT_09g027310          153   7e-42   Sorghum bicolor [broomcorn]
ref|XP_008231004.1|  PREDICTED: transcription initiation factor IIB     152   1e-41   Prunus mume [ume]
ref|XP_004963621.1|  PREDICTED: transcription initiation factor I...    152   1e-41   Setaria italica
ref|XP_011075610.1|  PREDICTED: transcription initiation factor IIB     151   2e-41   
ref|XP_008393133.1|  PREDICTED: transcription initiation factor I...    145   4e-41   
ref|XP_007216364.1|  hypothetical protein PRUPE_ppa020830mg             147   1e-39   Prunus persica
ref|XP_007216374.1|  hypothetical protein PRUPE_ppa021805mg             146   1e-39   Prunus persica
ref|XP_008231005.1|  PREDICTED: transcription initiation factor I...    147   2e-39   Prunus mume [ume]
ref|NP_001056225.1|  Os05g0548200                                       144   3e-38   
ref|XP_008649960.1|  PREDICTED: transcription initiation factor I...    142   6e-38   Zea mays [maize]
gb|EAY98907.1|  hypothetical protein OsI_20862                          142   1e-37   Oryza sativa Indica Group [Indian rice]
gb|EMT16337.1|  Transcription initiation factor IIB                     141   2e-37   
ref|XP_003565964.1|  PREDICTED: transcription initiation factor I...    140   7e-37   Brachypodium distachyon [annual false brome]
dbj|BAK06351.1|  predicted protein                                      139   1e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAN59779.1|  Putative transcription initiation factor IIB            138   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002511493.1|  transcription initiation factor iib, putative      131   5e-36   
gb|KDP27236.1|  hypothetical protein JCGZ_19935                         135   7e-35   Jatropha curcas
ref|XP_006421302.1|  hypothetical protein CICLE_v10005479mg             129   5e-34   
gb|KFM69995.1|  Transcription initiation factor IIB                     129   9e-34   Stegodyphus mimosarum
gb|EEE64578.1|  hypothetical protein OsJ_19430                          131   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006407583.1|  hypothetical protein EUTSA_v100213350mg            127   2e-33   
ref|XP_006649548.1|  PREDICTED: transcription initiation factor I...    129   9e-33   Oryza brachyantha
gb|EFX72645.1|  hypothetical protein DAPPUDRAFT_325996                  128   2e-32   Daphnia pulex
gb|AEE63627.1|  unknown                                                 128   2e-32   Dendroctonus ponderosae
ref|XP_008199323.1|  PREDICTED: transcription initiation factor IIB     128   2e-32   Tribolium castaneum [rust-red flour beetle]
ref|XP_011148503.1|  PREDICTED: transcription initiation factor IIB     128   3e-32   Harpegnathos saltator
ref|XP_011161274.1|  PREDICTED: transcription initiation factor IIB     127   3e-32   Solenopsis invicta [imported red fire ant]
ref|XP_002736287.1|  PREDICTED: transcription initiation factor I...    127   3e-32   Saccoglossus kowalevskii
gb|KDR15192.1|  Transcription initiation factor IIB                     128   4e-32   Zootermopsis nevadensis
ref|XP_005092831.1|  PREDICTED: transcription initiation factor I...    127   4e-32   Aplysia californica
ref|XP_002324107.2|  hypothetical protein POPTR_0017s12860g             127   4e-32   Populus trichocarpa [western balsam poplar]
gb|EFZ17278.1|  hypothetical protein SINV_13223                         127   4e-32   
ref|XP_005092830.1|  PREDICTED: transcription initiation factor I...    127   4e-32   Aplysia californica
ref|XP_009811555.1|  PREDICTED: transcription initiation factor IIB     126   4e-32   Gavia stellata
gb|KFV54425.1|  Transcription initiation factor IIB                     126   4e-32   Gavia stellata
gb|EFN78510.1|  Transcription initiation factor IIB                     128   5e-32   Harpegnathos saltator
gb|KFQ84502.1|  Transcription initiation factor IIB                     125   5e-32   Phoenicopterus ruber ruber
gb|KFP59335.1|  Transcription initiation factor IIB                     125   5e-32   Cathartes aura
ref|XP_002593734.1|  hypothetical protein BRAFLDRAFT_117242             127   6e-32   Branchiostoma floridae
ref|XP_006398877.1|  hypothetical protein EUTSA_v10015304mg             124   7e-32   
gb|EMT14827.1|  Transcription initiation factor IIB                     128   7e-32   
ref|XP_011257314.1|  PREDICTED: transcription initiation factor IIB     126   8e-32   
ref|XP_003693523.1|  PREDICTED: transcription initiation factor I...    126   8e-32   Apis florea [dwarf honeybee]
ref|XP_003491660.1|  PREDICTED: transcription initiation factor I...    126   8e-32   
ref|XP_003706629.1|  PREDICTED: transcription initiation factor I...    126   9e-32   Megachile rotundata
ref|XP_009920151.1|  PREDICTED: transcription initiation factor IIB     125   1e-31   Haliaeetus albicilla
ref|XP_011335845.1|  PREDICTED: transcription initiation factor I...    126   1e-31   Ooceraea biroi
ref|XP_011335846.1|  PREDICTED: transcription initiation factor I...    126   1e-31   Ooceraea biroi
ref|XP_010158695.1|  PREDICTED: transcription initiation factor IIB     125   1e-31   Eurypyga helias
ref|XP_010580894.1|  PREDICTED: transcription initiation factor I...    125   1e-31   Haliaeetus leucocephalus
gb|KFV98743.1|  Transcription initiation factor IIB                     125   1e-31   Eurypyga helias
ref|XP_006569641.1|  PREDICTED: transcription initiation factor I...    126   1e-31   Apis mellifera [bee]
ref|XP_006624602.1|  PREDICTED: transcription initiation factor I...    126   1e-31   Apis dorsata [rock honeybee]
ref|XP_008937318.1|  PREDICTED: transcription initiation factor IIB     125   1e-31   Merops nubicus
gb|KFQ06428.1|  Transcription initiation factor IIB                     125   2e-31   Haliaeetus albicilla
ref|XP_007509965.1|  predicted protein                                  127   2e-31   Bathycoccus prasinos
ref|XP_004176261.1|  PREDICTED: transcription initiation factor I...    125   2e-31   Taeniopygia guttata
ref|XP_004929188.1|  PREDICTED: transcription initiation factor I...    125   2e-31   
ref|XP_010222676.1|  PREDICTED: transcription initiation factor IIB     125   2e-31   Tinamus guttatus
ref|XP_011053895.1|  PREDICTED: transcription initiation factor IIB     125   2e-31   Acromyrmex echinatior
ref|XP_011498835.1|  PREDICTED: transcription initiation factor I...    125   2e-31   Ceratosolen solmsi marchali
ref|XP_011498836.1|  PREDICTED: transcription initiation factor I...    125   3e-31   Ceratosolen solmsi marchali
ref|NP_001016277.1|  general transcription factor 2B                    125   3e-31   Xenopus tropicalis [western clawed frog]
ref|XP_008489064.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   Calypte anna
ref|XP_008628722.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   
ref|XP_010407372.1|  PREDICTED: transcription initiation factor I...    125   3e-31   Corvus cornix cornix
ref|XP_422356.3|  PREDICTED: transcription initiation factor IIB ...    125   3e-31   Gallus gallus [bantam]
ref|XP_010714257.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   Meleagris gallopavo [common turkey]
gb|KFO56585.1|  Transcription initiation factor IIB                     125   3e-31   Corvus brachyrhynchos
ref|XP_005146585.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   Melopsittacus undulatus
ref|XP_002195495.1|  PREDICTED: transcription initiation factor I...    125   3e-31   Taeniopygia guttata
ref|XP_006032379.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   Alligator sinensis
gb|KFM00694.1|  Transcription initiation factor IIB                     125   3e-31   Aptenodytes forsteri
ref|XP_009510300.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   Phalacrocorax carbo [common cormorant]
gb|EMC78935.1|  Transcription initiation factor IIB                     125   3e-31   
ref|XP_006651126.1|  PREDICTED: transcription initiation factor I...    124   3e-31   Oryza brachyantha
ref|XP_004936696.1|  PREDICTED: transcription initiation factor I...    125   3e-31   
ref|XP_005029322.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   Anas platyrhynchos [duck]
gb|KFO69604.1|  Transcription initiation factor IIB                     125   3e-31   Cuculus canorus
ref|XP_005422178.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   
gb|KFO89034.1|  Transcription initiation factor IIB                     125   3e-31   Buceros rhinoceros silvestris
ref|XP_009986098.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   Tauraco erythrolophus
ref|XP_004306077.1|  PREDICTED: transcription initiation factor I...    125   3e-31   Fragaria vesca subsp. vesca
ref|XP_009633395.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   Egretta garzetta
gb|KFO98637.1|  Transcription initiation factor IIB                     125   3e-31   Calypte anna
ref|XP_010133310.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   Buceros rhinoceros silvestris
ref|XP_009554842.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   Cuculus canorus
ref|XP_009332156.1|  PREDICTED: transcription initiation factor IIB     125   3e-31   Pygoscelis adeliae
ref|XP_005482168.1|  PREDICTED: transcription initiation factor I...    125   4e-31   
ref|XP_005050374.1|  PREDICTED: transcription initiation factor I...    125   4e-31   Ficedula albicollis
ref|XP_005499022.1|  PREDICTED: transcription initiation factor IIB     125   4e-31   
gb|EHJ75466.1|  hypothetical protein KGM_17256                          124   4e-31   
ref|XP_009883190.1|  PREDICTED: transcription initiation factor IIB     125   4e-31   Charadrius vociferus
ref|XP_005238585.1|  PREDICTED: transcription initiation factor IIB     125   4e-31   
ref|XP_009943273.1|  PREDICTED: transcription initiation factor IIB     125   5e-31   Opisthocomus hoazin [hoatzin]
ref|XP_009680860.1|  PREDICTED: transcription initiation factor I...    125   5e-31   Struthio camelus australis
ref|XP_003220155.1|  PREDICTED: transcription initiation factor IIB     124   5e-31   Anolis carolinensis [Carolina anole]
gb|EGI65813.1|  Transcription initiation factor IIB                     124   6e-31   Acromyrmex echinatior
ref|NP_001081115.1|  transcription initiation factor IIB                124   6e-31   Xenopus laevis [clawed frog]
ref|XP_009680861.1|  PREDICTED: transcription initiation factor I...    125   7e-31   Struthio camelus australis
ref|XP_008481393.1|  PREDICTED: transcription initiation factor IIB     124   7e-31   Diaphorina citri
ref|XP_007423700.1|  PREDICTED: transcription initiation factor IIB     124   7e-31   Python bivittatus
ref|XP_009874640.1|  PREDICTED: transcription initiation factor IIB     125   7e-31   Apaloderma vittatum
ref|XP_005298167.1|  PREDICTED: transcription initiation factor IIB     124   7e-31   Chrysemys picta bellii
ref|XP_001607291.1|  PREDICTED: transcription initiation factor IIB     124   8e-31   Nasonia vitripennis
ref|XP_002129417.1|  PREDICTED: transcription initiation factor I...    124   8e-31   
ref|XP_008920209.1|  PREDICTED: transcription initiation factor IIB     125   8e-31   
ref|XP_007068811.1|  PREDICTED: transcription initiation factor IIB     124   8e-31   Chelonia mydas [green seaturtle]
ref|XP_796335.2|  PREDICTED: transcription initiation factor IIB-...    124   8e-31   Strongylocentrotus purpuratus [purple urchin]
ref|XP_010005048.1|  PREDICTED: transcription initiation factor IIB     125   8e-31   Chaetura pelagica
gb|EMP27386.1|  Transcription initiation factor IIB                     124   8e-31   Chelonia mydas [green seaturtle]
ref|XP_005997750.1|  PREDICTED: transcription initiation factor IIB     124   1e-30   Latimeria chalumnae
ref|XP_007885368.1|  PREDICTED: transcription initiation factor IIB     124   1e-30   Callorhinchus milii [Australian ghost shark]
ref|XP_009026544.1|  hypothetical protein HELRODRAFT_185984             124   1e-30   Helobdella robusta
ref|XP_006634774.1|  PREDICTED: transcription initiation factor I...    124   1e-30   Lepisosteus oculatus
ref|XP_009272498.1|  PREDICTED: transcription initiation factor IIB     125   1e-30   
ref|XP_011422418.1|  PREDICTED: transcription initiation factor I...    123   1e-30   Crassostrea gigas
ref|NP_001088125.1|  general transcription factor 2B                    123   1e-30   Xenopus laevis [clawed frog]
ref|XP_009466630.1|  PREDICTED: transcription initiation factor IIB     125   1e-30   Nipponia nippon
ref|XP_006137399.1|  PREDICTED: transcription initiation factor IIB     124   1e-30   
ref|XP_011422417.1|  PREDICTED: transcription initiation factor I...    123   2e-30   Crassostrea gigas
ref|XP_007245148.1|  PREDICTED: transcription initiation factor IIB     122   3e-30   
ref|XP_002427639.1|  transcription initiation factor iib, putative      122   3e-30   Pediculus humanus corporis [human body lice]
ref|XP_007480430.1|  PREDICTED: transcription initiation factor I...    121   4e-30   
ref|XP_310128.4|  AGAP009558-PA                                         122   5e-30   Anopheles gambiae str. PEST
ref|NP_955991.1|  transcription initiation factor IIB                   122   5e-30   Danio rerio [leopard danio]
ref|XP_001848391.1|  transcription initiation factor TFIIB              122   5e-30   Culex quinquefasciatus
ref|XP_001650764.1|  AAEL005368-PA                                      122   5e-30   Aedes aegypti
ref|XP_001650763.1|  AAEL005368-PB                                      121   6e-30   Aedes aegypti
ref|XP_004679246.1|  PREDICTED: transcription initiation factor IIB     121   6e-30   Condylura cristata
ref|XP_001364333.1|  PREDICTED: transcription initiation factor I...    121   6e-30   Monodelphis domestica
gb|ETN58170.1|  transcription initiation factor TFIIB                   121   6e-30   Anopheles darlingi [American malaria mosquito]
gb|KFP83894.1|  Transcription initiation factor IIB                     121   6e-30   Acanthisitta chloris
ref|XP_004078691.1|  PREDICTED: transcription initiation factor IIB     121   8e-30   Oryzias latipes [Japanese rice fish]
ref|XP_004299623.1|  PREDICTED: transcription initiation factor I...    120   8e-30   Fragaria vesca subsp. vesca
gb|ELU17299.1|  hypothetical protein CAPTEDRAFT_167658                  120   9e-30   Capitella teleta
ref|XP_009076566.1|  PREDICTED: transcription initiation factor IIB     121   9e-30   
ref|XP_007568790.1|  PREDICTED: transcription initiation factor IIB     121   9e-30   
ref|XP_007670377.1|  PREDICTED: transcription initiation factor IIB     122   1e-29   
ref|XP_003767291.1|  PREDICTED: transcription initiation factor IIB     121   1e-29   
ref|XP_005802414.1|  PREDICTED: transcription initiation factor I...    121   1e-29   
ref|XP_008553152.1|  PREDICTED: transcription initiation factor IIB     120   1e-29   
ref|XP_008431575.1|  PREDICTED: transcription initiation factor IIB     121   1e-29   
ref|NP_001134769.1|  Transcription initiation factor IIB                120   1e-29   
ref|XP_003437835.1|  PREDICTED: transcription initiation factor I...    120   1e-29   
ref|XP_008332285.1|  PREDICTED: transcription initiation factor IIB     120   1e-29   
ref|XP_004570594.1|  PREDICTED: transcription initiation factor I...    120   1e-29   
ref|XP_010891764.1|  PREDICTED: transcription initiation factor IIB     120   1e-29   
ref|XP_003975769.1|  PREDICTED: transcription initiation factor I...    120   1e-29   
ref|XP_008278092.1|  PREDICTED: transcription initiation factor IIB     120   1e-29   
ref|XP_010731634.1|  PREDICTED: transcription initiation factor IIB     120   1e-29   
ref|XP_006786868.1|  PREDICTED: transcription initiation factor I...    120   1e-29   
gb|ETE74041.1|  Transcription initiation factor IIB                     124   2e-29   
emb|CAF96369.1|  unnamed protein product                                120   2e-29   
ref|XP_003743470.1|  PREDICTED: transcription initiation factor I...    120   2e-29   
ref|XP_011303306.1|  PREDICTED: transcription initiation factor IIB     120   2e-29   
gb|AER39748.1|  transcription initiation factor IIB                     120   2e-29   
pdb|1C9B|A  Chain A, Crystal Structure Of A Human Tbp Core Domain...    117   2e-29   
ref|XP_001628995.1|  predicted protein                                  119   4e-29   
ref|XP_011294670.1|  PREDICTED: transcription initiation factor IIB     119   4e-29   
gb|KJB75630.1|  hypothetical protein B456_012G049100                    118   6e-29   
gb|EGW05303.1|  Transcription initiation factor IIB                     118   7e-29   
ref|XP_010961602.1|  PREDICTED: transcription initiation factor IIB     118   8e-29   
gb|KFO28021.1|  Transcription initiation factor IIB                     118   8e-29   
ref|XP_004699332.1|  PREDICTED: transcription initiation factor IIB     118   8e-29   
gb|EHH50060.1|  hypothetical protein EGM_00825                          118   8e-29   
emb|CDQ69906.1|  unnamed protein product                                119   9e-29   
ref|XP_011195045.1|  PREDICTED: transcription initiation factor I...    118   9e-29   
ref|XP_006169750.1|  PREDICTED: transcription initiation factor I...    118   9e-29   
gb|EFX89549.1|  hypothetical protein DAPPUDRAFT_303055                  118   9e-29   
ref|XP_009049030.1|  hypothetical protein LOTGIDRAFT_238621             118   9e-29   
gb|ELV10226.1|  Transcription initiation factor IIB                     118   1e-28   
ref|XP_005885375.1|  PREDICTED: transcription initiation factor IIB     118   1e-28   
ref|XP_008156013.1|  PREDICTED: transcription initiation factor IIB     118   1e-28   
ref|NP_112303.1|  transcription initiation factor IIB                   118   1e-28   
ref|XP_005888480.1|  PREDICTED: transcription initiation factor IIB     118   1e-28   
ref|XP_004639334.1|  PREDICTED: transcription initiation factor IIB     118   1e-28   
ref|XP_005339174.1|  PREDICTED: transcription initiation factor IIB     118   1e-28   
dbj|BAE21864.1|  unnamed protein product                                118   1e-28   
ref|NP_001505.1|  transcription initiation factor IIB                   118   1e-28   
ref|XP_003478838.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    118   1e-28   
ref|XP_003260070.1|  PREDICTED: transcription initiation factor IIB     118   1e-28   
ref|XP_002715922.1|  PREDICTED: transcription initiation factor IIB     118   1e-28   
ref|XP_006831043.1|  PREDICTED: transcription initiation factor IIB     118   1e-28   
ref|XP_004469753.1|  PREDICTED: transcription initiation factor I...    118   1e-28   
ref|XP_008583219.1|  PREDICTED: transcription initiation factor IIB     118   1e-28   
ref|XP_004519404.1|  PREDICTED: transcription initiation factor I...    118   1e-28   
gb|EFB14094.1|  hypothetical protein PANDA_006057                       118   1e-28   
ref|XP_006187749.1|  PREDICTED: transcription initiation factor IIB     118   1e-28   
ref|XP_006919448.1|  PREDICTED: transcription initiation factor IIB     118   1e-28   
ref|XP_006169749.1|  PREDICTED: transcription initiation factor I...    118   1e-28   
gb|EHB08370.1|  Transcription initiation factor IIB                     117   1e-28   
gb|ELK32500.1|  Transcription initiation factor IIB                     117   1e-28   
gb|ELR61695.1|  Transcription initiation factor IIB                     117   1e-28   
ref|XP_008999883.1|  PREDICTED: transcription initiation factor I...    118   1e-28   
gb|AAB23144.1|  S300-II                                                 117   1e-28   
sp|Q9NHP7.1|TF2B_DROVI  RecName: Full=Transcription initiation fa...    117   1e-28   
ref|NP_001039607.1|  transcription initiation factor IIB                117   1e-28   
ref|XP_004519403.1|  PREDICTED: transcription initiation factor I...    117   2e-28   
ref|XP_011200566.1|  PREDICTED: transcription initiation factor IIB     117   2e-28   
ref|XP_002036519.1|  GM18405                                            117   2e-28   
ref|XP_002003919.1|  GI20422                                            117   2e-28   
ref|XP_011353898.1|  PREDICTED: transcription initiation factor I...    117   2e-28   
ref|NP_476888.1|  transcription factor IIB, isoform A                   117   2e-28   
ref|XP_011195043.1|  PREDICTED: transcription initiation factor I...    117   2e-28   
ref|XP_002089120.1|  GE18945                                            117   2e-28   
gb|ERE88177.1|  transcription initiation factor IIB-like protein        118   2e-28   
pdb|2PHG|A  Chain A, Model For Vp16 Binding To Tfiib                    115   2e-28   
pdb|1TFB|A  Chain A, Nmr Studies Of Human General Transcription F...    115   2e-28   
ref|XP_005542862.1|  PREDICTED: transcription initiation factor IIB     118   2e-28   
gb|EAW73160.1|  general transcription factor IIB, isoform CRA_b         118   2e-28   
ref|XP_007976241.1|  PREDICTED: transcription initiation factor IIB     118   2e-28   
gb|EHB10571.1|  Transcription initiation factor IIB                     115   4e-28   
ref|XP_006805630.1|  PREDICTED: transcription initiation factor I...    115   4e-28   
gb|EPQ19652.1|  Transcription initiation factor IIB                     117   4e-28   
ref|XP_003386928.1|  PREDICTED: transcription initiation factor I...    116   5e-28   
ref|XP_004350491.1|  transcription initiation factor IIB                116   5e-28   
ref|XP_002109441.1|  hypothetical protein TRIADDRAFT_53474              116   7e-28   
ref|XP_001993045.1|  GH13607                                            115   1e-27   
ref|XP_001951275.2|  PREDICTED: transcription initiation factor IIB     115   1e-27   
gb|EFA77303.1|  transcription initiation factor IIB                     115   1e-27   
ref|XP_002441464.1|  hypothetical protein SORBIDRAFT_09g027300          115   1e-27   
ref|XP_004896598.1|  PREDICTED: transcription initiation factor I...    115   1e-27   
dbj|BAE25617.1|  unnamed protein product                                115   1e-27   
ref|XP_002415383.1|  transcription initiation factor iib, putative      110   3e-27   
gb|AEI88079.1|  transcription initiation factor IIB-like protein        112   3e-27   
ref|XP_011464553.1|  PREDICTED: transcription initiation factor I...    113   8e-27   
ref|XP_003284652.1|  hypothetical protein DICPUDRAFT_53091              114   8e-27   
ref|XP_635486.1|  transcription initiation factor IIB                   112   1e-26   
ref|XP_001421184.1|  predicted protein                                  112   2e-26   
ref|XP_002506681.1|  predicted protein                                  112   3e-26   
ref|XP_009018820.1|  hypothetical protein HELRODRAFT_174017             111   3e-26   
ref|XP_003061300.1|  transcription initiation factor                    111   5e-26   
ref|XP_003083158.1|  Transcription initiation factor IIB [Oryza s...    111   7e-26   
pdb|1VOL|A  Chain A, Tfiib (Human Core Domain)TBP (A.THALIANA)TAT...    107   1e-25   
dbj|GAM27124.1|  hypothetical protein SAMD00019534_102990               108   4e-25   
ref|XP_009018819.1|  hypothetical protein HELRODRAFT_80977              108   4e-25   
gb|KHJ78809.1|  transcription factor TFIIB repeat-containing doma...    105   1e-24   
ref|NP_001183266.1|  hypothetical protein                               107   1e-24   
gb|EJW88149.1|  transcription initiation factor IIB                     105   2e-24   
gb|ETN85115.1|  transcription factor TFIIB repeat-containing doma...    105   2e-24   
gb|AFX72995.1|  Transcription factor IIB                                105   3e-24   
ref|XP_003560170.1|  PREDICTED: transcription initiation factor I...    106   4e-24   
gb|ERG79172.1|  transcription initiation factor iib                     105   5e-24   
emb|CDS34147.1|  transcription initiation factor TFIIB                  105   6e-24   
emb|CDP96217.1|  Protein BM-TTB-1, isoform e                            105   6e-24   
ref|XP_001901837.1|  Transcription initiation factor IIB                105   7e-24   
ref|XP_003145382.1|  transcription initiation factor IIB                105   8e-24   
emb|CDW56394.1|  Transcription initiation factor IIB                    104   8e-24   
gb|KFD53277.1|  hypothetical protein M513_05758                         104   9e-24   
emb|CDJ04061.1|  transcription initiation factor TFIIB                  104   1e-23   
gb|EUB64582.1|  Transcription initiation factor IIB                     104   1e-23   
gb|KHN82738.1|  Transcription initiation factor IIB                     105   1e-23   
emb|CDJ80592.1|  Glycosyl transferase and Zinc finger and Transcr...    105   2e-23   
gb|EJD76760.1|  hypothetical protein LOAG_16340                         105   2e-23   
emb|CBY32147.1|  unnamed protein product                                103   4e-23   
emb|CAX73903.1|  Transcription factor IIB                               102   4e-23   
ref|XP_004963622.1|  PREDICTED: transcription initiation factor I...    102   5e-23   
emb|CCD76391.1|  putative transcription initiation factor IIB (TF...    102   6e-23   
gb|ESA03649.1|  hypothetical protein GLOINDRAFT_67132                   102   6e-23   
emb|CCD76390.1|  putative transcription initiation factor iib           102   6e-23   
gb|EFX81075.1|  hypothetical protein DAPPUDRAFT_50412                   102   1e-22   
emb|CCG82300.1|  Transcription initiation factor IIB                    102   1e-22   
emb|CEF61218.1|  Transcription initiation factor IIB                    101   1e-22   
ref|NP_503146.1|  Protein TTB-1                                         101   2e-22   
ref|XP_002647378.1|  C. briggsae CBR-TTB-1 protein                      101   2e-22   
ref|XP_310127.3|  AGAP009559-PA                                         101   2e-22   
ref|XP_008075109.1|  hypothetical protein VCUG_02096                    100   2e-22   
gb|ELQ74241.1|  Transcription initiation factor TFIIB                   100   2e-22   
gb|EAZ03987.1|  hypothetical protein OsI_26125                          100   3e-22   
gb|KHJ95746.1|  transcription factor TFIIB repeat-containing doma...    100   4e-22   
gb|EGT41143.1|  hypothetical protein CAEBREN_12544                    99.4    5e-22   
dbj|BAC83997.1|  putative Transcription initiation factor IIB           100   5e-22   
ref|XP_002156994.2|  PREDICTED: transcription initiation factor I...  98.2    7e-22   
gb|EGT57002.1|  hypothetical protein CAEBREN_14440                    99.4    8e-22   
ref|XP_003115733.1|  CRE-TTB-1 protein                                99.4    9e-22   
gb|EAZ25910.1|  hypothetical protein OsJ_09753                        99.0    1e-21   
gb|EPR79275.1|  Transcription initiation factor TFIIB                 99.0    1e-21   
ref|XP_008348242.1|  PREDICTED: transcription initiation factor I...  99.0    1e-21   
dbj|GAA33522.2|  transcription initiation factor TFIIB                98.2    2e-21   
ref|XP_009164831.1|  hypothetical protein T265_02353                  98.6    2e-21   
gb|KFK34972.1|  hypothetical protein AALP_AA5G217600                  97.4    4e-21   
gb|KFB44849.1|  AGAP009558-PA-like protein                            97.1    4e-21   
gb|EMD40435.1|  hypothetical protein CERSUDRAFT_111033                97.8    4e-21   
ref|XP_005846958.1|  hypothetical protein CHLNCDRAFT_24273            97.4    5e-21   
gb|KFH72448.1|  transcription initiation factor TFIIB                 97.1    5e-21   
ref|XP_003115540.1|  hypothetical protein CRE_18811                   96.7    6e-21   
ref|XP_007365064.1|  cyclin-like protein                              97.1    7e-21   
gb|ERG79452.1|  transcription initiation factor iib                   96.3    9e-21   
gb|EEC82109.1|  hypothetical protein OsI_26126                        96.7    9e-21   
gb|KDQ08841.1|  hypothetical protein BOTBODRAFT_555788                95.9    2e-20   
ref|XP_005642842.1|  cyclin-like protein                              95.1    3e-20   
ref|XP_009365868.1|  PREDICTED: transcription initiation factor I...  95.1    3e-20   
ref|XP_003887456.1|  transcription initiation factor TFIIIB subun...  94.7    3e-20   
ref|NP_585866.1|  TRANSCRIPTION INITIATION FACTOR TFIIB               94.7    3e-20   
ref|XP_009264694.1|  transcription initiation factor TFIIB subuni...  94.7    3e-20   
ref|XP_003073070.1|  transcription initiation factor TFIIB subuni...  94.7    3e-20   
gb|KHN69445.1|  subunit of transcription initiation factor TFIIIB     94.7    4e-20   
gb|AIG98180.1|  Transcription initiation factor TFIIIB, Brf1 subu...  94.7    4e-20   
emb|CDO73794.1|  hypothetical protein BN946_scf185015.g123            94.7    4e-20   
ref|XP_001691339.1|  hypothetical protein CHLREDRAFT_115221           94.7    4e-20   
dbj|GAN05796.1|  cyclin-like protein                                  94.4    5e-20   
ref|XP_002652480.1|  transcription initiation factor IIB              92.0    5e-20   
dbj|BAC84000.1|  putative Transcription initiation factor IIB         94.4    6e-20   
ref|XP_003560173.1|  PREDICTED: transcription initiation factor I...  93.2    2e-19   
ref|XP_008035530.1|  transcription initiation factor IIB              93.2    2e-19   
ref|XP_002650895.1|  transcription initiation factor IIB              92.4    2e-19   
ref|XP_002651040.1|  transcription initiation factor IIB              92.4    2e-19   
ref|XP_002650868.1|  transcription initiation factor IIB              92.8    2e-19   
gb|AAT12348.1|  transcription initiation factor TFIIB                 92.8    2e-19   
ref|XP_002946810.1|  hypothetical protein VOLCADRAFT_79408            92.4    2e-19   
ref|WP_013684523.1|  transcription initiation factor IIB              92.4    3e-19   
ref|WP_010878796.1|  transcription initiation factor IIB              92.4    3e-19   
gb|EPB86427.1|  transcription initiation factor TFIIB                 92.4    3e-19   
gb|KII95274.1|  hypothetical protein PLICRDRAFT_34116                 91.7    5e-19   
ref|XP_007268820.1|  cyclin-like protein                              91.7    5e-19   
ref|XP_002650958.1|  transcription initiation factor IIB              90.1    6e-19   
ref|XP_007773582.1|  transcription initiation factor IIB              91.7    6e-19   
ref|WP_012965883.1|  transcription factor TFIIB cyclin-related pr...  91.3    6e-19   
gb|KIM91237.1|  hypothetical protein PILCRDRAFT_94746                 91.3    6e-19   
ref|XP_009543435.1|  hypothetical protein HETIRDRAFT_471921           91.3    7e-19   
gb|KIY52326.1|  cyclin-like protein                                   91.3    7e-19   
gb|AIY90564.1|  Transcription initiation factor B                     90.9    1e-18   
gb|KDD74092.1|  hypothetical protein H632_c1578p0                     90.9    1e-18   
ref|XP_006658593.1|  PREDICTED: transcription initiation factor I...  90.5    1e-18   
gb|KIL70304.1|  hypothetical protein M378DRAFT_67330                  90.5    1e-18   
ref|XP_008178253.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  90.5    1e-18   
gb|AAR28031.1|  mutant TFIIB3                                         90.5    1e-18   
ref|XP_002911260.1|  transcription initiation factor IIB              90.5    1e-18   
emb|CCM00438.1|  predicted protein                                    90.5    2e-18   
gb|EPX72664.1|  transcription factor TFIIB                            90.1    2e-18   
ref|XP_007604919.1|  hypothetical protein VICG_01473                  90.1    2e-18   
ref|NP_594229.1|  transcription factor TFIIB                          90.1    2e-18   
gb|EPY52757.1|  transcription factor TFIIB                            90.1    2e-18   
gb|EOB13568.1|  Transcription initiation factor IIB                   89.7    2e-18   
gb|EIJ89645.1|  transcription initiation factor TFIIB                 89.4    2e-18   
gb|EIJ94152.1|  transcription initiation factor TFIIB                 89.4    2e-18   
gb|ADD93256.1|  transcription initiation factor IIB                   88.6    3e-18   
ref|WP_012939458.1|  transcription factor TFIIB cyclin-related pr...  89.4    3e-18   
ref|XP_010516349.1|  PREDICTED: transcription initiation factor I...  88.6    3e-18   
ref|XP_010516348.1|  PREDICTED: transcription initiation factor I...  88.6    3e-18   
ref|XP_007338270.1|  cyclin-like protein                              89.4    3e-18   
ref|XP_002172775.1|  transcription factor TFIIB                       89.0    4e-18   
ref|XP_007862235.1|  alpha/beta-hydrolase                             91.3    4e-18   
gb|KIP08353.1|  hypothetical protein PHLGIDRAFT_69548                 88.6    6e-18   
gb|KIK96066.1|  hypothetical protein PAXRUDRAFT_139312                88.6    6e-18   
ref|NP_189584.1|  TFIIB-related protein 2                             88.6    6e-18   
gb|EHR75671.1|  transcription initiation factor TFIIB                 88.2    6e-18   
gb|EHY66531.1|  transcription initiation factor IIB                   88.2    6e-18   
gb|KDQ29703.1|  hypothetical protein PLEOSDRAFT_1039449               88.6    7e-18   
ref|WP_006433307.1|  transcription initiation factor IIB              87.4    8e-18   
gb|KIO29467.1|  hypothetical protein M407DRAFT_242576                 88.2    9e-18   
ref|XP_001838296.1|  transcription initiation factor IIB              87.8    1e-17   
ref|XP_007391685.1|  hypothetical protein PHACADRAFT_249341           87.8    1e-17   
emb|CCJ30774.1|  unnamed protein product                              87.8    1e-17   
gb|KJA29724.1|  hypothetical protein HYPSUDRAFT_126710                87.8    1e-17   
gb|KIK63853.1|  hypothetical protein GYMLUDRAFT_162217                87.8    1e-17   



>emb|CDP14130.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/150 (96%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDPDRA+V+AFKAI NMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV
Sbjct  90   ARLQNRGGDPDRAIVLAFKAITNMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  149

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGK RTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  150  AACIYIACRQEGKARTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  209

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGMSNEE+KAVQETV KSEEFD
Sbjct  210  YLRRFCSNLGMSNEEIKAVQETVQKSEEFD  239



>ref|XP_009782888.1| PREDICTED: transcription initiation factor IIB-2-like [Nicotiana 
sylvestris]
Length=312

 Score =   296 bits (759),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDPDRALV+AFKAIANMADRLSLV+TIKDRASEIYKRLEDQKCTRGRNLDALV
Sbjct  90   ARLQNRGGDPDRALVIAFKAIANMADRLSLVSTIKDRASEIYKRLEDQKCTRGRNLDALV  149

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGKPRTVKEICS+ANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  150  AACIYIACRQEGKPRTVKEICSMANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  209

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSN+GM++EE+KAVQETV KSEEFD
Sbjct  210  YLRRFCSNIGMNHEEIKAVQETVKKSEEFD  239



>ref|XP_009595638.1| PREDICTED: transcription initiation factor IIB-2-like [Nicotiana 
tomentosiformis]
Length=312

 Score =   295 bits (755),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDPDRALV+AFKAIANMADRLSLV+TIKDRASEIYKRLEDQKCTRGRNLD LV
Sbjct  90   ARLQNRGGDPDRALVIAFKAIANMADRLSLVSTIKDRASEIYKRLEDQKCTRGRNLDPLV  149

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGKPRTVKEICS+ANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  150  AACIYIACRQEGKPRTVKEICSMANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  209

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSN+GM++EE+KAVQETV KSEEFD
Sbjct  210  YLRRFCSNIGMNHEEIKAVQETVKKSEEFD  239



>ref|XP_009597032.1| PREDICTED: transcription initiation factor IIB-2-like [Nicotiana 
tomentosiformis]
Length=311

 Score =   294 bits (752),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDPDRA+V+AFK IANMADRLSLV+TI+DRASEIYKRLEDQKCTRGRNLDALV
Sbjct  89   ARLQNRGGDPDRAIVIAFKTIANMADRLSLVSTIRDRASEIYKRLEDQKCTRGRNLDALV  148

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGKPRTVKEICSIANGA+KKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  149  AACIYIACRQEGKPRTVKEICSIANGASKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  208

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGM++EE+KAVQETV KSEEFD
Sbjct  209  YLRRFCSNLGMNHEEIKAVQETVQKSEEFD  238



>ref|XP_006351306.1| PREDICTED: transcription initiation factor IIB-2-like [Solanum 
tuberosum]
Length=312

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDP+RALVMAFKAIANMADRLSLV+TIKDRASEIYKRLEDQKCTRGRNLDALV
Sbjct  90   ARLQNRGGDPERALVMAFKAIANMADRLSLVSTIKDRASEIYKRLEDQKCTRGRNLDALV  149

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGK RTVKEICSIANGATKKEIGRAKEFIVKQLKVEMG+SMEMGTIHAGD
Sbjct  150  AACIYIACRQEGKARTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGDSMEMGTIHAGD  209

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSN+GM++EE+KAVQETV KSEEFD
Sbjct  210  YLRRFCSNIGMNHEEIKAVQETVKKSEEFD  239



>ref|XP_004249253.1| PREDICTED: transcription initiation factor IIB-2-like [Solanum 
lycopersicum]
Length=312

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDP+RALVMAFKAIANMADRLSLV+TIKDRASEIYKRLEDQKCTRGRNLDALV
Sbjct  90   ARLQNRGGDPERALVMAFKAIANMADRLSLVSTIKDRASEIYKRLEDQKCTRGRNLDALV  149

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGK RTVKEICSIANGATKKEIGRAKEFIVKQLKVEMG+SMEMGTIHAGD
Sbjct  150  AACIYIACRQEGKARTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGDSMEMGTIHAGD  209

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSN+GM++EE+KAVQETV KSEEFD
Sbjct  210  YLRRFCSNIGMNHEEIKAVQETVKKSEEFD  239



>ref|XP_004249217.1| PREDICTED: transcription initiation factor IIB-2 isoform X1 [Solanum 
lycopersicum]
Length=313

 Score =   291 bits (744),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDPDRA+V+AFKAIA MADRLSLV+TI+DRASEIYKRLEDQKCTRGRNLDALV
Sbjct  89   ARLQNRGGDPDRAIVLAFKAIATMADRLSLVSTIRDRASEIYKRLEDQKCTRGRNLDALV  148

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGKPRTVKEICSIANGA+KKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  149  AACIYIACRQEGKPRTVKEICSIANGASKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  208

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGM++EE+K VQETV K+EEFD
Sbjct  209  YLRRFCSNLGMNHEEIKVVQETVQKAEEFD  238



>ref|XP_006351253.1| PREDICTED: transcription initiation factor IIB-2-like isoform 
X1 [Solanum tuberosum]
Length=313

 Score =   291 bits (744),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDPDRA+V+AFKAIA MADRLSLV+TI+DRASEIYKRLEDQKCTRGRNLDALV
Sbjct  89   ARLQNRGGDPDRAIVLAFKAIATMADRLSLVSTIRDRASEIYKRLEDQKCTRGRNLDALV  148

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGKPRTVKEICSIANGA+KKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  149  AACIYIACRQEGKPRTVKEICSIANGASKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  208

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGM++EE+K VQETV K+EEFD
Sbjct  209  YLRRFCSNLGMNHEEIKVVQETVQKAEEFD  238



>ref|XP_010312094.1| PREDICTED: transcription initiation factor IIB-2 isoform X2 [Solanum 
lycopersicum]
Length=312

 Score =   291 bits (744),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDPDRA+V+AFKAIA MADRLSLV+TI+DRASEIYKRLEDQKCTRGRNLDALV
Sbjct  89   ARLQNRGGDPDRAIVLAFKAIATMADRLSLVSTIRDRASEIYKRLEDQKCTRGRNLDALV  148

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGKPRTVKEICSIANGA+KKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  149  AACIYIACRQEGKPRTVKEICSIANGASKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  208

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGM++EE+K VQETV K+EEFD
Sbjct  209  YLRRFCSNLGMNHEEIKVVQETVQKAEEFD  238



>ref|XP_006351254.1| PREDICTED: transcription initiation factor IIB-2-like isoform 
X2 [Solanum tuberosum]
Length=312

 Score =   291 bits (744),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDPDRA+V+AFKAIA MADRLSLV+TI+DRASEIYKRLEDQKCTRGRNLDALV
Sbjct  89   ARLQNRGGDPDRAIVLAFKAIATMADRLSLVSTIRDRASEIYKRLEDQKCTRGRNLDALV  148

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGKPRTVKEICSIANGA+KKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  149  AACIYIACRQEGKPRTVKEICSIANGASKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  208

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGM++EE+K VQETV K+EEFD
Sbjct  209  YLRRFCSNLGMNHEEIKVVQETVQKAEEFD  238



>ref|XP_009772113.1| PREDICTED: transcription initiation factor IIB-2-like [Nicotiana 
sylvestris]
Length=311

 Score =   290 bits (741),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDPDRA+V+AFKAIA MADRLSLV+TI+DRASEIYKRLEDQKCTRGRNLD LV
Sbjct  89   ARLQNRGGDPDRAIVIAFKAIATMADRLSLVSTIRDRASEIYKRLEDQKCTRGRNLDPLV  148

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGKPRTVKEICSIANGA+KKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  149  AACIYIACRQEGKPRTVKEICSIANGASKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  208

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGM++EE+K VQETV KSEEFD
Sbjct  209  YLRRFCSNLGMNHEEIKVVQETVQKSEEFD  238



>ref|XP_011078912.1| PREDICTED: transcription initiation factor IIB-2-like [Sesamum 
indicum]
Length=312

 Score =   289 bits (740),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDPDRA+V+AFK I+NMADRLSLV TIKDRASEIYKRLEDQKCTRGRNL+ALV
Sbjct  90   ARLQNRGGDPDRAIVLAFKTISNMADRLSLVTTIKDRASEIYKRLEDQKCTRGRNLEALV  149

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGKPRTVKEICSI  GATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  150  AACIYIACRQEGKPRTVKEICSIVAGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  209

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGMSNEEVKAVQETV KS +FD
Sbjct  210  YLRRFCSNLGMSNEEVKAVQETVQKSGDFD  239



>ref|XP_011075341.1| PREDICTED: transcription initiation factor IIB-2-like [Sesamum 
indicum]
Length=311

 Score =   286 bits (733),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            +RLQNRGGDPDRA+V+AFK I+NMADRLSLV TIKDRASEIYKRLEDQKCTRGRNL+ALV
Sbjct  89   SRLQNRGGDPDRAIVLAFKTISNMADRLSLVTTIKDRASEIYKRLEDQKCTRGRNLEALV  148

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGKPRTVKEICSI  GATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  149  AACIYIACRQEGKPRTVKEICSIVAGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  208

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGMSNEEVKAVQETV K+ +FD
Sbjct  209  YLRRFCSNLGMSNEEVKAVQETVQKAGDFD  238



>gb|EYU18714.1| hypothetical protein MIMGU_mgv1a010444mg [Erythranthe guttata]
 gb|EYU18715.1| hypothetical protein MIMGU_mgv1a010444mg [Erythranthe guttata]
Length=312

 Score =   286 bits (732),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRGGDPDRA+V+AFK IANMADRLSLV TIKDRA+EIYKRLEDQKCTRGRNL+ALV
Sbjct  90   ARLQNRGGDPDRAIVLAFKTIANMADRLSLVTTIKDRANEIYKRLEDQKCTRGRNLEALV  149

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQEGKPRTVKEICSI  GATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  150  AACIYIACRQEGKPRTVKEICSIVAGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  209

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGMS+EEVKAVQETV K+ +FD
Sbjct  210  YLRRFCSNLGMSHEEVKAVQETVQKAGDFD  239



>gb|EYU20758.1| hypothetical protein MIMGU_mgv1a010447mg [Erythranthe guttata]
Length=312

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/149 (91%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            RLQNRGGDPDRA+V+AFK IANMADRLSLV TIKDRA+EIYKRLEDQKCTRGRNL+ALVA
Sbjct  91   RLQNRGGDPDRAIVLAFKTIANMADRLSLVTTIKDRANEIYKRLEDQKCTRGRNLEALVA  150

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            ACIYIACRQEGKPRTVKEICSI  GATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY
Sbjct  151  ACIYIACRQEGKPRTVKEICSIVAGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  210

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCSNLGMS+EEVKAVQETV K+  FD
Sbjct  211  LRRFCSNLGMSHEEVKAVQETVQKAGNFD  239



>ref|XP_006298174.1| hypothetical protein CARUB_v10014225mg [Capsella rubella]
 gb|EOA31072.1| hypothetical protein CARUB_v10014225mg [Capsella rubella]
Length=277

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA MADRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIVAFKTIATMADRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE+V KSEEFD
Sbjct  212  FMRRFCSNLGMTNQTVKAAQESVQKSEEFD  241



>ref|XP_002882661.1| transcription initiation factor IIB-2 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006298175.1| hypothetical protein CARUB_v10014225mg [Capsella rubella]
 ref|XP_010464705.1| PREDICTED: transcription initiation factor IIB-2 [Camelina sativa]
 ref|XP_010486635.1| PREDICTED: transcription initiation factor IIB-2 [Camelina sativa]
 gb|EFH58920.1| transcription initiation factor IIB-2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA31073.1| hypothetical protein CARUB_v10014225mg [Capsella rubella]
Length=312

 Score =   254 bits (648),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA MADRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIVAFKTIATMADRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE+V KSEEFD
Sbjct  212  FMRRFCSNLGMTNQTVKAAQESVQKSEEFD  241



>ref|XP_009135103.1| PREDICTED: transcription initiation factor IIB-2 [Brassica rapa]
 emb|CDY00664.1| BnaC03g36480D [Brassica napus]
 emb|CDX73932.1| BnaA03g31150D [Brassica napus]
Length=312

 Score =   254 bits (648),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA MADRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIVAFKTIATMADRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE+V KSEEFD
Sbjct  212  FMRRFCSNLGMTNQTVKAAQESVKKSEEFD  241



>gb|KFK24868.1| hypothetical protein AALP_AA8G035400 [Arabis alpina]
Length=312

 Score =   253 bits (646),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA MADRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIVAFKTIATMADRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE+V KSEEFD
Sbjct  212  FMRRFCSNLGMTNQTVKAAQESVKKSEEFD  241



>ref|XP_010482840.1| PREDICTED: transcription initiation factor IIB-2-like [Camelina 
sativa]
Length=312

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA MADRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIVAFKTIATMADRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGA+KKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGASKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE+V KSEEFD
Sbjct  212  FMRRFCSNLGMTNQTVKAAQESVQKSEEFD  241



>ref|XP_006289549.1| hypothetical protein CARUB_v10003094mg [Capsella rubella]
 gb|EOA22447.1| hypothetical protein CARUB_v10003094mg [Capsella rubella]
Length=312

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA MADRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIVAFKTIATMADRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+I+KQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIIKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM N+ VKA QE+V KSEEFD
Sbjct  212  FMRRFCSNLGMGNQTVKAAQESVQKSEEFD  241



>gb|KJB36009.1| hypothetical protein B456_006G136100 [Gossypium raimondii]
Length=243

 Score =   249 bits (637),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIVAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE+V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQESVQKSEEFD  241



>emb|CAA84309.1| AtTFIIB2 [Arabidopsis thaliana]
Length=301

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA MADRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  81   GRWQNRGSNPDRGLIVAFKTIATMADRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  140

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+ +EMGTIHAGD
Sbjct  141  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQLVEMGTIHAGD  200

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE+V KSEEFD
Sbjct  201  FMRRFCSNLGMTNQTVKAAQESVQKSEEFD  230



>ref|XP_006421305.1| hypothetical protein CICLE_v10005479mg [Citrus clementina]
 gb|ESR34545.1| hypothetical protein CICLE_v10005479mg [Citrus clementina]
 gb|KDO45910.1| hypothetical protein CISIN_1g025983mg [Citrus sinensis]
Length=245

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQEAVQKSEEFD  241



>ref|XP_008387306.1| PREDICTED: transcription initiation factor IIB-2 [Malus domestica]
Length=312

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLEKGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMTNQAVKAAQEAVTKSEEFD  241



>ref|XP_007145590.1| hypothetical protein PHAVU_007G251400g [Phaseolus vulgaris]
 gb|ESW17584.1| hypothetical protein PHAVU_007G251400g [Phaseolus vulgaris]
Length=312

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDRAL++AFK IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRALILAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKE+GRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEVGRAKEYIVKQLGLENGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQEAVQKSEEFD  241



>ref|XP_010269721.1| PREDICTED: transcription initiation factor IIB [Nelumbo nucifera]
Length=312

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSIRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL+VEMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLEVEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM+N+ VKA QE V KSEE D
Sbjct  212  FLRRFCSHLGMTNQAVKAAQEAVQKSEELD  241



>ref|XP_007015120.1| Cyclin-like family protein [Theobroma cacao]
 gb|EOY32739.1| Cyclin-like family protein [Theobroma cacao]
Length=312

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L+ AFK IA M+DRL LVATIKDRA+EIYK++EDQK  RGRN DA++
Sbjct  92   GRWQNRGANPDRSLIQAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKPLRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL+VEMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLEVEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGMSN+ VKA QE V KSEE D
Sbjct  212  FLRRFCSHLGMSNQTVKAAQEAVQKSEELD  241



>emb|CAN74371.1| hypothetical protein VITISV_004775 [Vitis vinifera]
Length=312

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK TRGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSTRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL+ E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLEAEKGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMTNQVVKAAQEAVQKSEEFD  241



>ref|XP_004150610.1| PREDICTED: transcription initiation factor IIB-2-like [Cucumis 
sativus]
 ref|XP_004171903.1| PREDICTED: transcription initiation factor IIB-2-like [Cucumis 
sativus]
 ref|XP_008455781.1| PREDICTED: transcription initiation factor IIB-2 [Cucumis melo]
 gb|KGN54643.1| hypothetical protein Csa_4G415910 [Cucumis sativus]
Length=312

 Score =   251 bits (641),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQEAVQKSEEFD  241



>ref|NP_187644.1| transcription initiation factor IIB-2 [Arabidopsis thaliana]
 sp|Q9SS44.1|TF2B2_ARATH RecName: Full=Transcription initiation factor IIB-2; AltName: 
Full=General transcription factor TFIIB-2; Short=AtTFIIB2 [Arabidopsis 
thaliana]
 gb|AAF02810.1|AC009400_6 transcription initiation factor IIB (TFIIB) [Arabidopsis thaliana]
 gb|AAK91437.1| AT3g10330/F14P13_7 [Arabidopsis thaliana]
 gb|AAL31139.1| AT3g10330/F14P13_7 [Arabidopsis thaliana]
 gb|AAM65403.1| transcription initiation factor IIB (TFIIB) [Arabidopsis thaliana]
 gb|AAR28003.1| TFIIB2 [Arabidopsis thaliana]
 gb|AEE74892.1| transcription initiation factor IIB-2 [Arabidopsis thaliana]
Length=312

 Score =   251 bits (641),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA MADRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIVAFKTIATMADRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+ +EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQLVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE+V KSEEFD
Sbjct  212  FMRRFCSNLGMTNQTVKAAQESVQKSEEFD  241



>ref|XP_004304334.1| PREDICTED: transcription initiation factor IIB [Fragaria vesca 
subsp. vesca]
Length=312

 Score =   251 bits (640),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLEKGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQEAVQKSEEFD  241



>ref|XP_002269045.1| PREDICTED: transcription initiation factor IIB-2 [Vitis vinifera]
 emb|CBI35314.3| unnamed protein product [Vitis vinifera]
Length=312

 Score =   251 bits (640),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK TRGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSTRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL+ E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLEAEKGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMTNQVVKAAQEAVQKSEEFD  241



>ref|XP_002284342.1| PREDICTED: transcription initiation factor IIB-2 [Vitis vinifera]
 emb|CBI29812.3| unnamed protein product [Vitis vinifera]
Length=312

 Score =   251 bits (640),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK TRGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSTRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL+ E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLEAEKGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMTNQVVKAAQEAVQKSEEFD  241



>ref|XP_009409174.1| PREDICTED: transcription initiation factor IIB-like [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   251 bits (640),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AFK IA MADRL LVATIKDRA+EIYK++ED K  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFKTIATMADRLGLVATIKDRANEIYKKVEDLKSVRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM+N+ VKA QE V KSEE D
Sbjct  212  FLRRFCSHLGMTNQAVKAAQEAVQKSEELD  241



>ref|XP_008788361.1| PREDICTED: transcription initiation factor IIB [Phoenix dactylifera]
Length=312

 Score =   251 bits (640),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNRG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++A
Sbjct  93   RWQNRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAILA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKE+IVKQL+VEMG+SMEMGTIHAGD+
Sbjct  153  ACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEYIVKQLEVEMGQSMEMGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCS+LGMSN+ VKA QE V KSEE D
Sbjct  213  LRRFCSHLGMSNQAVKAAQEAVHKSEELD  241



>ref|XP_010920217.1| PREDICTED: transcription initiation factor IIB [Elaeis guineensis]
Length=312

 Score =   251 bits (640),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNRG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++A
Sbjct  93   RWQNRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAILA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKE+IVKQL+VEMG+SMEMGTIHAGD+
Sbjct  153  ACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEYIVKQLEVEMGQSMEMGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCS+LGMSN+ VKA QE V KSEE D
Sbjct  213  LRRFCSHLGMSNQAVKAAQEAVQKSEELD  241



>ref|XP_006421304.1| hypothetical protein CICLE_v10005479mg [Citrus clementina]
 ref|XP_006492943.1| PREDICTED: transcription initiation factor IIB-2-like [Citrus 
sinensis]
 gb|ESR34544.1| hypothetical protein CICLE_v10005479mg [Citrus clementina]
Length=312

 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQEAVQKSEEFD  241



>ref|XP_009388781.1| PREDICTED: transcription initiation factor IIB-like [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AFK IA MADRL LVATIKDRA+EIYK++ED K  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFKTIATMADRLGLVATIKDRANEIYKKVEDLKSVRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKEFIVKQL++EMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEFIVKQLEIEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM+N+ VKA QE V KSEE D
Sbjct  212  FLRRFCSHLGMTNQAVKAAQEAVQKSEELD  241



>gb|KJB36008.1| hypothetical protein B456_006G136100 [Gossypium raimondii]
Length=312

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIVAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE+V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQESVQKSEEFD  241



>ref|XP_007162169.1| hypothetical protein PHAVU_001G130000g [Phaseolus vulgaris]
 gb|ESW34163.1| hypothetical protein PHAVU_001G130000g [Phaseolus vulgaris]
Length=312

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK+IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIVAFKSIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE++VKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYVVKQLGLEKGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQEAVQKSEEFD  241



>ref|XP_007028688.1| Cyclin-like family protein isoform 1 [Theobroma cacao]
 gb|EOY09190.1| Cyclin-like family protein isoform 1 [Theobroma cacao]
Length=312

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQEAVQKSEEFD  241



>ref|XP_004516731.1| PREDICTED: transcription initiation factor IIB-like [Cicer arietinum]
Length=312

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LV TIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVGTIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLEKGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQEAVKKSEEFD  241



>ref|XP_008785330.1| PREDICTED: transcription initiation factor IIB, partial [Phoenix 
dactylifera]
Length=294

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R Q RG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++A
Sbjct  75   RWQTRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAILA  134

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKE+IVKQL+VEMG+SMEMGTIHAGD+
Sbjct  135  ACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEYIVKQLEVEMGQSMEMGTIHAGDF  194

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCS+LGMSN+ VKA QE V KSEE D
Sbjct  195  LRRFCSHLGMSNQAVKAAQEAVQKSEELD  223



>ref|XP_009355479.1| PREDICTED: transcription initiation factor IIB-2 [Pyrus x bretschneideri]
Length=312

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L+MAFK IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIMAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLENGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM N+ VKA  E V KSEEFD
Sbjct  212  FMRRFCSNLGMINQAVKAAHEAVTKSEEFD  241



>ref|XP_007202277.1| hypothetical protein PRUPE_ppa008972mg [Prunus persica]
 ref|XP_008244256.1| PREDICTED: transcription initiation factor IIB [Prunus mume]
 gb|EMJ03476.1| hypothetical protein PRUPE_ppa008972mg [Prunus persica]
Length=312

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGA+KKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGASKKEIGRAKEYIVKQLGLEKGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQEAVQKSEEFD  241



>gb|KDP22116.1| hypothetical protein JCGZ_25947 [Jatropha curcas]
Length=312

 Score =   249 bits (636),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L+ AFK IA M+DRL LVATIKDRA+EIYK++EDQK  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLIQAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKPLRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL+VE+G+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLEVELGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM+N+ VKA QE+V KSEE D
Sbjct  212  FLRRFCSHLGMNNQAVKAAQESVQKSEELD  241



>ref|NP_001063775.1| Os09g0534800 [Oryza sativa Japonica Group]
 sp|Q8W0W3.1|TF2B_ORYSJ RecName: Full=Transcription initiation factor IIB; AltName: Full=General 
transcription factor TFIIB [Oryza sativa Japonica 
Group]
 gb|AAL73491.1|AF464908_1 general transcription factor TFIIB [Oryza sativa]
 dbj|BAD33339.1| Transcription initiation factor IIB [Oryza sativa Japonica Group]
 dbj|BAD34211.1| Transcription initiation factor IIB [Oryza sativa Japonica Group]
 dbj|BAF25689.1| Os09g0534800 [Oryza sativa Japonica Group]
 gb|EAZ09877.1| hypothetical protein OsI_32170 [Oryza sativa Indica Group]
 gb|EAZ45480.1| hypothetical protein OsJ_30135 [Oryza sativa Japonica Group]
 gb|AEP20532.1| transcription factor [Oryza sativa Japonica Group]
Length=312

 Score =   249 bits (636),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS LGM+N+ VKA QE V +SEE D
Sbjct  212  FLRRFCSTLGMNNQAVKAAQEAVQRSEELD  241



>ref|XP_010312093.1| PREDICTED: transcription initiation factor IIB-2 isoform X2 [Solanum 
lycopersicum]
Length=268

 Score =   248 bits (632),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG + DR+L++AFKAI  M+DRL LVATIKDRA+EIYK++EDQK +RGRN DA++
Sbjct  91   GRWQNRGSNADRSLILAFKAIGVMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDAIL  150

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL++EMG+S+EMGTIHAGD
Sbjct  151  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLELEMGQSVEMGTIHAGD  210

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  211  FMRRFCSNLGMTNQAVKAAQEAVKKSEEFD  240



>ref|XP_002460572.1| hypothetical protein SORBIDRAFT_02g031020 [Sorghum bicolor]
 gb|EER97093.1| hypothetical protein SORBIDRAFT_02g031020 [Sorghum bicolor]
Length=312

 Score =   249 bits (636),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS LGM+N+ VKA QE V +SEE D
Sbjct  212  FLRRFCSTLGMNNQAVKAAQEAVQRSEELD  241



>ref|XP_009772114.1| PREDICTED: transcription initiation factor IIB-2 [Nicotiana sylvestris]
Length=311

 Score =   249 bits (636),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG + DR+L++AFKAI  M+DRL LVATIKDRA+EIYK++EDQK +RGRN DA++
Sbjct  91   GRWQNRGSNSDRSLILAFKAIGVMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDAIL  150

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL++EMG+S+EMGTIHAGD
Sbjct  151  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLELEMGQSVEMGTIHAGD  210

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  211  FMRRFCSNLGMTNQTVKAAQEAVKKSEEFD  240



>ref|XP_004957467.1| PREDICTED: transcription initiation factor IIB-like [Setaria 
italica]
Length=312

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS LGM+N+ VKA QE V +SEE D
Sbjct  212  FLRRFCSTLGMNNQAVKAAQEAVQRSEELD  241



>ref|XP_006660890.1| PREDICTED: transcription initiation factor IIB-like [Oryza brachyantha]
Length=312

 Score =   249 bits (635),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS LGM+N+ VKA QE V +SEE D
Sbjct  212  FLRRFCSTLGMNNQAVKAAQEAVQRSEELD  241



>ref|XP_009597031.1| PREDICTED: transcription initiation factor IIB-2 [Nicotiana tomentosiformis]
Length=311

 Score =   249 bits (635),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG + DR+L++AFKAI  M+DRL LVATIKDRA+EIYK++EDQK +RGRN DA++
Sbjct  91   GRWQNRGSNSDRSLILAFKAIGVMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDAIL  150

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL++EMG+S+EMGTIHAGD
Sbjct  151  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLELEMGQSVEMGTIHAGD  210

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  211  FMRRFCSNLGMTNQTVKAAQEAVKKSEEFD  240



>ref|XP_004249237.1| PREDICTED: transcription initiation factor IIB-2 isoform X1 [Solanum 
lycopersicum]
 ref|XP_006351252.1| PREDICTED: transcription initiation factor IIB-2-like [Solanum 
tuberosum]
Length=311

 Score =   248 bits (634),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG + DR+L++AFKAI  M+DRL LVATIKDRA+EIYK++EDQK +RGRN DA++
Sbjct  91   GRWQNRGSNADRSLILAFKAIGVMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDAIL  150

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL++EMG+S+EMGTIHAGD
Sbjct  151  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLELEMGQSVEMGTIHAGD  210

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  211  FMRRFCSNLGMTNQAVKAAQEAVKKSEEFD  240



>ref|XP_002534470.1| transcription initiation factor iib, putative [Ricinus communis]
 gb|EEF27913.1| transcription initiation factor iib, putative [Ricinus communis]
Length=312

 Score =   248 bits (634),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ +KA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAMKAAQEAVQKSEEFD  241



>ref|XP_010941281.1| PREDICTED: transcription initiation factor IIB-like [Elaeis guineensis]
Length=312

 Score =   248 bits (634),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNRG +PDR+L++AF+ IA MADRL LVATIKDRA+EIYK++ED K  RGRN DA++A
Sbjct  93   RWQNRGSNPDRSLILAFRTIATMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAILA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD+
Sbjct  153  ACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCS+LGM+N  VKA QE V KSEE D
Sbjct  213  LRRFCSHLGMTNHAVKAAQEAVQKSEELD  241



>ref|XP_002513521.1| transcription initiation factor iib, putative [Ricinus communis]
 gb|EEF48924.1| transcription initiation factor iib, putative [Ricinus communis]
Length=312

 Score =   248 bits (634),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L+ AFK IA M+DRL LVATIKDRA+EIYK++EDQK  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLIQAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKPLRGRNQDAVL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL+VE+G+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLEVELGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM+N+ VKA QE V KSEE D
Sbjct  212  FLRRFCSHLGMNNQAVKAAQEAVKKSEELD  241



>dbj|BAJ53205.1| JHL06B08.6 [Jatropha curcas]
 gb|KDP26080.1| hypothetical protein JCGZ_21113 [Jatropha curcas]
Length=312

 Score =   248 bits (634),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ +KA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAMKAAQEAVQKSEEFD  241



>ref|XP_010672876.1| PREDICTED: transcription initiation factor IIB-2 [Beta vulgaris 
subsp. vulgaris]
Length=312

 Score =   248 bits (633),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA MADRL LV+TIKDRASEIYK++EDQK +RGRN DA++
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMADRLGLVSTIKDRASEIYKKVEDQKSSRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL+ EMG+++EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLESEMGQAVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCSNLGM+N+ +KA QE V KSEE D
Sbjct  212  FLRRFCSNLGMNNQAMKAAQEAVQKSEEID  241



>gb|KJB14839.1| hypothetical protein B456_002G146300 [Gossypium raimondii]
Length=302

 Score =   248 bits (632),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMG IHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGAIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQEAVQKSEEFD  241



>ref|XP_003578512.1| PREDICTED: transcription initiation factor IIB [Brachypodium 
distachyon]
Length=312

 Score =   248 bits (633),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS LGM+N  VKA QE V +SEE D
Sbjct  212  FLRRFCSTLGMNNTAVKAAQEAVQRSEELD  241



>dbj|BAK05040.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=312

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNRG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++A
Sbjct  93   RWQNRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAILA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD+
Sbjct  153  ACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCS LGM+N  VKA QE V +SEE D
Sbjct  213  LRRFCSTLGMNNTAVKAAQEAVQRSEELD  241



>ref|XP_010558141.1| PREDICTED: transcription initiation factor IIB-2 [Tarenaya hassleriana]
Length=312

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA MADRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRYQNRGSNPDRGLIVAFKTIATMADRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGA+KKEIGRAKE+IVK L +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGASKKEIGRAKEYIVKTLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ +KA QE+V KSEEFD
Sbjct  212  FMRRFCSNLGMTNQTMKAAQESVQKSEEFD  241



>gb|KJB14836.1| hypothetical protein B456_002G146300 [Gossypium raimondii]
Length=312

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMG IHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGAIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGMNNQAVKAAQEAVQKSEEFD  241



>ref|XP_002277679.1| PREDICTED: transcription initiation factor IIB [Vitis vinifera]
 emb|CBI17180.3| unnamed protein product [Vitis vinifera]
Length=314

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L+ AFK IA M DRL LVATIKD A+EIYK++EDQK  RGRN DA++
Sbjct  94   GRWQNRGSNPDRSLIQAFKTIATMCDRLGLVATIKDLANEIYKKVEDQKPLRGRNQDAIL  153

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AACIYIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL+VEMG+SMEMGTIHAGD
Sbjct  154  AACIYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLEVEMGQSMEMGTIHAGD  213

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM+N+ VKA QE V KSEE D
Sbjct  214  FLRRFCSHLGMTNQAVKAAQEAVQKSEELD  243



>ref|XP_008392240.1| PREDICTED: transcription initiation factor IIB-2 [Malus domestica]
Length=312

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L+ AFK IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIXAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLENGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM N+ VKA  E V KSEEFD
Sbjct  212  FMRRFCSNLGMINQAVKAAHEAVTKSEEFD  241



>ref|XP_010934192.1| PREDICTED: transcription initiation factor IIB-like isoform X2 
[Elaeis guineensis]
Length=313

 Score =   246 bits (629),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R Q RG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++A
Sbjct  94   RWQTRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAILA  153

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE +PRTVKEICS+ANGA KKEIGRAKE+IVKQL+VEMG+SMEMGTIHAGD+
Sbjct  154  ACLYIACRQEDRPRTVKEICSVANGAAKKEIGRAKEYIVKQLEVEMGQSMEMGTIHAGDF  213

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCS+LGMSN+ VKA QE V KSEE D
Sbjct  214  LRRFCSHLGMSNQAVKAAQEAVQKSEELD  242



>ref|XP_008788640.1| PREDICTED: transcription initiation factor IIB-like [Phoenix 
dactylifera]
Length=312

 Score =   246 bits (629),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNR  +PDR+L++AF+ IA MADRL LVATIKDRA+EIYK++ED K  RGRN DA++A
Sbjct  93   RWQNRSSNPDRSLILAFRTIATMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAILA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD+
Sbjct  153  ACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCS+LGM+N+ VKA QE V KSEE D
Sbjct  213  LRRFCSHLGMTNQAVKAAQEAVQKSEELD  241



>ref|XP_010935048.1| PREDICTED: transcription initiation factor IIB-like [Elaeis guineensis]
Length=312

 Score =   246 bits (628),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNR  +PDR+L++AF+ IA MADRL LVATIKDRA+EIYK++ED K  RGRN DA++
Sbjct  92   GRWQNRSSNPDRSLILAFRTIATMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM+N+ VKA QE V KSEE D
Sbjct  212  FLRRFCSHLGMTNQAVKAAQEAVQKSEELD  241



>ref|XP_003519077.1| PREDICTED: transcription initiation factor IIB-like [Glycine 
max]
Length=314

 Score =   246 bits (628),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDRAL++AFK IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  94   GRWQNRGSNPDRALIIAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  153

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G ++EMGTIHAGD
Sbjct  154  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLENGNAVEMGTIHAGD  213

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNL M+N+ VKA QE V KSEEFD
Sbjct  214  FMRRFCSNLCMNNQAVKAAQEAVHKSEEFD  243



>ref|XP_010554814.1| PREDICTED: transcription initiation factor IIB-2-like [Tarenaya 
hassleriana]
Length=312

 Score =   246 bits (627),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EI+KR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIIAFKTIATMSDRLGLVATIKDRANEIFKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVK L +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKTLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLG +N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGTNNQAVKAAQEAVKKSEEFD  241



>ref|XP_002308933.1| Transcription initiation factor IIB-1 family protein [Populus 
trichocarpa]
 gb|EEE92456.1| Transcription initiation factor IIB-1 family protein [Populus 
trichocarpa]
Length=312

 Score =   245 bits (626),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLEAGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGMSN  VKA  E V  SE+FD
Sbjct  212  FMRRFCSNLGMSNHTVKAATEAVKTSEQFD  241



>ref|XP_009409510.1| PREDICTED: transcription initiation factor IIB [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R Q+RG +PDR L++AFK IA MADRL LVATIKDRA+EIYK++ED K  RGRN DA++A
Sbjct  93   RWQSRGANPDRNLILAFKTIATMADRLGLVATIKDRANEIYKKIEDLKSIRGRNQDAILA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE +PRTVKEICS+ANGA KKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD+
Sbjct  153  ACLYIACRQEDRPRTVKEICSVANGAAKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCS+LGM+N+ VKA QE V KSEE D
Sbjct  213  LRRFCSHLGMTNQAVKAAQEAVQKSEELD  241



>ref|NP_001238343.1| transcription initiation factor IIB [Glycine max]
 sp|P48513.1|TF2B_SOYBN RecName: Full=Transcription initiation factor IIB; AltName: Full=General 
transcription factor TFIIB [Glycine max]
 gb|AAB09756.1| transcription factor TFIIB [Glycine max]
Length=313

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDRAL+ AFK IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  93   GRWQNRGSNPDRALIQAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  152

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G ++EMGTIHAGD
Sbjct  153  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLENGNAVEMGTIHAGD  212

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNL M+N+ VKA QE V KSEEFD
Sbjct  213  FMRRFCSNLCMNNQAVKAAQEAVQKSEEFD  242



>ref|XP_002322722.1| Transcription initiation factor IIB-1 family protein [Populus 
trichocarpa]
 gb|EEF04483.1| Transcription initiation factor IIB-1 family protein [Populus 
trichocarpa]
Length=312

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L+ AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLITAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGMSN  VKA  E V  SE+FD
Sbjct  212  FMRRFCSNLGMSNHTVKAATEAVKTSEQFD  241



>ref|XP_011039445.1| PREDICTED: transcription initiation factor IIB-2 [Populus euphratica]
Length=312

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L+ AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLITAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGMSN  VKA  E V  SE+FD
Sbjct  212  FMRRFCSNLGMSNHTVKAATEAVKTSEQFD  241



>ref|XP_008799413.1| PREDICTED: transcription initiation factor IIB-like [Phoenix 
dactylifera]
Length=312

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNRG +PDR+L++AF+ IA MADRL LVA IKDRA+EIYK++ED K  RGRN DA++A
Sbjct  93   RWQNRGSNPDRSLIIAFRTIATMADRLGLVAIIKDRANEIYKKVEDLKSIRGRNQDAILA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG SMEMGTIHAGD+
Sbjct  153  ACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGRSMEMGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCS+LGM+N  VKA QE V KSEE D
Sbjct  213  LRRFCSHLGMTNHAVKAAQEAVQKSEELD  241



>ref|NP_001149721.1| transcription initiation factor IIB [Zea mays]
 gb|ACG36522.1| transcription initiation factor IIB [Zea mays]
 tpg|DAA40630.1| TPA: transcription initiation factor IIB [Zea mays]
Length=312

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AF+ IANMADRL LVATIKDRA+EI+K++ED K  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIFKKIEDLKSIRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS LGM+N+ V A +E V +SEE D
Sbjct  212  FLRRFCSTLGMTNQAVNAAKEAVQRSEELD  241



>ref|XP_011075342.1| PREDICTED: transcription initiation factor IIB-2 [Sesamum indicum]
Length=362

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AFK+IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DA++
Sbjct  142  GRWQNRGSNPDRSLILAFKSIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDAIL  201

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+I+KQL++E G+S+E+GTIHAGD
Sbjct  202  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIMKQLELENGQSVEIGTIHAGD  261

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM N+ VKA QE V K+EEFD
Sbjct  262  FMRRFCSNLGMGNQTVKAAQEAVRKAEEFD  291



>tpg|DAA40631.1| TPA: hypothetical protein ZEAMMB73_839050 [Zea mays]
Length=330

 Score =   244 bits (624),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AF+ IANMADRL LVATIKDRA+EI+K++ED K  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIFKKIEDLKSIRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD
Sbjct  152  AACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS LGM+N+ V A +E V +SEE D
Sbjct  212  FLRRFCSTLGMTNQAVNAAKEAVQRSEELD  241



>gb|ACF81664.1| unknown [Zea mays]
 tpg|DAA62479.1| TPA: hypothetical protein ZEAMMB73_928076 [Zea mays]
 tpg|DAA62480.1| TPA: hypothetical protein ZEAMMB73_928076 [Zea mays]
Length=312

 Score =   244 bits (623),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE +PRTVKEICS+ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAG+
Sbjct  152  AACLYIACRQEDRPRTVKEICSVANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGN  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS LGM+N+ V+A Q+ V  SEE D
Sbjct  212  FLRRFCSTLGMNNQAVRAAQDAVKHSEELD  241



>ref|XP_011048084.1| PREDICTED: transcription initiation factor IIB-2-like [Populus 
euphratica]
Length=312

 Score =   244 bits (622),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLEAGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGMSN   KA  E V  SE+FD
Sbjct  212  FMRRFCSNLGMSNHTFKAATEAVKTSEQFD  241



>ref|XP_011090131.1| PREDICTED: transcription initiation factor IIB-2-like isoform 
X1 [Sesamum indicum]
Length=312

 Score =   244 bits (622),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+++ AFK IA MADRL LVATIKDRA+EIYK++EDQK  RGRN DA++
Sbjct  92   GRWQNRGSNPDRSIIQAFKTIATMADRLGLVATIKDRANEIYKKVEDQKPLRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANG TKKEIGRAKEFIVKQL++EMG+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGTTKKEIGRAKEFIVKQLELEMGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+L M+N+ VKA QE V KSEE D
Sbjct  212  FLRRFCSHLSMANQAVKAAQEAVQKSEELD  241



>ref|XP_010523759.1| PREDICTED: transcription initiation factor IIB-2-like [Tarenaya 
hassleriana]
Length=312

 Score =   243 bits (621),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EI+KR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIIAFKTIATMSDRLGLVATIKDRANEIFKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGA+KKEIGRAKE+IVK L +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGASKKEIGRAKEYIVKTLGLETGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLG +N+ VKA QE V KSEEFD
Sbjct  212  FMRRFCSNLGTNNQAVKAAQEAVKKSEEFD  241



>ref|XP_004493474.1| PREDICTED: transcription initiation factor IIB-like [Cicer arietinum]
Length=312

 Score =   243 bits (620),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M++RL LV TIKDRA+EI+KR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSERLGLVGTIKDRANEIFKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICSIANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSIANGATKKEIGRAKEYIVKQLGLENGQSVEMGTIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+ + VKA QE+V KSEEFD
Sbjct  212  FMRRFCSNLGMNIQAVKAAQESVQKSEEFD  241



>emb|CDP14131.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L++AFK IA M++RL LVATIKDRA+EIYK++EDQK +RGRN DA++
Sbjct  92   GRWQNRGSNPDRSLILAFKTIATMSERLGLVATIKDRANEIYKKVEDQKSSRGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL++EMG+S+EMG IHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLELEMGQSVEMGAIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRF S LGM+N+ VKA QE V KSEEFD
Sbjct  212  FMRRFGSYLGMTNQAVKAAQEAVQKSEEFD  241



>ref|XP_010056895.1| PREDICTED: transcription initiation factor IIB-2 [Eucalyptus 
grandis]
 gb|KCW90139.1| hypothetical protein EUGRSUZ_A02331 [Eucalyptus grandis]
Length=312

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EI+K++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIFKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGA+KKEIGRAKE+IVKQL +E G+S+EMG IHA D
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGASKKEIGRAKEYIVKQLGLEKGQSVEMGAIHAAD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSN+GM+N+ VKA QE+V KSEEFD
Sbjct  212  FMRRFCSNVGMNNQAVKAAQESVQKSEEFD  241



>ref|XP_003625123.1| Transcription initiation factor IIB [Medicago truncatula]
 gb|AES81341.1| transcription initiation factor IIB [Medicago truncatula]
Length=313

 Score =   241 bits (616),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK I  MA+RL LV TIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIGTMAERLGLVPTIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEM-GESMEMGTIHAG  357
            AAC+YIACRQE KPRTVKEICSIANGATKKEIGRAKE+IVKQL +E  G+S+EMGTIHAG
Sbjct  152  AACLYIACRQEDKPRTVKEICSIANGATKKEIGRAKEYIVKQLGLENGGQSVEMGTIHAG  211

Query  358  DYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            D++RRFCSNLGM+++ VKA QE+V KSEEFD
Sbjct  212  DFMRRFCSNLGMNHQAVKAAQESVQKSEEFD  242



>gb|ABR16853.1| unknown [Picea sitchensis]
Length=313

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L+MAFK I  M+DRL LVATIKDRA+EIYK++ED K  RGRN DA++
Sbjct  93   GRWQNRGSNPDRSLIMAFKTIGTMSDRLGLVATIKDRANEIYKKVEDSKSIRGRNQDAIL  152

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGA+KKE+GRAKEFIVKQL+ EMG+SMEMGTIHAGD
Sbjct  153  AACLYIACRQEDKPRTVKEICSVANGASKKEVGRAKEFIVKQLEEEMGKSMEMGTIHAGD  212

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM ++ VKA  E V KSEE D
Sbjct  213  FLRRFCSHLGMGHQAVKAATEAVKKSEELD  242



>ref|XP_009380970.1| PREDICTED: transcription initiation factor IIB-like [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNR  + DR+L++AFKAIA MADRL LVATIKDRA+EIYK++ED K  RGRN +A++
Sbjct  92   GRWQNRASNSDRSLILAFKAIATMADRLGLVATIKDRANEIYKKVEDLKSVRGRNQEAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YI+CRQE KPRTVKEICS+ANGATKK+IGRAKEFIVKQL+VEMG+SMEMGTI+AGD
Sbjct  152  AACLYISCRQEDKPRTVKEICSVANGATKKDIGRAKEFIVKQLEVEMGKSMEMGTINAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM+N+EVKA QE V KS+E D
Sbjct  212  FLRRFCSHLGMTNQEVKAAQEAVQKSDELD  241



>gb|KHN07351.1| Transcription initiation factor IIB-2 [Glycine soja]
Length=299

 Score =   238 bits (607),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  28   PDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACR  207
            PDR L++AFK IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+AAC+YIACR
Sbjct  88   PDRGLIVAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALLAACLYIACR  147

Query  208  QEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNL  387
            QE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+E+GTIHAGD++RRFCSNL
Sbjct  148  QEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLEQGQSVEIGTIHAGDFMRRFCSNL  207

Query  388  GMSNEEVKAVQETVXKSEEFD  450
            GM+N+ VKA QE V KSEEFD
Sbjct  208  GMTNQAVKAAQEAVQKSEEFD  228



>ref|XP_010517653.1| PREDICTED: transcription initiation factor IIB-1-like [Camelina 
sativa]
Length=312

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNR  + DR L+ AFK IA M++RL LVATIKDRA+EIYKRLEDQK +RGRN DAL A
Sbjct  93   RWQNRNSNSDRGLIQAFKTIATMSERLGLVATIKDRANEIYKRLEDQKSSRGRNQDALYA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE KPRT+KEIC IANGATKKEIGRAK++IVK L +E G+S+E+GTIHAGD+
Sbjct  153  ACLYIACRQEDKPRTIKEICVIANGATKKEIGRAKDYIVKTLGLETGQSVELGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +RRFCSNLGMSN  VKA QE V KSEEFD
Sbjct  213  MRRFCSNLGMSNHAVKAAQEAVQKSEEFD  241



>ref|XP_006294641.1| hypothetical protein CARUB_v10023678mg [Capsella rubella]
 ref|XP_010505948.1| PREDICTED: transcription initiation factor IIB-1 [Camelina sativa]
 ref|XP_010508696.1| PREDICTED: transcription initiation factor IIB-1 [Camelina sativa]
 gb|EOA27539.1| hypothetical protein CARUB_v10023678mg [Capsella rubella]
Length=312

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNR  + DR L+ AFK IA M++RL LVATIKDRA+EIYKRLEDQK +RGRN DAL A
Sbjct  93   RWQNRNSNSDRGLIQAFKTIATMSERLGLVATIKDRANEIYKRLEDQKSSRGRNQDALYA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE KPRT+KEIC IANGATKKEIGRAK++IVK L +E G+S+E+GTIHAGD+
Sbjct  153  ACLYIACRQEDKPRTIKEICVIANGATKKEIGRAKDYIVKTLGLETGQSVELGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +RRFCSNLGMSN  VKA QE V KSEEFD
Sbjct  213  MRRFCSNLGMSNHAVKAAQEAVQKSEEFD  241



>ref|XP_002881787.1| hypothetical protein ARALYDRAFT_903484 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58046.1| hypothetical protein ARALYDRAFT_903484 [Arabidopsis lyrata subsp. 
lyrata]
Length=312

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNR  + DR L+ AFK IA M++RL LVATIKDRA+EIYKRLEDQK TRGRN DAL A
Sbjct  93   RWQNRNSNSDRGLIQAFKTIATMSERLGLVATIKDRANEIYKRLEDQKTTRGRNQDALYA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE KPRT+KEIC IANGATKKEIGRAK++IVK L ++ G+S+E+GTIHAGD+
Sbjct  153  ACLYIACRQEDKPRTIKEICVIANGATKKEIGRAKDYIVKTLGLDPGQSVELGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +RRFCSNLGMSN  VKA QE V KSEEFD
Sbjct  213  MRRFCSNLGMSNHAVKAAQEAVQKSEEFD  241



>gb|EPS61179.1| hypothetical protein M569_13619, partial [Genlisea aurea]
Length=211

 Score =   233 bits (594),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
            ARLQNRG DPDRA+V+AFK I+NMADRLSLV TIKDRASEIYKRLEDQKCTRGRNL+ALV
Sbjct  90   ARLQNRGSDPDRAIVLAFKTISNMADRLSLVTTIKDRASEIYKRLEDQKCTRGRNLEALV  149

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            A CIYIACRQEGKPRTVKEICS+  GATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD
Sbjct  150  AGCIYIACRQEGKPRTVKEICSVVAGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  209

Query  361  YL  366
            YL
Sbjct  210  YL  211



>ref|XP_010028570.1| PREDICTED: transcription initiation factor IIB-2-like [Eucalyptus 
grandis]
 gb|KCW83476.1| hypothetical protein EUGRSUZ_B00390 [Eucalyptus grandis]
 gb|KCW83477.1| hypothetical protein EUGRSUZ_B00390 [Eucalyptus grandis]
 gb|KCW83478.1| hypothetical protein EUGRSUZ_B00390 [Eucalyptus grandis]
Length=312

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             + Q RG +PDR L+ AFK+IA M+DRL LV TIKDRA+EIYK++EDQK  +GRNLDA++
Sbjct  92   GKWQGRGANPDRNLIQAFKSIAIMSDRLGLVTTIKDRANEIYKKVEDQKPLKGRNLDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+AN ATKKEIGRAKEFIVK L+ EMG+S+EMG IHA D
Sbjct  152  AACLYIACRQENKPRTVKEICSVANNATKKEIGRAKEFIVKLLEGEMGQSVEMGAIHAAD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            Y+RRFCSNLGM+N+EVKA QE V KSEE D
Sbjct  212  YMRRFCSNLGMTNQEVKAAQEVVLKSEELD  241



>gb|EYU18713.1| hypothetical protein MIMGU_mgv1a010428mg [Erythranthe guttata]
Length=312

 Score =   236 bits (601),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNRG +  R LV AF+ IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DA+ A
Sbjct  93   RWQNRGSNTYRTLVFAFQTIATMSDRLGLVATIKDRANEIYKRIEDQKSSRGRNQDAIYA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE KPRTVKEICS+ANGATKKE+GRAKE+I+K L++EMG+S+E+GTIHAGD+
Sbjct  153  ACLYIACRQEDKPRTVKEICSVANGATKKEVGRAKEYIMKHLQLEMGQSVEIGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +RRFCSNLGM+N+ VKA QE V K+E FD
Sbjct  213  MRRFCSNLGMANQTVKAAQEAVQKTEAFD  241



>ref|XP_006411427.1| hypothetical protein EUTSA_v10016972mg [Eutrema salsugineum]
 gb|ESQ52880.1| hypothetical protein EUTSA_v10016972mg [Eutrema salsugineum]
Length=312

 Score =   236 bits (601),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNR  + DR L+ AFK IA M++RL+LVATIKDRA+EI+KRLEDQK +RGRN DAL A
Sbjct  93   RWQNRNANSDRGLIQAFKTIATMSERLNLVATIKDRANEIFKRLEDQKSSRGRNQDALFA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YI+CRQE KPRT+KEICS+ANGATKKEIGRAK++IVK L +E G+S+E+GTIHAGD+
Sbjct  153  ACLYISCRQEDKPRTIKEICSVANGATKKEIGRAKDYIVKTLGLETGQSVELGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +RRFCSNLGMS++ VKA QE V KSEEFD
Sbjct  213  MRRFCSNLGMSHQAVKAAQEAVAKSEEFD  241



>ref|XP_010673685.1| PREDICTED: transcription initiation factor IIB-like [Beta vulgaris 
subsp. vulgaris]
Length=313

 Score =   236 bits (601),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R Q+RG +PDR L+ AFK+IA MADRL LV+TIKDRA+EI+K++EDQK  RGRN DA++
Sbjct  93   GRWQSRGSNPDRNLIQAFKSIATMADRLGLVSTIKDRANEIFKKVEDQKPLRGRNQDAIL  152

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKEFIVKQL+ E+G+S+EMG IHAGD
Sbjct  153  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEFIVKQLEGELGQSVEMGAIHAGD  212

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM  + VKA QE V KSEE D
Sbjct  213  FLRRFCSHLGMDKQAVKAAQEAVQKSEELD  242



>ref|XP_003521166.1| PREDICTED: transcription initiation factor IIB-2-like [Glycine 
max]
Length=306

 Score =   235 bits (600),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 6/150 (4%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG      L++AFK IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRG------LIVAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  145

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+E+GTIHAGD
Sbjct  146  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLEQGQSVEIGTIHAGD  205

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  206  FMRRFCSNLGMTNQAVKAAQEAVQKSEEFD  235



>emb|CDY23840.1| BnaC04g01970D [Brassica napus]
 emb|CDX79927.1| BnaA05g02290D [Brassica napus]
Length=312

 Score =   235 bits (600),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNR G+P+R L+ AFK IA M+DRL LV TIKDRA+EI+KRLEDQK TRGRN DAL+
Sbjct  92   GRWQNRNGNPERGLMQAFKTIATMSDRLGLVGTIKDRANEIFKRLEDQKSTRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YI+CRQE KPRT+KEICS+ANGATKKE+GRAK+FIVK L +E G S+EMG IHAGD
Sbjct  152  AACLYISCRQEDKPRTIKEICSVANGATKKEMGRAKDFIVKTLGLETGHSVEMGAIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +++RFCSNLGMS++ V+A +E V KSEEFD
Sbjct  212  FMKRFCSNLGMSHQAVRAAEEAVKKSEEFD  241



>ref|XP_006476712.1| PREDICTED: transcription initiation factor IIB-like [Citrus sinensis]
Length=312

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            +LQ RG  PDR L+ AFK+I+ M+DRL LV TIKDRA+EIYK++EDQK  RGRN +A+VA
Sbjct  94   KLQARGSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVA  153

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE KPRTVKE CS+ANG TKKEIGRAKEFIVK L+ EMG+S+EMGTIHA DY
Sbjct  154  ACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDY  213

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCSNLGM+N+ VKA QE V KSE+ D
Sbjct  214  LRRFCSNLGMTNQAVKAAQEAVQKSEDLD  242



>ref|XP_002322134.1| Transcription initiation factor IIB-1 family protein [Populus 
trichocarpa]
 gb|EEF06261.1| Transcription initiation factor IIB-1 family protein [Populus 
trichocarpa]
Length=311

 Score =   233 bits (594),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             + Q+RG +PDR  + AFK+IA MADRL LV TIKDRA+EIYK++EDQK  +GRN DA++
Sbjct  92   GKWQSRGANPDRNRIQAFKSIAAMADRLGLVTTIKDRANEIYKKVEDQKPLKGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE K RTVKEICS+ NG TKKEIGRAKEFIVK L+VEMG SMEMGTIHA D
Sbjct  152  AACLYIACRQENKARTVKEICSVVNGTTKKEIGRAKEFIVKHLEVEMGHSMEMGTIHAAD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGM+N+ VKA  E V KSEE D
Sbjct  212  YLRRFCSNLGMTNQAVKAAHEAVQKSEELD  241



>ref|NP_181694.1| transcription initiation factor IIB-1 [Arabidopsis thaliana]
 sp|P48512.1|TF2B1_ARATH RecName: Full=Transcription initiation factor IIB-1; AltName: 
Full=General transcription factor TFIIB-1; Short=AtTFIIB1 [Arabidopsis 
thaliana]
 gb|AAB09755.1| transcription factor TFIIB [Arabidopsis thaliana]
 gb|AAB84344.1| transcription factor IIB (TFIIB) [Arabidopsis thaliana]
 gb|AAM13059.1| transcription factor IIB [Arabidopsis thaliana]
 gb|AAM63705.1| transcription factor IIB (TFIIB) [Arabidopsis thaliana]
 gb|AAM91169.1| transcription factor IIB [Arabidopsis thaliana]
 gb|AAR28002.1| TFIIB1 [Arabidopsis thaliana]
 gb|AEC10009.1| transcription initiation factor IIB-1 [Arabidopsis thaliana]
Length=312

 Score =   233 bits (594),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNR  + DR L+ AFK IA M++RL LVATIKDRA+E+YKRLEDQK +RGRN DAL A
Sbjct  93   RWQNRNSNSDRGLIQAFKTIATMSERLGLVATIKDRANELYKRLEDQKSSRGRNQDALYA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE KPRT+KEIC IANGATKKEIGRAK++IVK L +E G+S+++GTIHAGD+
Sbjct  153  ACLYIACRQEDKPRTIKEICVIANGATKKEIGRAKDYIVKTLGLEPGQSVDLGTIHAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +RRFCSNL MSN  VKA QE V KSEEFD
Sbjct  213  MRRFCSNLAMSNHAVKAAQEAVQKSEEFD  241



>ref|XP_006439685.1| hypothetical protein CICLE_v10021272mg [Citrus clementina]
 gb|ESR52925.1| hypothetical protein CICLE_v10021272mg [Citrus clementina]
Length=312

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            +LQ R   PDR L+ AFK+I+ M+DRL LV TIKDRA+EIYK++EDQK  RGRN +A+VA
Sbjct  94   KLQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVA  153

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE KPRTVKE CS+ANG TKKEIGRAKEFIVK L+ EMG+S+EMGTIHA DY
Sbjct  154  ACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDY  213

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCSNLGM+N+ VKA QE V KSE+ D
Sbjct  214  LRRFCSNLGMTNQAVKAAQEAVQKSEDLD  242



>gb|KDO75998.1| hypothetical protein CISIN_1g021438mg [Citrus sinensis]
Length=312

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            +LQ R   PDR L+ AFK+I+ M+DRL LV TIKDRA+EIYK++EDQK  RGRN +A+VA
Sbjct  94   KLQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVA  153

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE KPRTVKE CS+ANG TKKEIGRAKEFIVK L+ EMG+S+EMGTIHA DY
Sbjct  154  ACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDY  213

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            LRRFCSNLGM+N+ VKA QE V KSE+ D
Sbjct  214  LRRFCSNLGMTNQAVKAAQEAVQKSEDLD  242



>ref|XP_011028679.1| PREDICTED: transcription initiation factor IIB-2-like [Populus 
euphratica]
Length=311

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             + Q+R  +PDR  + AFK+IA MADRL LV TIKDRA+EIYK++EDQK  +GRN DA++
Sbjct  92   GKWQSRSANPDRNRIQAFKSIAAMADRLGLVTTIKDRANEIYKKVEDQKPLKGRNQDAIL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE K RTVKEICS+ NGATKKEIGRAKEFIVK L+VEMG SMEMGTIHA D
Sbjct  152  AACLYIACRQENKARTVKEICSVVNGATKKEIGRAKEFIVKHLEVEMGHSMEMGTIHAAD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGM+N+ VKA  E V KSEE D
Sbjct  212  YLRRFCSNLGMTNQAVKAAHEAVQKSEELD  241



>gb|EMS56891.1| Transcription initiation factor IIB [Triticum urartu]
Length=358

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 133/175 (76%), Gaps = 26/175 (15%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIK--------------------------  105
            R QNRG +PDR+L++AF+ IANMADRL LVATIK                          
Sbjct  93   RWQNRGSNPDRSLILAFRTIANMADRLGLVATIKLETENTYYYSYTCMRELMNELNASSL  152

Query  106  DRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRA  285
            DRA+EIYK++ED K  RGRN DA++AAC+YIACRQE +PRTVKEICS+ANGATKKEIGRA
Sbjct  153  DRANEIYKKVEDLKSIRGRNQDAILAACLYIACRQEDRPRTVKEICSVANGATKKEIGRA  212

Query  286  KEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            KEFIVKQL+VEMG+SMEMGTIHAGD+LRRFCS LGM+N  VKA QE V +SEE D
Sbjct  213  KEFIVKQLEVEMGQSMEMGTIHAGDFLRRFCSTLGMNNTAVKAAQEAVQRSEELD  267



>gb|KDO75999.1| hypothetical protein CISIN_1g021438mg [Citrus sinensis]
Length=278

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             +LQ R   PDR L+ AFK+I+ M+DRL LV TIKDRA+EIYK++EDQK  RGRN +A+V
Sbjct  93   GKLQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIV  152

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKE CS+ANG TKKEIGRAKEFIVK L+ EMG+S+EMGTIHA D
Sbjct  153  AACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASD  212

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGM+N+ VKA QE V KSE+ D
Sbjct  213  YLRRFCSNLGMTNQAVKAAQEAVQKSEDLD  242



>gb|KEH33433.1| transcription initiation factor IIB [Medicago truncatula]
Length=313

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 130/150 (87%), Gaps = 1/150 (1%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R Q  G +PDR L++AFK I  MA+RL LV  IKDRA+EIYKR++DQK +RGRN DAL+A
Sbjct  93   RWQKHGSNPDRGLILAFKTIDTMAERLGLVPIIKDRANEIYKRVQDQKSSRGRNQDALLA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEM-GESMEMGTIHAGD  360
            AC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E  G+S+EMGTIHAGD
Sbjct  153  ACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLENGGQSVEMGTIHAGD  212

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+++ VKA QE+V KSEEFD
Sbjct  213  FMRRFCSNLGMNHQAVKAAQESVKKSEEFD  242



>ref|XP_009133502.1| PREDICTED: transcription initiation factor IIB-1 [Brassica rapa]
 emb|CDY35407.1| BnaA03g19530D [Brassica napus]
 emb|CDY22532.1| BnaC03g23420D [Brassica napus]
Length=312

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNR G  +R L+ AFK IA M+DRL LV TIKDRA+EI+KRLEDQK TRGRN DAL+
Sbjct  92   GRWQNRNGSAERGLIQAFKTIATMSDRLGLVGTIKDRANEIFKRLEDQKSTRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YI+CRQE KPRT+KEICS+ANGATKKEIGRAK+FIVK L +E G S+E+G IHAGD
Sbjct  152  AACLYISCRQEDKPRTIKEICSVANGATKKEIGRAKDFIVKTLGLETGHSVELGAIHAGD  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +++RFCSNLGMS++ V+A +E V KSEEFD
Sbjct  212  FMKRFCSNLGMSHQAVRAAEEAVKKSEEFD  241



>ref|XP_010934190.1| PREDICTED: transcription initiation factor IIB-like isoform X1 
[Elaeis guineensis]
Length=340

 Score =   232 bits (591),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 133/176 (76%), Gaps = 27/176 (15%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R Q RG +PDR+L++AF+ IANMADRL LVATIKDRA+EIYK++ED K  RGRN DA++A
Sbjct  94   RWQTRGSNPDRSLILAFRTIANMADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAILA  153

Query  184  ACIYIACRQEGKPRTVK---------------------------EICSIANGATKKEIGR  282
            AC+YIACRQE +PRTVK                           EICS+ANGA KKEIGR
Sbjct  154  ACLYIACRQEDRPRTVKGMADILLQVSSEFIMWGVLHQLPYFQIEICSVANGAAKKEIGR  213

Query  283  AKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            AKE+IVKQL+VEMG+SMEMGTIHAGD+LRRFCS+LGMSN+ VKA QE V KSEE D
Sbjct  214  AKEYIVKQLEVEMGQSMEMGTIHAGDFLRRFCSHLGMSNQAVKAAQEAVQKSEELD  269



>gb|KFK37005.1| hypothetical protein AALP_AA4G200000 [Arabis alpina]
Length=313

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNR  + +R L+ AFK IA M+DRL LVATIKDRA+EI+KRLEDQK +RGRN DAL+
Sbjct  92   GRWQNRNSNSERGLIQAFKTIATMSDRLGLVATIKDRANEIFKRLEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEM-GESMEMGTIHAG  357
            AAC+YI+CRQE KPRT+KEICS+ANGA+KKEIGRAK++IVK L +E  G+S+E+G IHAG
Sbjct  152  AACLYISCRQEDKPRTIKEICSVANGASKKEIGRAKDYIVKTLGLEPGGQSVELGAIHAG  211

Query  358  DYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            D++RRFCSNLGMS + VKA QE V KSEEFD
Sbjct  212  DFMRRFCSNLGMSQQAVKAAQEAVKKSEEFD  242



>ref|XP_010413000.1| PREDICTED: uncharacterized protein LOC104699385 [Camelina sativa]
Length=600

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNR  + DR L+   K IA M++RL LVATIKDRA+EIYKRLEDQK +RGRN DAL 
Sbjct  398  GRWQNRNSNSDRVLIQTVKTIATMSERLGLVATIKDRANEIYKRLEDQKSSRGRNQDALY  457

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRT+ EIC IANGATKKEIGRAK++IVK L +E G+S+E+GTIHAGD
Sbjct  458  AACLYIACRQEDKPRTINEICVIANGATKKEIGRAKDYIVKTLGLETGQSVELGTIHAGD  517

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGMSN  VKA QE V KSEEFD
Sbjct  518  FMRRFCSNLGMSNHAVKAAQEAVQKSEEFD  547



>ref|XP_006605212.1| PREDICTED: transcription initiation factor IIB-like [Glycine 
max]
Length=300

 Score =   223 bits (567),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  55   KAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQEGKPRTVK  234
            + IA M+DRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+AAC+YIACRQE KPRTVK
Sbjct  98   ETIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVK  157

Query  235  EICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLGMSNEEVKA  414
            EICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD++RRFCSNLGM+N+ VKA
Sbjct  158  EICSVANGATKKEIGRAKEYIVKQLGLEQGQSVEMGTIHAGDFMRRFCSNLGMTNQAVKA  217

Query  415  VQETVXKSEEFD  450
             QE V KSEEFD
Sbjct  218  AQEAVQKSEEFD  229



>gb|KEH41632.1| transcription initiation factor IIB [Medicago truncatula]
Length=312

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            RLQNR  + DR L++AFK I  MA+RL L   IKDRA+EIYKR+EDQK +RGRN DAL+A
Sbjct  93   RLQNRASNHDRTLLLAFKNITTMAERLDLATFIKDRANEIYKRVEDQKSSRGRNQDALLA  152

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            ACIYIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL ++ G+SMEMGTI+AGD+
Sbjct  153  ACIYIACRQEEKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLDNGQSMEMGTINAGDF  212

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +RRFCS + ++N+  KA  E V KSEEFD
Sbjct  213  MRRFCSTIDLNNQARKAAMEAVKKSEEFD  241



>ref|XP_001772159.1| predicted protein [Physcomitrella patens]
 gb|EDQ62972.1| predicted protein [Physcomitrella patens]
Length=312

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            R QNRG +PDR+L++AF++I  MADRL LV+TIKDRA+EIYK++ED K  RGR+ DA++A
Sbjct  91   RWQNRGSNPDRSLIIAFRSIGTMADRLGLVSTIKDRANEIYKKVEDLKSIRGRSQDAILA  150

Query  184  ACIYIACRQEGKPRTVK-EICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AC+YIACRQE KPRT K EICS+ANGA+KK+IGRA +FIVKQL+ +MG SMEMGTIHAGD
Sbjct  151  ACLYIACRQEDKPRTFKAEICSVANGASKKDIGRATKFIVKQLEEDMGISMEMGTIHAGD  210

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+L M N EV+A  ETV KSE  D
Sbjct  211  FLRRFCSHLNMENNEVRAATETVKKSEMLD  240



>ref|XP_002961186.1| hypothetical protein SELMODRAFT_266576 [Selaginella moellendorffii]
 gb|EFJ38725.1| hypothetical protein SELMODRAFT_266576 [Selaginella moellendorffii]
Length=300

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             + QN G +PDRAL++AFK I  MADRL LV+TIKDRA EIYK++ED K  RGR+ DA++
Sbjct  80   GKWQNHGTNPDRALLLAFKTIGTMADRLGLVSTIKDRADEIYKKVEDMKSIRGRSQDAIL  139

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRT KEI S+ANGATKKEIGRA  FIVK+L+ EMG+SM MG+IHAGD
Sbjct  140  AACLYIACRQEDKPRTFKEIHSVANGATKKEIGRATNFIVKRLEEEMGKSMSMGSIHAGD  199

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM+N+ V+A  +TV K EE D
Sbjct  200  FLRRFCSHLGMTNQAVRAATDTVKKVEELD  229



>ref|XP_002966817.1| hypothetical protein SELMODRAFT_87129 [Selaginella moellendorffii]
 gb|EFJ31416.1| hypothetical protein SELMODRAFT_87129 [Selaginella moellendorffii]
Length=310

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             + QN G +PDRAL++AFK I  MADRL LV+TIKDRA EIYK++ED K  RGR+ DA++
Sbjct  90   GKWQNHGTNPDRALLLAFKTIGTMADRLGLVSTIKDRADEIYKKVEDMKSIRGRSQDAIL  149

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRT KEI S+ANGATKKEIGRA  FIVK+L+ EMG+SM MG+IHAGD
Sbjct  150  AACLYIACRQEDKPRTFKEIHSVANGATKKEIGRATNFIVKRLEEEMGKSMSMGSIHAGD  209

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+LGM+N+ V+A  +TV K EE D
Sbjct  210  FLRRFCSHLGMTNQAVRAATDTVKKVEELD  239



>ref|XP_008239669.1| PREDICTED: transcription initiation factor IIB-like [Prunus mume]
Length=310

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 122/149 (82%), Gaps = 2/149 (1%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R Q+R   PDR L+  F AIA MADRL LV TIKDRA+EIYK++EDQ+  RGRN DA+V
Sbjct  93   GRWQSRASKPDRHLLNIFSAIAIMADRLGLVTTIKDRANEIYKKVEDQRPLRGRNQDAVV  152

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS  +GA+KKEIGRAKEFI K L+VE+G+  E+GTIHAGD
Sbjct  153  AACLYIACRQENKPRTVKEICSAVSGASKKEIGRAKEFIWKHLEVEIGQ--EIGTIHAGD  210

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEF  447
            YLRRFCSNLGM N EVKA QETV KSE+ 
Sbjct  211  YLRRFCSNLGMKNLEVKAAQETVQKSEDL  239



>gb|EMT25381.1| Transcription initiation factor IIB [Aegilops tauschii]
Length=198

 Score =   214 bits (544),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +1

Query  70   MADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQEGKPRTVKEICSI  249
            MADRL LVATIKDRA+EIYK++ED K  RGRN DA++AAC+YIACRQE +PRTVKEICS+
Sbjct  1    MADRLGLVATIKDRANEIYKKVEDLKSIRGRNQDAILAACLYIACRQEDRPRTVKEICSV  60

Query  250  ANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLGMSNEEVKAVQETV  429
            ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD+LRRFCS LGM+N  VKA QE V
Sbjct  61   ANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGDFLRRFCSTLGMNNTAVKAAQEAV  120

Query  430  XKSEEFD  450
             +SEE D
Sbjct  121  QRSEELD  127



>gb|KDP31182.1| hypothetical protein JCGZ_11558 [Jatropha curcas]
Length=305

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 119/150 (79%), Gaps = 8/150 (5%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             + Q+RG +PDR L+ AFK        L LV  IKDRA+EIYK++EDQK  +GRN DA++
Sbjct  92   GKWQSRGANPDRGLIQAFK--------LGLVTIIKDRANEIYKKVEDQKPLKGRNQDAIL  143

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ NG TKKEIGRAKEFIVK L+VEMG S+EMGTIHA D
Sbjct  144  AACLYIACRQENKPRTVKEICSVVNGPTKKEIGRAKEFIVKHLEVEMGHSVEMGTIHAAD  203

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            YLRRFCSNLGM+N+ VKA QE V KSE  D
Sbjct  204  YLRRFCSNLGMTNQAVKAAQEAVQKSEGLD  233



>ref|XP_007210181.1| hypothetical protein PRUPE_ppa020307mg [Prunus persica]
 gb|EMJ11380.1| hypothetical protein PRUPE_ppa020307mg [Prunus persica]
Length=310

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 121/149 (81%), Gaps = 2/149 (1%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R Q R   PDR L+  F AIA MADRL LV TIKDRA+EIYK++EDQ+  RGRN DA+V
Sbjct  93   GRWQCRASKPDRHLLNIFSAIAIMADRLGLVTTIKDRANEIYKKVEDQRPLRGRNQDAVV  152

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS  +GA+KKEIGRAKEFI K L+VE+G+  E+GTIHAGD
Sbjct  153  AACLYIACRQENKPRTVKEICSAVSGASKKEIGRAKEFIWKHLEVEIGQ--EIGTIHAGD  210

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEF  447
            YLRRFCSNLGM N EVKA QETV KSE+ 
Sbjct  211  YLRRFCSNLGMKNLEVKAAQETVQKSEDL  239



>ref|XP_006853036.1| hypothetical protein AMTR_s00038p00018470 [Amborella trichopoda]
 gb|ERN14503.1| hypothetical protein AMTR_s00038p00018470 [Amborella trichopoda]
Length=314

 Score =   215 bits (548),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR+L+ AF  IA MA+RL LV TIKD A+EIYK++ED K  +GRN DA+ 
Sbjct  92   GRWQNRGSNPDRSLIQAFGTIAAMAERLGLVPTIKDLANEIYKKVEDLKSVKGRNQDAIY  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE  PRTVKEICS+ NGA+KKEIGRAKE IVK L+VE G+SMEMGTIHAG 
Sbjct  152  AACLYIACRQEQMPRTVKEICSVTNGASKKEIGRAKEHIVKLLEVETGKSMEMGTIHAGG  211

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCS L M+N+E KA  E V KSEE D
Sbjct  212  FMRRFCSTLNMTNQEKKAASEAVVKSEELD  241



>ref|XP_011090132.1| PREDICTED: transcription initiation factor IIB-2-like isoform 
X2 [Sesamum indicum]
Length=297

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 120/150 (80%), Gaps = 15/150 (10%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR               L LVATIKDRA+EIYK++EDQK  RGRN DA++
Sbjct  92   GRWQNRGSNPDR---------------LGLVATIKDRANEIYKKVEDQKPLRGRNQDAIL  136

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANG TKKEIGRAKEFIVKQL++EMG+S+EMGTIHAGD
Sbjct  137  AACLYIACRQEDKPRTVKEICSVANGTTKKEIGRAKEFIVKQLELEMGQSVEMGTIHAGD  196

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            +LRRFCS+L M+N+ VKA QE V KSEE D
Sbjct  197  FLRRFCSHLSMANQAVKAAQEAVQKSEELD  226



>gb|ACF84713.1| unknown [Zea mays]
Length=198

 Score =   210 bits (535),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +1

Query  70   MADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQEGKPRTVKEICSI  249
            MADRL LVATIKDRA+EI+K++ED K  RGRN DA++AAC+YIACRQE +PRTVKEICS+
Sbjct  1    MADRLGLVATIKDRANEIFKKIEDLKSIRGRNQDAILAACLYIACRQEDRPRTVKEICSV  60

Query  250  ANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLGMSNEEVKAVQETV  429
            ANGATKKEIGRAKEFIVKQL+VEMG+SMEMGTIHAGD+LRRFCS LGM+N+ V A +E V
Sbjct  61   ANGATKKEIGRAKEFIVKQLEVEMGQSMEMGTIHAGDFLRRFCSTLGMTNQAVNAAKEAV  120

Query  430  XKSEEFD  450
             +SEE D
Sbjct  121  QRSEELD  127



>ref|XP_009369381.1| PREDICTED: transcription initiation factor IIB-like [Pyrus x 
bretschneideri]
Length=312

 Score =   207 bits (526),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 117/148 (79%), Gaps = 2/148 (1%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            + Q R  +PD  L+  F AIA MADRL LV TIKDRA+EIYK++EDQK  RGRN DA+VA
Sbjct  96   KWQRRASNPDGHLLDIFGAIAVMADRLGLVTTIKDRANEIYKKVEDQKPLRGRNQDAIVA  155

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+YIACRQE KPRTVKEIC+  +GATKKEIGRAKEFI K ++ E+G  +EMGTIHA DY
Sbjct  156  ACLYIACRQENKPRTVKEICTAVSGATKKEIGRAKEFIWKHMEAELG--LEMGTIHAEDY  213

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEF  447
            LRRFCSNLGM N +VKA QE V  +EE 
Sbjct  214  LRRFCSNLGMKNRDVKAAQEMVQNTEEL  241



>ref|XP_006421303.1| hypothetical protein CICLE_v10005479mg [Citrus clementina]
 gb|ESR34543.1| hypothetical protein CICLE_v10005479mg [Citrus clementina]
Length=222

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  211

Query  361  YL  366
            ++
Sbjct  212  FM  213



>gb|KJB14838.1| hypothetical protein B456_002G146300 [Gossypium raimondii]
Length=222

 Score =   202 bits (514),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMG IHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGAIHAGD  211

Query  361  YL  366
            ++
Sbjct  212  FM  213



>gb|KJB14837.1| hypothetical protein B456_002G146300 [Gossypium raimondii]
Length=222

 Score =   202 bits (513),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMG IHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGAIHAGD  211

Query  361  YL  366
            ++
Sbjct  212  FM  213



>gb|KEH33477.1| transcription initiation factor IIB [Medicago truncatula]
Length=405

 Score =   207 bits (527),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QN   +PD  L+++F+ I  MA++L LV TIKDRA+EIYKR+EDQK ++GRN +AL+
Sbjct  87   GRWQNSSSNPDLGLIVSFQTIDIMAEKLGLVPTIKDRANEIYKRVEDQKSSKGRNQEALL  146

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEM-GESMEMGTIHAG  357
            AAC+YIACRQE KPRT+KEIC IANGATKKEI RAKE+IVKQL +E  G+S+EMG IH G
Sbjct  147  AACVYIACRQEDKPRTIKEICLIANGATKKEIVRAKEYIVKQLGLENGGQSIEMGIIHIG  206

Query  358  DYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            D++ RFCSNLGM+++ VKA  E+V  SEEFD
Sbjct  207  DFMGRFCSNLGMNHQAVKAATESVQNSEEFD  237



>gb|KJB14835.1| hypothetical protein B456_002G146300 [Gossypium raimondii]
Length=232

 Score =   201 bits (512),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMG IHAGD
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGAIHAGD  211

Query  361  YL  366
            ++
Sbjct  212  FM  213



>gb|KFK38412.1| hypothetical protein AALP_AA3G110000 [Arabis alpina]
Length=299

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 118/150 (79%), Gaps = 6/150 (4%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L+ AFK IA MADRL LVATIKDRA EIYKR+EDQK +RGRN DAL+
Sbjct  85   GRRQNRGSNPDRWLIGAFKTIATMADRLDLVATIKDRAKEIYKRVEDQKSSRGRNQDALL  144

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC++IACRQE KPRTV EICS+ANG T K+  RAK+ I KQL +E G+S+       GD
Sbjct  145  AACLFIACRQEEKPRTVIEICSVANGVTMKKFCRAKKHIDKQLGLETGQSV------PGD  198

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCS LGM+N+ VKA QE+V KSEEFD
Sbjct  199  FMRRFCSYLGMTNQTVKAAQESVKKSEEFD  228



>gb|KCW90140.1| hypothetical protein EUGRSUZ_A02331 [Eucalyptus grandis]
Length=226

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EI+K++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIFKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKEICS+ANGA+KKEIGRAKE+IVKQL +E G+S+EMG IHA D
Sbjct  152  AACLYIACRQEDKPRTVKEICSVANGASKKEIGRAKEYIVKQLGLEKGQSVEMGAIHAAD  211

Query  361  YL  366
            ++
Sbjct  212  FM  213



>ref|XP_008374507.1| PREDICTED: transcription initiation factor IIB-like [Malus domestica]
Length=319

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 116/155 (75%), Gaps = 8/155 (5%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRL------SLVATIKDRASEIYKRLEDQKCTRGR  162
             + Q R   P+R L+  F AIA MADR       +L++ + DRA+EIYK++EDQK  RGR
Sbjct  96   GKWQGRASKPBRHLLDIFGAIAVMADRFGFLALHALISLVVDRANEIYKKVEDQKPLRGR  155

Query  163  NLDALVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMG  342
            N DA+VAAC+YIACRQE KPRTVKEIC+  +GATKKEIGRAKEFI K L+ E+G   EMG
Sbjct  156  NQDAIVAACLYIACRQENKPRTVKEICTAVSGATKKEIGRAKEFIWKHLEAELG--XEMG  213

Query  343  TIHAGDYLRRFCSNLGMSNEEVKAVQETVXKSEEF  447
            TIHAGDYLRRFCSNLGM N +VKA QE V  +EE 
Sbjct  214  TIHAGDYLRRFCSNLGMKNRDVKAAQEMVQNTEEL  248



>ref|XP_006477530.1| PREDICTED: transcription initiation factor IIB-2-like [Citrus 
sinensis]
Length=201

 Score =   194 bits (493),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  100  IKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQEGKPRTVKEICSIANGATKKEIG  279
             KDRA+EIYK++EDQK  RGRN +A+VAAC+YIACRQE KPRTVKE CS+ANG TKKEIG
Sbjct  15   FKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIG  74

Query  280  RAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            RAKEFIVK L+ EMG+S+EMGTIHA DYLRRFCSNLGM+N+ VKA QE V KSE+ D
Sbjct  75   RAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLD  131



>gb|KDO76000.1| hypothetical protein CISIN_1g021438mg [Citrus sinensis]
Length=254

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             +LQ R   PDR L+ AFK+I+ M+DRL LV TIKDRA+EIYK++EDQK  RGRN +A+V
Sbjct  93   GKLQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIV  152

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+YIACRQE KPRTVKE CS+ANG TKKEIGRAKEFIVK L+ EMG+S+EMGTIHA D
Sbjct  153  AACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASD  212

Query  361  YLRRFCSNL  387
            YL  F  N+
Sbjct  213  YLVIFLLNI  221



>ref|XP_007028689.1| Cyclin-like family protein isoform 2, partial [Theobroma cacao]
 gb|EOY09191.1| Cyclin-like family protein isoform 2, partial [Theobroma cacao]
Length=248

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 108/150 (72%), Gaps = 29/150 (19%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK                 
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYK-----------------  134

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
                        KPRTVKEICS+ANGATKKEIGRAKE+IVKQL +E G+S+EMGTIHAGD
Sbjct  135  ------------KPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGD  182

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            ++RRFCSNLGM+N+ VKA QE V KSEEFD
Sbjct  183  FMRRFCSNLGMNNQAVKAAQEAVQKSEEFD  212



>ref|XP_008351835.1| PREDICTED: transcription initiation factor IIB-2-like [Malus 
domestica]
Length=314

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 108/134 (81%), Gaps = 5/134 (4%)
 Frame = +1

Query  49   AFKAIANMADR-LSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQEGKPR  225
            AFKA   +A R L LV TIKDRA+EIYK++EDQK  RGRN DA+VAAC+YIACRQE K R
Sbjct  114  AFKAF--LAFRMLGLVTTIKDRANEIYKKVEDQKPLRGRNQDAVVAACLYIACRQENKAR  171

Query  226  TVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLGMSNEE  405
            T+KEIC+  +GATKKEIGRAKEFI+K L+ E+G+  EMGTIHAGDYLRRFCSNLGM N +
Sbjct  172  TMKEICTAVSGATKKEIGRAKEFILKHLEAELGQ--EMGTIHAGDYLRRFCSNLGMKNRD  229

Query  406  VKAVQETVXKSEEF  447
            VKA QE V   EE 
Sbjct  230  VKAAQEMVQNIEEL  243



>ref|XP_001758790.1| predicted protein [Physcomitrella patens]
 gb|EDQ76296.1| predicted protein [Physcomitrella patens]
Length=312

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = +1

Query  28   PDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACR  207
            PD++ ++AF++I NMADRL LV+TIKDRA+EIYK + D K TR R+ +A++A+C+YIACR
Sbjct  99   PDQSRIIAFRSIGNMADRLGLVSTIKDRANEIYKNVVDLKLTRNRSHEAILASCLYIACR  158

Query  208  QEGKPRTVK-EICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSN  384
            QE KPRT K EICS++NGA+K + GR  + +VKQ++  MG SMEMGTIHAGD+ RRFCS+
Sbjct  159  QEDKPRTFKEEICSVSNGASKTDTGRITKKLVKQIEKGMGISMEMGTIHAGDFSRRFCSH  218

Query  385  LGMSNEEVKAVQETVXKSE  441
            L M   EV+A+ ETV KSE
Sbjct  219  LDMEKNEVRAITETVKKSE  237



>gb|KEH33482.1| transcription initiation factor IIB [Medicago truncatula]
Length=270

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 111/146 (76%), Gaps = 5/146 (3%)
 Frame = +1

Query  16   RGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIY  195
            R G P   L++    I  M ++L LV TIKDRA EIYK + +QK ++ RN DAL+AAC+Y
Sbjct  58   RVGGPSNPLLI----IDTMTEKLGLVPTIKDRAIEIYKLVANQKYSKARNQDALLAACLY  113

Query  196  IACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEM-GESMEMGTIHAGDYLRR  372
            IACRQE KP TVKEI SIA GATKKEIGRAK++I+KQL +E  G+S+EMGT H GD++ R
Sbjct  114  IACRQEDKPHTVKEISSIAIGATKKEIGRAKQYIMKQLALENGGQSVEMGTTHIGDFMGR  173

Query  373  FCSNLGMSNEEVKAVQETVXKSEEFD  450
            FCSNLGM+++ VKA  E+V  SEEFD
Sbjct  174  FCSNLGMNHQAVKAANESVQNSEEFD  199



>ref|XP_004961337.1| PREDICTED: transcription initiation factor IIB-like [Setaria 
italica]
Length=310

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 105/147 (71%), Gaps = 3/147 (2%)
 Frame = +1

Query  13   NRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQK-CTRGRNLDALVAAC  189
            N G DP+++LV AF+AI +MADRL LVATI+DRA ++YK++++ K C RG+  D   AAC
Sbjct  105  NTGPDPEQSLVEAFRAITDMADRLGLVATIRDRAKDVYKKMDEAKACPRGKKRDQFYAAC  164

Query  190  IYIACRQEGKPRTVKEICSIANGAT--KKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            +++ACR EGKPRT KE+ +  +G    KKE+GR    I K L  E G+ M++G +HA DY
Sbjct  165  LFVACRNEGKPRTYKELATATSGGATAKKEVGRMTTLIKKVLGEEAGQVMDIGVVHAADY  224

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEE  444
            +RRFCS LGM N+E++A QE   + ++
Sbjct  225  MRRFCSRLGMGNQEMRAAQEAARRLDD  251



>ref|XP_002440177.1| hypothetical protein SORBIDRAFT_09g027310 [Sorghum bicolor]
 gb|EES18607.1| hypothetical protein SORBIDRAFT_09g027310 [Sorghum bicolor]
Length=311

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 101/145 (70%), Gaps = 4/145 (3%)
 Frame = +1

Query  19   GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKC--TRGRNLDALVAACI  192
            G D ++ALV AF AIA+MADRL LV TI+DRA ++YKRL++ K   TRG+  D   AAC+
Sbjct  107  GADHEQALVDAFHAIADMADRLGLVGTIRDRAKDVYKRLDEAKACPTRGKKRDVFYAACL  166

Query  193  YIACRQEGKPRTVKEICSI--ANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYL  366
            Y+ACR EGKPRT KE+ ++  A  + KKEIG+    I K L  E G+ M++G + A DY+
Sbjct  167  YVACRNEGKPRTYKELATVTAAGASAKKEIGKMTTLIKKVLGEEAGQVMDIGVVRAADYM  226

Query  367  RRFCSNLGMSNEEVKAVQETVXKSE  441
            RRFCS LGM N+E++A QE   + E
Sbjct  227  RRFCSRLGMGNQEMRAAQEAARRLE  251



>ref|XP_008231004.1| PREDICTED: transcription initiation factor IIB [Prunus mume]
Length=285

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 111/149 (74%), Gaps = 6/149 (4%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            RL     +PD++L +AF+++  MADRL+LVATI+D A E+YK+ +++K  RGRN DA++A
Sbjct  68   RLHKTLRNPDKSLHIAFESLGVMADRLALVATIRDHAKEVYKKADNRKFCRGRNCDAIMA  127

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+++AC+++G PRT+KEI ++ANGA++KEI R KE + K L+V      +  T + GD 
Sbjct  128  ACLFLACQEKGFPRTLKEIATVANGASRKEINRMKELLKKVLEV------DSKTTNVGDL  181

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
             RR CS +GM+N+++KAV ET+ KSEE D
Sbjct  182  SRRCCSRIGMANQDMKAVLETLNKSEEVD  210



>ref|XP_004963621.1| PREDICTED: transcription initiation factor IIB-like [Setaria 
italica]
Length=309

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 105/150 (70%), Gaps = 4/150 (3%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQK-CTRGRNLDALV  180
            R+   G DP+++LV AF+AIA+MADRL LVATI+D A ++YK+L++ K C RG+  D   
Sbjct  100  RVNVGGADPEQSLVEAFQAIADMADRLGLVATIRDGAKDVYKKLDEAKACPRGKKRDVFY  159

Query  181  AACIYIACRQEGKPRTVKEICSI--ANGATKKEIGRAKEFIVKQLKVEMGES-MEMGTIH  351
            AAC+YIACR +GKPRT KE+ ++  A  + KKEIGR    I K L  E G+  +++G + 
Sbjct  160  AACLYIACRNDGKPRTYKELATVTRAGASAKKEIGRMTTLIKKVLGEEAGQQVLDIGVVS  219

Query  352  AGDYLRRFCSNLGMSNEEVKAVQETVXKSE  441
            A DYLRRFCS LGM N+E++A QE   + E
Sbjct  220  ATDYLRRFCSRLGMGNQEMRAAQEAARRLE  249



>ref|XP_011075610.1| PREDICTED: transcription initiation factor IIB [Sesamum indicum]
Length=290

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 95/124 (77%), Gaps = 8/124 (6%)
 Frame = +1

Query  16   RGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIY  195
            R  DPD+ L  AF  IA+MADRLSLVATIKDRA E+YK+L DQK TRG+ L+ L AACI+
Sbjct  90   RRPDPDKVL-FAFNIIADMADRLSLVATIKDRACEMYKKLHDQKSTRGKKLEILAAACIF  148

Query  196  IACRQEGKPRTVKEICSIANG------ATKKEIGRAKEFIVKQLKVEMGES-MEMGTIHA  354
            IACRQEGK RTVKEICSI NG      A  KE  RA EFI ++LKVEMG+S +EMGT +A
Sbjct  149  IACRQEGKSRTVKEICSIVNGGESINRAGMKEFNRAVEFIKEKLKVEMGKSFIEMGTANA  208

Query  355  GDYL  366
            GD+L
Sbjct  209  GDFL  212



>ref|XP_008393133.1| PREDICTED: transcription initiation factor IIB-like [Malus domestica]
Length=120

 Score =   145 bits (366),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 84/98 (86%), Gaps = 2/98 (2%)
 Frame = +1

Query  73   ADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQEGKPRTVKEICSIA  252
            A +L LV TIKDRA+EIYK++EDQK  RGRN DA+VAAC+YIACRQE K RT+KEIC+  
Sbjct  18   AQKLGLVTTIKDRANEIYKKVEDQKPLRGRNQDAVVAACLYIACRQENKARTMKEICTAV  77

Query  253  NGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYL  366
            +GATKKEIGRAKEFI+K L+ E+G+  EMGTIHAGDYL
Sbjct  78   SGATKKEIGRAKEFILKHLEAELGQ--EMGTIHAGDYL  113



>ref|XP_007216364.1| hypothetical protein PRUPE_ppa020830mg [Prunus persica]
 gb|EMJ17563.1| hypothetical protein PRUPE_ppa020830mg [Prunus persica]
Length=322

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 107/150 (71%), Gaps = 6/150 (4%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             RL     +PD++L +AF+ +  MADRL+LV  I+D A E+YK+ +D+K  RGRN DA++
Sbjct  104  PRLHKTLQNPDKSLHIAFETLGMMADRLALVTAIRDHAKELYKKADDRKFCRGRNCDAIM  163

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC+++AC+++G PRT+KEI  +ANGAT+KEI R KE + K L+V      +  T + GD
Sbjct  164  AACLFLACQEKGLPRTLKEIAMVANGATRKEINRMKELLKKILEV------DSKTTNVGD  217

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
              RR CS +GM+N+++KAV ET+ KS+E D
Sbjct  218  LSRRCCSMIGMANQDMKAVLETLNKSKEVD  247



>ref|XP_007216374.1| hypothetical protein PRUPE_ppa021805mg [Prunus persica]
 gb|EMJ17573.1| hypothetical protein PRUPE_ppa021805mg [Prunus persica]
Length=285

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            RL     +PD++L +AF+++  MAD L+LVATI+D A E+Y++ +++K  RGRN DA++A
Sbjct  68   RLHKTLRNPDKSLHIAFESLGVMADGLALVATIRDHAKELYEKADNRKFCRGRNCDAIMA  127

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+++AC+++G PRT+KEI ++ANGA++KEI R KE + K L+V      +  T + GD 
Sbjct  128  ACLFLACQEKGFPRTLKEISTVANGASRKEISRMKELLKKILEV------DSKTTNVGDL  181

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
             RR CS +GM+N+++KAV ET+ KSEE D
Sbjct  182  SRRCCSRIGMANQDMKAVLETLNKSEEVD  210



>ref|XP_008231005.1| PREDICTED: transcription initiation factor IIB-like [Prunus mume]
Length=322

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 107/149 (72%), Gaps = 6/149 (4%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            RL     +PD++L +AF+ +  MADRL+LV  I+D A E+YK+ +D+K  RGRN DA++A
Sbjct  105  RLHKTLRNPDKSLHVAFETLGMMADRLALVTAIRDHAKELYKKADDRKFCRGRNCDAIMA  164

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDY  363
            AC+++AC+++G PRT+KEI  +ANGAT+KEI R KE + K L+V      +  T + GD 
Sbjct  165  ACLFLACQEKGLPRTLKEIAMVANGATRKEINRMKELLKKILEV------DSKTTNVGDL  218

Query  364  LRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
             RR CS +GM+N+++KAV ET+ KS+E D
Sbjct  219  SRRCCSMIGMANQDMKAVLETLNKSKEVD  247



>ref|NP_001056225.1| Os05g0548200 [Oryza sativa Japonica Group]
 gb|AAW56898.1| putative transcription initiation factor TFIIB [Oryza sativa 
Japonica Group]
 dbj|BAF18139.1| Os05g0548200 [Oryza sativa Japonica Group]
 dbj|BAG98075.1| unnamed protein product [Oryza sativa Japonica Group]
Length=316

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 103/153 (67%), Gaps = 6/153 (4%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLED---QKCTRGRNLDA  174
            R+   G  P+ ALV AF+ IA+MADRL LVATI+DRA E++K+L +   +   RGRN DA
Sbjct  104  RVDVVGPSPENALVAAFRGIADMADRLGLVATIRDRAKEVFKKLGEAPTKGLPRGRNRDA  163

Query  175  LVAACIYIACRQEGKPRTVKEICSIA--NGATKKEIGRAKEFIVKQLKVEM-GESMEMGT  345
            + AAC++IACR EG PRT KE+ S+     A KKEIGR    I K L  +  G +M++G 
Sbjct  164  VYAACLFIACRNEGMPRTYKELASVTAEGAAAKKEIGRLTTLIKKHLGDQGEGRAMDIGV  223

Query  346  IHAGDYLRRFCSNLGMSNEEVKAVQETVXKSEE  444
            + + DYLRRFCS LG+ +++V+A  + V + EE
Sbjct  224  VRSTDYLRRFCSRLGLGHQDVRAAGDAVRRLEE  256



>ref|XP_008649960.1| PREDICTED: transcription initiation factor IIB-like [Zea mays]
 gb|AFW78988.1| hypothetical protein ZEAMMB73_349781 [Zea mays]
Length=311

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 4/145 (3%)
 Frame = +1

Query  19   GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRL-EDQKCT-RGRNLDALVAACI  192
            G   ++ LV  F AIA+MADRL LVATI+DRA ++YKRL E + C  RG+  DA  AAC+
Sbjct  107  GAGGEQTLVEGFHAIADMADRLGLVATIRDRAKDVYKRLGEARACPGRGKKRDAFYAACL  166

Query  193  YIACRQEGKPRTVKEICSIAN--GATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYL  366
            Y+ACR EGKPRT KE+ ++ +   A KKEIG+    I K L  E G+ M++G +   DY+
Sbjct  167  YVACRNEGKPRTYKELATVTSDGAAAKKEIGKMTMLIKKVLGEEAGQVMDIGVVRPSDYM  226

Query  367  RRFCSNLGMSNEEVKAVQETVXKSE  441
            RRFCS LGM N E++A QE   + E
Sbjct  227  RRFCSRLGMGNREMRAAQEAARRLE  251



>gb|EAY98907.1| hypothetical protein OsI_20862 [Oryza sativa Indica Group]
Length=319

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 102/152 (67%), Gaps = 5/152 (3%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLED--QKCTRGRNLDAL  177
            R+   G  P+ ALV AF+ IA+MADRL LVATI+DRA E++K+L +  +   RGRN D +
Sbjct  108  RVDVVGPSPENALVAAFRGIADMADRLGLVATIRDRAKEVFKKLGEAPKGFPRGRNRDTV  167

Query  178  VAACIYIACRQEGKPRTVKEICSIA--NGATKKEIGRAKEFIVKQLKVEM-GESMEMGTI  348
             AAC++IACR EG PRT KE+ S+     A KKEIGR    I K L  +  G +M++G +
Sbjct  168  YAACLFIACRNEGMPRTYKELASVTAEGAAAKKEIGRLTTLIKKHLGDQGEGRAMDIGVV  227

Query  349  HAGDYLRRFCSNLGMSNEEVKAVQETVXKSEE  444
             + DYLRRFCS LG+ +++V+A  + V + EE
Sbjct  228  RSTDYLRRFCSRLGLGHQDVRAAGDAVRRLEE  259



>gb|EMT16337.1| Transcription initiation factor IIB [Aegilops tauschii]
Length=317

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 99/149 (66%), Gaps = 3/149 (2%)
 Frame = +1

Query  7    LQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQK-CTRGRNLDALVA  183
            + + G   +  LV  F+ I++MADRL LVATI+D A E +K+L++ K C RGR  D++ A
Sbjct  110  VPDAGAASENTLVDGFRGISDMADRLGLVATIRDLAKETFKKLDEAKGCPRGRKRDSVYA  169

Query  184  ACIYIACRQEGKPRTVKEICSIANG--ATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAG  357
            AC+YIACR  G PRT KE+ S+  G  A KK++G+    I K L  E G+ M++G + A 
Sbjct  170  ACLYIACRNLGMPRTYKELASVTAGGVAAKKDVGKMTTHIKKLLGEEDGQVMDIGVVSAS  229

Query  358  DYLRRFCSNLGMSNEEVKAVQETVXKSEE  444
            DYLRRFCS LG+ N+EV+  QE V + EE
Sbjct  230  DYLRRFCSRLGLGNQEVRDAQEAVRRVEE  258



>ref|XP_003565964.1| PREDICTED: transcription initiation factor IIB-2-like [Brachypodium 
distachyon]
Length=338

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 102/149 (68%), Gaps = 5/149 (3%)
 Frame = +1

Query  19   GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQK-CTRG-RNLDALVAACI  192
            G  PD ALV AF+ IA+MADRL LVATI+D A + +KRLE+ K C RG R+ DA+ AAC+
Sbjct  117  GPAPDTALVDAFRGIADMADRLGLVATIRDSAKQTFKRLEEAKGCPRGARSRDAVYAACL  176

Query  193  YIACRQEGKPRTVKEICSIA--NGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYL  366
            Y+ACR+EG PRT KE+ S+     A +K+IG+    I K L  E G+ +++G + A  YL
Sbjct  177  YVACRKEGMPRTYKELASVTAQGAAARKDIGKMTTHIKKLLGEEDGQVLDIGVVRATSYL  236

Query  367  RRFCSNLGMSNEEVKAVQETVXKSE-EFD  450
            RRFCS LG+ N+++ A QE V + E E D
Sbjct  237  RRFCSILGLGNQQMLAAQEAVSRLEMELD  265



>dbj|BAK06351.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 94/138 (68%), Gaps = 3/138 (2%)
 Frame = +1

Query  40   LVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCT-RGRNLDALVAACIYIACRQEG  216
            LV  F+ IA+MADRL LVATI+D A E +K+L D K + RGR  DA+ AAC+YIACR  G
Sbjct  120  LVDGFRGIADMADRLGLVATIRDLAKETFKKLYDAKGSPRGRKRDAVYAACLYIACRNLG  179

Query  217  KPRTVKEICSIANGA--TKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLG  390
             PRT KE+ S+  G   +KK+IG+    I + L  E G+ M++G + A DYLRRFCS LG
Sbjct  180  MPRTYKELASVTAGGAESKKDIGKMTTHIKRLLGEEDGQVMDIGVVSASDYLRRFCSRLG  239

Query  391  MSNEEVKAVQETVXKSEE  444
            + N+EV+  QE V K EE
Sbjct  240  LGNQEVRDAQEAVRKVEE  257



>gb|AAN59779.1| Putative transcription initiation factor IIB [Oryza sativa Japonica 
Group]
 gb|ABF94430.1| Transcription factor TFIIB repeat family protein [Oryza sativa 
Japonica Group]
 gb|EAY88883.1| hypothetical protein OsI_10362 [Oryza sativa Indica Group]
Length=308

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 100/149 (67%), Gaps = 3/149 (2%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQK-CTRGRNLDALV  180
            R+ ++ G  D +L +AF+AI++MADRL LVATI+DRA E++K++E+ K C R RN DA  
Sbjct  101  RVDSKSGQ-DSSLAVAFRAISDMADRLQLVATIRDRAKELFKKMEEAKLCARVRNRDAAY  159

Query  181  AACIYIACRQEGKPRTVKEICSIA-NGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAG  357
            AAC++IACR EG PRT+KE+ S+  +   KKEIGR +  I + L  E G +MEMG + A 
Sbjct  160  AACLHIACRNEGNPRTLKELASVMRDCQDKKEIGRMERIIRRHLGEEAGTAMEMGVVRAA  219

Query  358  DYLRRFCSNLGMSNEEVKAVQETVXKSEE  444
            DY+ RF S LGM   EV+  Q      E+
Sbjct  220  DYMSRFGSRLGMGKPEVREAQRAAQTLED  248



>ref|XP_002511493.1| transcription initiation factor iib, putative [Ricinus communis]
 gb|EEF52095.1| transcription initiation factor iib, putative [Ricinus communis]
Length=89

 Score =   131 bits (330),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 2/90 (2%)
 Frame = +1

Query  133  LEDQK-CTRGRNLDALVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQL  309
            +EDQK    GRN DA+ AAC+YIACRQE KPRT KEICS+ NGATKKEIGRA+ FI+K L
Sbjct  1    MEDQKKPLEGRNQDAITAACLYIACRQENKPRTPKEICSVVNGATKKEIGRAEVFILKHL  60

Query  310  KVEMGESMEMGTIHAGDYLRRFCSNLGMSN  399
            +VEMG  +E GTIHA DYLRR CSNLG++N
Sbjct  61   EVEMGH-VEAGTIHAADYLRRVCSNLGLTN  89



>gb|KDP27236.1| hypothetical protein JCGZ_19935 [Jatropha curcas]
Length=321

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 97/142 (68%), Gaps = 7/142 (5%)
 Frame = +1

Query  25   DPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIAC  204
            +PD+ +   F+ IA MADRLS+V TIKDRA EIYK +  + C +G+ L A++ AC++IAC
Sbjct  107  NPDKDIAEGFEVIATMADRLSIVKTIKDRACEIYKDVLGKSC-KGKKLSAIMGACLFIAC  165

Query  205  RQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSN  384
            R+   PRT+KEICS  +G +KKEI RA E I K + V      E G ++  + +RRFCSN
Sbjct  166  RETKSPRTLKEICSAIDGVSKKEIVRAVETIRKLVDV------ESGILNTSELVRRFCSN  219

Query  385  LGMSNEEVKAVQETVXKSEEFD  450
            L M++  +KAVQE + KS+E D
Sbjct  220  LSMNSTAMKAVQEALEKSQEID  241



>ref|XP_006421302.1| hypothetical protein CICLE_v10005479mg [Citrus clementina]
 gb|ESR34542.1| hypothetical protein CICLE_v10005479mg [Citrus clementina]
 gb|KDO45913.1| hypothetical protein CISIN_1g025983mg [Citrus sinensis]
Length=172

 Score =   129 bits (323),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA M+DRL LVATIKDRA+EIYK++EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKKVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRTVK  234
            AAC+YIACRQE KPRTVK
Sbjct  152  AACLYIACRQEDKPRTVK  169



>gb|KFM69995.1| Transcription initiation factor IIB, partial [Stegodyphus mimosarum]
Length=210

 Score =   129 bits (324),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 92/140 (66%), Gaps = 7/140 (5%)
 Frame = +1

Query  31   DRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQ  210
            DR L+ AF+ I+NMADR++L  TI DRA+ ++K++ D K  +GR+ DA+ ++C+YIACRQ
Sbjct  5    DRTLINAFREISNMADRINLPKTIVDRANSLFKQVHDGKTLKGRSNDAIASSCVYIACRQ  64

Query  211  EGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLG  390
            EG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  GD++ RFCSNLG
Sbjct  65   EGVPRTFKEICAVSK-VSKKEIGRCFKLILKALET------SVDLITTGDFMSRFCSNLG  117

Query  391  MSNEEVKAVQETVXKSEEFD  450
            +     KA      K+ E D
Sbjct  118  LPTSVQKAATYIARKAVELD  137



>gb|EEE64578.1| hypothetical protein OsJ_19430 [Oryza sativa Japonica Group]
Length=287

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 93/136 (68%), Gaps = 6/136 (4%)
 Frame = +1

Query  55   KAIANMADRLSLVATIKDRASEIYKRLED---QKCTRGRNLDALVAACIYIACRQEGKPR  225
            K IA+MADRL LVATI+DRA E++K+L +   +   RGRN DA+ AAC++IACR EG PR
Sbjct  92   KGIADMADRLGLVATIRDRAKEVFKKLGEAPTKGLPRGRNRDAVYAACLFIACRNEGMPR  151

Query  226  TVKEICSIA--NGATKKEIGRAKEFIVKQLKVEM-GESMEMGTIHAGDYLRRFCSNLGMS  396
            T KE+ S+     A KKEIGR    I K L  +  G +M++G + + DYLRRFCS LG+ 
Sbjct  152  TYKELASVTAEGAAAKKEIGRLTTLIKKHLGDQGEGRAMDIGVVRSTDYLRRFCSRLGLG  211

Query  397  NEEVKAVQETVXKSEE  444
            +++V+A  + V + EE
Sbjct  212  HQDVRAAGDAVRRLEE  227



>ref|XP_006407583.1| hypothetical protein EUTSA_v100213350mg, partial [Eutrema salsugineum]
 gb|ESQ49036.1| hypothetical protein EUTSA_v100213350mg, partial [Eutrema salsugineum]
Length=167

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R QNRG +PDR L++AFK IA MADRL LVATIKDRA+EIYKR+EDQK +RGRN DAL+
Sbjct  92   GRWQNRGSNPDRGLIVAFKTIATMADRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALL  151

Query  181  AACIYIACRQEGKPRT  228
            AAC+YIACRQE KPRT
Sbjct  152  AACLYIACRQEDKPRT  167



>ref|XP_006649548.1| PREDICTED: transcription initiation factor IIB-2-like [Oryza 
brachyantha]
Length=313

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = +1

Query  31   DRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQK-CTRGRNLDALVAACIYIACR  207
            D AL+  F+AI++MADRL LV+TI+DRA+E+ K LE  K C RG++ D   AAC+ IACR
Sbjct  115  DNALLAGFRAISDMADRLGLVSTIRDRANELLKMLEGAKLCKRGQHRDTTYAACLNIACR  174

Query  208  QEGKPRTVKEICSIAN-GATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSN  384
             EGKPRT+KE+ S+   G  KKEIGR  + I   L  E G++ME+G + A DY+ RF S 
Sbjct  175  NEGKPRTLKELTSVMRAGYDKKEIGRMSKIIRTYLGEEAGQAMEVGVVCAADYMARFGSR  234

Query  385  LGMSNEEVKAVQ  420
            LG++  E++A Q
Sbjct  235  LGIAAAELRAAQ  246



>gb|EFX72645.1| hypothetical protein DAPPUDRAFT_325996 [Daphnia pulex]
Length=318

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            A+ QNR      DRALV AFK I+NMADR++L  TI DRA+ ++K++ D K  +GR+ DA
Sbjct  99   AKYQNRRTMSSSDRALVNAFKEISNMADRINLPRTIVDRANNLFKQVHDGKNLKGRSNDA  158

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YI+CRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  159  IASACLYISCRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET------SVDIITT  211

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
             D++ RFCSNLG+     +A      K+ E D
Sbjct  212  ADFMSRFCSNLGLPTMVQRAASHIARKAVELD  243



>gb|AEE63627.1| unknown [Dendroctonus ponderosae]
 gb|ENN73844.1| hypothetical protein YQE_09536, partial [Dendroctonus ponderosae]
 gb|ERL94911.1| hypothetical protein D910_12183 [Dendroctonus ponderosae]
Length=315

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            AR QNR      DRAL+ AFK I  MADR++L  TI DRA+ ++K++ D +  +GR+ DA
Sbjct  98   ARYQNRRTMNSSDRALINAFKEINAMADRINLPRTIVDRANNLFKQVHDGRNLKGRSNDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +K+EIGR  + I+K L+        +  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKREIGRCFKLILKALET------SVDLITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  211  GDFMSRFCSNLGLPNMVQRAATHIARKAVELD  242



>ref|XP_008199323.1| PREDICTED: transcription initiation factor IIB [Tribolium castaneum]
 gb|EFA03052.1| hypothetical protein TcasGA2_TC010900 [Tribolium castaneum]
Length=315

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNRG--GDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            AR QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D +  +GR+ DA
Sbjct  98   ARYQNRKTMSSSDRALINAFREINGMADRINLPRTIVDRANNLFKQVHDGRNLKGRSNDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +K+EIGR  + I+K L+        +  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKREIGRCFKLILKALET------SVDLITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  211  GDFMSRFCSNLGLPNMVQRAATHIARKAVELD  242



>ref|XP_011148503.1| PREDICTED: transcription initiation factor IIB [Harpegnathos 
saltator]
Length=315

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            A+ QNR      DRALV AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  98   AKYQNRRTMSSSDRALVNAFREINGMADRINLPKTIVDRANTLFKQVHDGKNLKGRANDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  211  GDFMSRFCSNLGLPNMVQRAATHIARKAVEID  242



>ref|XP_011161274.1| PREDICTED: transcription initiation factor IIB [Solenopsis invicta]
Length=315

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            A+ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  98   AKYQNRRTMSSSDRALLNAFREINGMADRINLPKTIVDRANALFKQVHDGKNLKGRANDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   KA      K+ E D
Sbjct  211  GDFMSRFCSNLGLPNMVQKAATHIARKAVEID  242



>ref|XP_002736287.1| PREDICTED: transcription initiation factor IIB-like [Saccoglossus 
kowalevskii]
Length=315

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 92/140 (66%), Gaps = 7/140 (5%)
 Frame = +1

Query  31   DRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQ  210
            DR L+ AF+ IA MADR++L  TI DR + ++K++ +Q+  RGR+ DA+ AAC+YIACRQ
Sbjct  110  DRTLLNAFREIAQMADRINLPKTIVDRTNTLFKQVHEQRTLRGRSNDAIAAACLYIACRQ  169

Query  211  EGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLG  390
            EG PRT KEIC+I+   +KKEIGR  + I+K L+        +  I  GD++ RFCSNLG
Sbjct  170  EGVPRTFKEICAISR-VSKKEIGRCFKEILKALET------SVDLITTGDFMSRFCSNLG  222

Query  391  MSNEEVKAVQETVXKSEEFD  450
            + +   KA      K+ E D
Sbjct  223  LPSRVQKAATHIAKKAVEMD  242



>gb|KDR15192.1| Transcription initiation factor IIB [Zootermopsis nevadensis]
Length=339

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRAL+ AF+ I +MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  122  SKYQNRRTMSSSDRALINAFREITSMADRINLPKTIVDRANNLFKQVHDGKNLKGRANDA  181

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  182  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET------SVDLITT  234

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  235  GDFMSRFCSNLGLPNMVQRAATHIARKAVELD  266



>ref|XP_005092831.1| PREDICTED: transcription initiation factor IIB-like isoform X2 
[Aplysia californica]
Length=316

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 95/140 (68%), Gaps = 7/140 (5%)
 Frame = +1

Query  31   DRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQ  210
            DRAL+ AF+ I  MADRL+L   + DRA+ ++K++ + K  +GR+ DA+V+AC+YIACRQ
Sbjct  111  DRALLTAFREIGQMADRLNLPKMLVDRANTLFKQVHESKTLKGRSNDAIVSACMYIACRQ  170

Query  211  EGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLG  390
            EG PRT KEIC+++   +KKEIGR  + I+K L+     ++E+  I  GD++ RFCSNLG
Sbjct  171  EGVPRTFKEICAVSK-ISKKEIGRVFKLILKNLET----NVEL--ITTGDFMSRFCSNLG  223

Query  391  MSNEEVKAVQETVXKSEEFD  450
            + +   KA      K+ E D
Sbjct  224  LPSSVQKAATHIARKAVEMD  243



>ref|XP_002324107.2| hypothetical protein POPTR_0017s12860g [Populus trichocarpa]
 gb|EEF04240.2| hypothetical protein POPTR_0017s12860g [Populus trichocarpa]
Length=318

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 96/150 (64%), Gaps = 5/150 (3%)
 Frame = +1

Query  1    ARLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALV  180
             R Q+   + DR L+  F  I  +A+RL LV  IKDRA EI+K++E+QK    R  D++ 
Sbjct  94   PRWQDGVSNSDRVLLQGFDIIEIIANRLGLVRPIKDRAKEIFKKIEEQKTCVMRKRDSIC  153

Query  181  AACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGD  360
            AAC++I+ R+   PRT+ EI S+  G TKKEI +A + I + +++E     +MGT++  +
Sbjct  154  AACLFISSRENKLPRTLNEISSVVYGVTKKEINKAVQSIKRHVELE-----DMGTLNPSE  208

Query  361  YLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
             +RRFCSNLGM N  VKAV E V K ++ D
Sbjct  209  LVRRFCSNLGMKNHAVKAVHEAVEKIQDVD  238



>gb|EFZ17278.1| hypothetical protein SINV_13223 [Solenopsis invicta]
Length=321

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            A+ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  93   AKYQNRRTMSSSDRALLNAFREINGMADRINLPKTIVDRANALFKQVHDGKNLKGRANDA  152

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  153  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  205

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   KA      K+ E D
Sbjct  206  GDFMSRFCSNLGLPNMVQKAATHIARKAVEID  237



>ref|XP_005092830.1| PREDICTED: transcription initiation factor IIB-like isoform X1 
[Aplysia californica]
Length=323

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 95/140 (68%), Gaps = 7/140 (5%)
 Frame = +1

Query  31   DRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQ  210
            DRAL+ AF+ I  MADRL+L   + DRA+ ++K++ + K  +GR+ DA+V+AC+YIACRQ
Sbjct  118  DRALLTAFREIGQMADRLNLPKMLVDRANTLFKQVHESKTLKGRSNDAIVSACMYIACRQ  177

Query  211  EGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLG  390
            EG PRT KEIC+++   +KKEIGR  + I+K L+     ++E+  I  GD++ RFCSNLG
Sbjct  178  EGVPRTFKEICAVSK-ISKKEIGRVFKLILKNLET----NVEL--ITTGDFMSRFCSNLG  230

Query  391  MSNEEVKAVQETVXKSEEFD  450
            + +   KA      K+ E D
Sbjct  231  LPSSVQKAATHIARKAVEMD  250



>ref|XP_009811555.1| PREDICTED: transcription initiation factor IIB, partial [Gavia 
stellata]
Length=274

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA+V AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  57   SKYQNRRTMSSSDRAMVNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  116

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  117  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  169

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  170  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  201



>gb|KFV54425.1| Transcription initiation factor IIB, partial [Gavia stellata]
Length=275

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA+V AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  58   SKYQNRRTMSSSDRAMVNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  117

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  118  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  170

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  171  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  202



>gb|EFN78510.1| Transcription initiation factor IIB [Harpegnathos saltator]
Length=373

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            A+ QNR      DRALV AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  156  AKYQNRRTMSSSDRALVNAFREINGMADRINLPKTIVDRANTLFKQVHDGKNLKGRANDA  215

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  216  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  268

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  269  GDFMSRFCSNLGLPNMVQRAATHIARKAVEID  300



>gb|KFQ84502.1| Transcription initiation factor IIB, partial [Phoenicopterus 
ruber ruber]
Length=238

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  21   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  80

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  81   IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  133

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  134  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  165



>gb|KFP59335.1| Transcription initiation factor IIB, partial [Cathartes aura]
Length=231

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  14   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  73

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  74   IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  126

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  127  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  158



>ref|XP_002593734.1| hypothetical protein BRAFLDRAFT_117242 [Branchiostoma floridae]
 gb|EEN49745.1| hypothetical protein BRAFLDRAFT_117242 [Branchiostoma floridae]
Length=319

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 93/140 (66%), Gaps = 7/140 (5%)
 Frame = +1

Query  31   DRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQ  210
            DRALV AF+ I  MADR++L   I DR   ++K++ DQK  +GR+ DA+ AAC+YIACRQ
Sbjct  114  DRALVNAFREITGMADRINLPRNIVDRTQMLFKQVNDQKSLKGRSNDAISAACLYIACRQ  173

Query  211  EGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLG  390
            EG PRT KEIC+I+   +KKEIGR  + I+K L+     S+E+  I  GD++ RFCSNL 
Sbjct  174  EGVPRTFKEICAISR-VSKKEIGRVFKLILKALET----SVEL--ITTGDFMSRFCSNLN  226

Query  391  MSNEEVKAVQETVXKSEEFD  450
            + ++  +A      K+ E D
Sbjct  227  LPSQVQRAATHIARKAVELD  246



>ref|XP_006398877.1| hypothetical protein EUTSA_v10015304mg [Eutrema salsugineum]
 gb|ESQ40330.1| hypothetical protein EUTSA_v10015304mg [Eutrema salsugineum]
Length=187

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 81/116 (70%), Gaps = 9/116 (8%)
 Frame = +1

Query  115  SEIYKRLE--DQKCTRGRNLDALVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAK  288
            S IY  ++   +K +RGRN DAL+AAC+YIAC QE KPRTVK I       +  +  RA 
Sbjct  35   SSIYIDIQGFHEKSSRGRNQDALLAACLYIACLQEDKPRTVKNI-----HHSLLQWHRAS  89

Query  289  EFI--VKQLKVEMGESMEMGTIHAGDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
              +   KQL +E G+S+EMGTIHAGD +RRFCSNL MSN+ VKA QE+V KSE+FD
Sbjct  90   NTLDLSKQLGLETGQSVEMGTIHAGDLMRRFCSNLAMSNQTVKAAQESVQKSEDFD  145



>gb|EMT14827.1| Transcription initiation factor IIB [Aegilops tauschii]
Length=393

 Score =   128 bits (321),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = +1

Query  49   AFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQEGKPRT  228
            A   IA+MADRL +V  IK +A+ +Y +  D K    R   +L AAC+YIACRQ  K RT
Sbjct  191  AIHYIADMADRLGIVDNIKLQATNLYMKANDLKIFNIRKKHSLCAACLYIACRQANKART  250

Query  229  VKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLGMSNEEV  408
            +KEIC++ NG TKKE+ RAK+ +V  +  + GE ME+ ++   D +RRFCS LGMSN+ +
Sbjct  251  IKEICTVTNGVTKKEVSRAKDLLVHHIVEKKGECMEISSVRPRDLVRRFCSTLGMSNKAI  310

Query  409  KAVQETVXKSEEFD  450
            +A +E   + +  D
Sbjct  311  QAAEEAANRVQRLD  324



>ref|XP_011257314.1| PREDICTED: transcription initiation factor IIB [Camponotus floridanus]
 gb|EFN67722.1| Transcription initiation factor IIB [Camponotus floridanus]
Length=315

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNRG--GDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            A+ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  98   AKYQNRRTLSSSDRALLNAFREINGMADRINLPKTIVDRANTLFKQVHDGKNLKGRANDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  211  GDFMSRFCSNLGLPNMVQRAATHIARKAVEID  242



>ref|XP_003693523.1| PREDICTED: transcription initiation factor IIB-like [Apis florea]
 ref|XP_006569642.1| PREDICTED: transcription initiation factor IIB isoform X2 [Apis 
mellifera]
 ref|XP_006624603.1| PREDICTED: transcription initiation factor IIB-like isoform X2 
[Apis dorsata]
Length=315

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  98   SKYQNRRTMSSSDRALINAFREINGMADRINLPKTIVDRANNLFKQVHDGKNLKGRANDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  211  GDFMSRFCSNLGLPNMVQRAATHIARKAVEID  242



>ref|XP_003491660.1| PREDICTED: transcription initiation factor IIB-like [Bombus impatiens]
Length=315

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  98   SKYQNRRTMSSSDRALINAFREINGMADRINLPKTIVDRANNLFKQVHDGKNLKGRANDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  211  GDFMSRFCSNLGLPNMVQRAATHIARKAVEID  242



>ref|XP_003706629.1| PREDICTED: transcription initiation factor IIB-like [Megachile 
rotundata]
Length=315

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  98   SKYQNRRTMSSSDRALINAFREINGMADRINLPKTIVDRANNLFKQVHDGKNLKGRANDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  211  GDFMSRFCSNLGLPNMVQRAATHIARKAVEID  242



>ref|XP_009920151.1| PREDICTED: transcription initiation factor IIB, partial [Haliaeetus 
albicilla]
Length=282

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  65   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  124

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  125  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  177

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  178  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  209



>ref|XP_011335845.1| PREDICTED: transcription initiation factor IIB isoform X1 [Cerapachys 
biroi]
 gb|EZA56488.1| Transcription initiation factor IIB [Cerapachys biroi]
Length=315

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            A+ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  98   AKYQNRRTMSSSDRALLNAFREINAMADRINLPKTIVDRANTLFKQVHDGKNLKGRANDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET------SVDLITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  211  GDFMSRFCSNLGLPNMVQRAATHIARKAVEID  242



>ref|XP_011335846.1| PREDICTED: transcription initiation factor IIB isoform X2 [Cerapachys 
biroi]
Length=313

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            A+ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  96   AKYQNRRTMSSSDRALLNAFREINAMADRINLPKTIVDRANTLFKQVHDGKNLKGRANDA  155

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  156  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET------SVDLITT  208

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  209  GDFMSRFCSNLGLPNMVQRAATHIARKAVEID  240



>ref|XP_010158695.1| PREDICTED: transcription initiation factor IIB, partial [Eurypyga 
helias]
Length=274

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  57   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  116

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  117  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  169

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  170  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  201



>ref|XP_010580894.1| PREDICTED: transcription initiation factor IIB isoform X3 [Haliaeetus 
leucocephalus]
Length=280

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  63   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  122

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  123  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  175

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  176  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  207



>gb|KFV98743.1| Transcription initiation factor IIB, partial [Eurypyga helias]
Length=275

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  58   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  117

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  118  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  170

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  171  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  202



>ref|XP_006569641.1| PREDICTED: transcription initiation factor IIB isoform X1 [Apis 
mellifera]
Length=343

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  126  SKYQNRRTMSSSDRALINAFREINGMADRINLPKTIVDRANNLFKQVHDGKNLKGRANDA  185

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  186  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET------SVDLITT  238

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  239  GDFMSRFCSNLGLPNMVQRAATHIARKAVEID  270



>ref|XP_006624602.1| PREDICTED: transcription initiation factor IIB-like isoform X1 
[Apis dorsata]
Length=343

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  126  SKYQNRRTMSSSDRALINAFREINGMADRINLPKTIVDRANNLFKQVHDGKNLKGRANDA  185

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  186  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET------SVDLITT  238

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  239  GDFMSRFCSNLGLPNMVQRAATHIARKAVEID  270



>ref|XP_008937318.1| PREDICTED: transcription initiation factor IIB, partial [Merops 
nubicus]
 ref|XP_009476560.1| PREDICTED: transcription initiation factor IIB, partial [Pelecanus 
crispus]
Length=274

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  57   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  116

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  117  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  169

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  170  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  201



>gb|KFQ06428.1| Transcription initiation factor IIB, partial [Haliaeetus albicilla]
 gb|KFQ16835.1| Transcription initiation factor IIB, partial [Merops nubicus]
 gb|KFQ59015.1| Transcription initiation factor IIB, partial [Pelecanus crispus]
Length=275

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  58   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  117

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  118  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  170

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  171  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  202



>ref|XP_007509965.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19080.1| predicted protein [Bathycoccus prasinos]
Length=396

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 88/139 (63%), Gaps = 9/139 (6%)
 Frame = +1

Query  4    RLQNRGGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVA  183
            RL NR G+PD+ L+ AF  I +MADR+++  TIK  A E+YK +     T+G++  A+ A
Sbjct  103  RLHNREGNPDKVLMAAFSQIGDMADRMAMNQTIKSGACELYKVVTSSHSTQGKSSVAMFA  162

Query  184  ACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVK-----QLKVEMGESMEMGTI  348
            AC+YIACRQEGK RT KEIC  A G+T KEIGR   FI++      L+++M E M    I
Sbjct  163  ACLYIACRQEGKTRTFKEICGAAVGSTVKEIGRCYRFIIRVCEGLDLQMQMNEQM----I  218

Query  349  HAGDYLRRFCSNLGMSNEE  405
                   RFC NLG++N E
Sbjct  219  TPELLTNRFCGNLGLANSE  237



>ref|XP_004176261.1| PREDICTED: transcription initiation factor IIB isoform 2 [Taeniopygia 
guttata]
 ref|XP_009086812.1| PREDICTED: transcription initiation factor IIB isoform X2 [Serinus 
canaria]
 ref|XP_010407373.1| PREDICTED: transcription initiation factor IIB isoform X3 [Corvus 
cornix cornix]
Length=285

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  68   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  127

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  128  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  180

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  181  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  212



>ref|XP_004929188.1| PREDICTED: transcription initiation factor IIB-like [Bombyx mori]
Length=315

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 95/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNRG--GDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  98   SKYQNRRNISSTDRALINAFREINTMADRINLPKTIVDRANNLFKQVHDGKNLKGRANDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET------SVDLITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
             D++ RFCSNLG+ N   +A      K+ E D
Sbjct  211  ADFMSRFCSNLGLPNSVQRAATHIARKAGELD  242



>ref|XP_010222676.1| PREDICTED: transcription initiation factor IIB [Tinamus guttatus]
 ref|XP_010580891.1| PREDICTED: transcription initiation factor IIB isoform X2 [Haliaeetus 
leucocephalus]
 ref|XP_010580893.1| PREDICTED: transcription initiation factor IIB isoform X2 [Haliaeetus 
leucocephalus]
Length=285

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  68   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  127

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  128  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  180

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  181  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  212



>ref|XP_011053895.1| PREDICTED: transcription initiation factor IIB [Acromyrmex echinatior]
Length=315

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 98/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            A+ QNR      DR L+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  98   AKYQNRRTMSSSDRTLLNAFREINGMADRINLPKTIVDRANTLFKQVHDGKNLKGRANDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  211  GDFMSRFCSNLGLPNMVQRAATHIARKAVEID  242



>ref|XP_011498835.1| PREDICTED: transcription initiation factor IIB isoform X1 [Ceratosolen 
solmsi marchali]
Length=315

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 98/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DR LV AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  98   SKYQNRRTMSSSDRTLVNAFREINAMADRINLPKTIVDRANNLFKQVHDGKNLKGRANDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  211  GDFMSRFCSNLGLPNMVQRAATHIARKAVELD  242



>ref|XP_011498836.1| PREDICTED: transcription initiation factor IIB isoform X2 [Ceratosolen 
solmsi marchali]
Length=311

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 95/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DR LV AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  94   SKYQNRRTMSSSDRTLVNAFREINAMADRINLPKTIVDRANNLFKQVHDGKNLKGRANDA  153

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  154  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET------SVDLITT  206

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ E D
Sbjct  207  GDFMSRFCSNLGLPNMVQRAATHIARKAVELD  238



>ref|NP_001016277.1| general transcription factor 2B [Xenopus (Silurana) tropicalis]
 emb|CAJ83945.1| general transcription factor IIBgeneral transcription factor 
IIB [Xenopus (Silurana) tropicalis]
Length=316

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 92/140 (66%), Gaps = 7/140 (5%)
 Frame = +1

Query  31   DRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQ  210
            DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA+ +AC+YIACRQ
Sbjct  111  DRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDAIASACLYIACRQ  170

Query  211  EGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLG  390
            EG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  GD++ RFCSNLG
Sbjct  171  EGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------NVDLITTGDFMSRFCSNLG  223

Query  391  MSNEEVKAVQETVXKSEEFD  450
            ++ +   A      K+ E D
Sbjct  224  LTKQVQMAATHIARKAVELD  243



>ref|XP_008489064.1| PREDICTED: transcription initiation factor IIB [Calypte anna]
 ref|XP_008489066.1| PREDICTED: transcription initiation factor IIB [Calypte anna]
Length=316

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  99   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  158

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  159  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  211

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  212  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  243



>ref|XP_008628722.1| PREDICTED: transcription initiation factor IIB [Corvus brachyrhynchos]
Length=320

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  103  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  162

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  163  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  215

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  216  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  247



>ref|XP_010407372.1| PREDICTED: transcription initiation factor IIB isoform X2 [Corvus 
cornix cornix]
Length=312

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  95   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  154

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  155  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  207

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  208  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  239



>ref|XP_422356.3| PREDICTED: transcription initiation factor IIB isoform X3 [Gallus 
gallus]
Length=316

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  99   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  158

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  159  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  211

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  212  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  243



>ref|XP_010714257.1| PREDICTED: transcription initiation factor IIB [Meleagris gallopavo]
Length=313

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  96   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  155

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  156  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  208

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  209  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  240



>gb|KFO56585.1| Transcription initiation factor IIB, partial [Corvus brachyrhynchos]
 gb|KFW79314.1| Transcription initiation factor IIB, partial [Manacus vitellinus]
Length=310

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  93   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  152

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  153  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  205

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  206  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  237



>ref|XP_005146585.1| PREDICTED: transcription initiation factor IIB [Melopsittacus 
undulatus]
 ref|XP_009898645.1| PREDICTED: transcription initiation factor IIB [Picoides pubescens]
 ref|XP_010580890.1| PREDICTED: transcription initiation factor IIB isoform X1 [Haliaeetus 
leucocephalus]
Length=316

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  99   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  158

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  159  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  211

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  212  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  243



>ref|XP_002195495.1| PREDICTED: transcription initiation factor IIB isoform 1 [Taeniopygia 
guttata]
 ref|XP_005050375.1| PREDICTED: transcription initiation factor IIB isoform X2 [Ficedula 
albicollis]
 ref|XP_005482169.1| PREDICTED: transcription initiation factor IIB isoform X2 [Zonotrichia 
albicollis]
 ref|XP_005521056.1| PREDICTED: transcription initiation factor IIB [Pseudopodoces 
humilis]
 ref|XP_009086811.1| PREDICTED: transcription initiation factor IIB isoform X1 [Serinus 
canaria]
Length=316

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  99   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  158

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  159  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  211

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  212  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  243



>ref|XP_006032379.1| PREDICTED: transcription initiation factor IIB [Alligator sinensis]
 ref|XP_006276430.1| PREDICTED: transcription initiation factor IIB [Alligator mississippiensis]
Length=316

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  99   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  158

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  159  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  211

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  212  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  243



>gb|KFM00694.1| Transcription initiation factor IIB, partial [Aptenodytes forsteri]
Length=310

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  93   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  152

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  153  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  205

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  206  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  237



>ref|XP_009510300.1| PREDICTED: transcription initiation factor IIB, partial [Phalacrocorax 
carbo]
 ref|XP_009581537.1| PREDICTED: transcription initiation factor IIB, partial [Fulmarus 
glacialis]
 ref|XP_009696035.1| PREDICTED: transcription initiation factor IIB, partial [Cariama 
cristata]
 ref|XP_009947297.1| PREDICTED: transcription initiation factor IIB, partial [Leptosomus 
discolor]
 ref|XP_010012918.1| PREDICTED: transcription initiation factor IIB, partial [Nestor 
notabilis]
 ref|XP_009962647.1| PREDICTED: transcription initiation factor IIB, partial [Tyto 
alba]
 ref|XP_010176313.1| PREDICTED: transcription initiation factor IIB, partial [Caprimulgus 
carolinensis]
 ref|XP_010073501.1| PREDICTED: transcription initiation factor IIB, partial [Pterocles 
gutturalis]
 ref|XP_010179512.1| PREDICTED: transcription initiation factor IIB, partial [Mesitornis 
unicolor]
 ref|XP_010115328.1| PREDICTED: transcription initiation factor IIB, partial [Chlamydotis 
macqueenii]
 ref|XP_010201935.1| PREDICTED: transcription initiation factor IIB, partial [Colius 
striatus]
 ref|XP_010284705.1| PREDICTED: transcription initiation factor IIB, partial [Phaethon 
lepturus]
 ref|XP_010311447.1| PREDICTED: transcription initiation factor IIB, partial [Balearica 
regulorum gibbericeps]
 gb|EOA94519.1| Transcription initiation factor IIB, partial [Anas platyrhynchos]
 gb|KFO08188.1| Transcription initiation factor IIB, partial [Balearica regulorum 
gibbericeps]
 gb|KFP12834.1| Transcription initiation factor IIB, partial [Egretta garzetta]
 gb|KFP32427.1| Transcription initiation factor IIB, partial [Colius striatus]
 gb|KFP40347.1| Transcription initiation factor IIB, partial [Chlamydotis macqueenii]
 gb|KFP60813.1| Transcription initiation factor IIB, partial [Cariama cristata]
 gb|KFP81894.1| Transcription initiation factor IIB, partial [Apaloderma vittatum]
 gb|KFQ09193.1| Transcription initiation factor IIB, partial [Leptosomus discolor]
 gb|KFQ32593.1| Transcription initiation factor IIB, partial [Mesitornis unicolor]
 gb|KFQ42547.1| Transcription initiation factor IIB, partial [Nestor notabilis]
 gb|KFQ74302.1| Transcription initiation factor IIB, partial [Phaethon lepturus]
 gb|KFR00368.1| Transcription initiation factor IIB, partial [Nipponia nippon]
 gb|KFR03743.1| Transcription initiation factor IIB, partial [Opisthocomus hoazin]
 gb|KFU96414.1| Transcription initiation factor IIB, partial [Chaetura pelagica]
 gb|KFV08401.1| Transcription initiation factor IIB, partial [Pterocles gutturalis]
 gb|KFV18977.1| Transcription initiation factor IIB, partial [Tauraco erythrolophus]
 gb|KFV47830.1| Transcription initiation factor IIB, partial [Tyto alba]
 gb|KFV67284.1| Transcription initiation factor IIB, partial [Picoides pubescens]
 gb|KFV85237.1| Transcription initiation factor IIB, partial [Struthio camelus 
australis]
 gb|KFW09822.1| Transcription initiation factor IIB, partial [Fulmarus glacialis]
 gb|KFW62189.1| Transcription initiation factor IIB, partial [Pygoscelis adeliae]
 gb|KFW78572.1| Transcription initiation factor IIB, partial [Phalacrocorax carbo]
 gb|KFZ52383.1| Transcription initiation factor IIB, partial [Caprimulgus carolinensis]
 gb|KFZ67667.1| Transcription initiation factor IIB, partial [Podiceps cristatus]
 gb|KGL83946.1| Transcription initiation factor IIB, partial [Tinamus guttatus]
 gb|KGL93088.1| Transcription initiation factor IIB, partial [Charadrius vociferus]
Length=310

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  93   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  152

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  153  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  205

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  206  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  237



>gb|EMC78935.1| Transcription initiation factor IIB [Columba livia]
Length=318

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  101  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  160

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  161  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  213

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  214  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  245



>ref|XP_006651126.1| PREDICTED: transcription initiation factor IIB-2-like [Oryza 
brachyantha]
Length=253

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 93/138 (67%), Gaps = 4/138 (3%)
 Frame = +1

Query  19   GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQK-CTRGRNLDALVAACIY  195
            G   D  L+  F AI++MADRL++ +TI+DRA E++K+LE  K C RG++ D   AAC+ 
Sbjct  49   GSGQDNTLLAGFLAISDMADRLAIGSTIRDRAKELFKKLEGAKLCKRGQHRDTTYAACLD  108

Query  196  IACRQEGKPRTVKEICS-IANGATKKEIGRAKEFIVKQLKVEMGESMEM--GTIHAGDYL  366
            IACR +GKPRT+KE+ S I+ G  KKEI R  + I   L  E G++MEM  G + A DY+
Sbjct  109  IACRNQGKPRTLKELASVISAGHDKKEIRRMSKIIRTYLGEEAGQAMEMEVGVVCAADYM  168

Query  367  RRFCSNLGMSNEEVKAVQ  420
             RF S LG++  EV+AVQ
Sbjct  169  VRFSSQLGIAAAEVRAVQ  186



>ref|XP_004936696.1| PREDICTED: transcription initiation factor IIB isoform X4 [Gallus 
gallus]
Length=312

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  95   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  154

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  155  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  207

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  208  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  239



>ref|XP_005029322.1| PREDICTED: transcription initiation factor IIB [Anas platyrhynchos]
Length=316

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  99   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  158

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  159  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  211

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  212  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  243



>gb|KFO69604.1| Transcription initiation factor IIB, partial [Cuculus canorus]
Length=316

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  99   SKYQNRRTMSSSDRAMLNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  158

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  159  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  211

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  212  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  243



>ref|XP_005422178.1| PREDICTED: transcription initiation factor IIB [Geospiza fortis]
Length=312

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  95   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  154

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  155  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  207

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  208  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  239



>gb|KFO89034.1| Transcription initiation factor IIB, partial [Buceros rhinoceros 
silvestris]
Length=309

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  92   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  151

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  152  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  204

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  205  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  236



>ref|XP_009986098.1| PREDICTED: transcription initiation factor IIB [Tauraco erythrolophus]
Length=325

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  108  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  167

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  168  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  220

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  221  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  252



>ref|XP_004306077.1| PREDICTED: transcription initiation factor IIB-2 [Fragaria vesca 
subsp. vesca]
Length=322

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 94/142 (66%), Gaps = 6/142 (4%)
 Frame = +1

Query  25   DPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIAC  204
            +PDR L  AF AI++ A  L L+ T+  RA +IYK  +D+K  +GR  +AL  AC+++AC
Sbjct  115  NPDRTLTQAFGAISSKASMLGLMNTVVSRAQQIYKEADDKKFCKGRKDEALTTACLFLAC  174

Query  205  RQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSN  384
            ++EG PRT+KEI ++ NGA+KKEI + KE + K L++      +   IHA D  RR CS 
Sbjct  175  QEEGFPRTLKEIATVGNGASKKEINKMKEQLKKVLEI------DSKIIHAEDLTRRSCSL  228

Query  385  LGMSNEEVKAVQETVXKSEEFD  450
            +GM +  +KAV ET+ K +EFD
Sbjct  229  IGMKHLGMKAVNETLDKLKEFD  250



>ref|XP_009633395.1| PREDICTED: transcription initiation factor IIB [Egretta garzetta]
Length=317

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  100  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  159

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  160  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  212

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  213  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  244



>gb|KFO98637.1| Transcription initiation factor IIB, partial [Calypte anna]
Length=310

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  93   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  152

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  153  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  205

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  206  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  237



>ref|XP_010133310.1| PREDICTED: transcription initiation factor IIB, partial [Buceros 
rhinoceros silvestris]
Length=310

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  93   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  152

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  153  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  205

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  206  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  237



>ref|XP_009554842.1| PREDICTED: transcription initiation factor IIB [Cuculus canorus]
Length=312

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  95   SKYQNRRTMSSSDRAMLNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  154

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  155  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  207

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  208  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  239



>ref|XP_009332156.1| PREDICTED: transcription initiation factor IIB, partial [Pygoscelis 
adeliae]
Length=315

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  98   SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  211  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  242



>ref|XP_005482168.1| PREDICTED: transcription initiation factor IIB isoform X1 [Zonotrichia 
albicollis]
Length=323

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  106  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  165

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  166  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  218

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  219  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  250



>ref|XP_005050374.1| PREDICTED: transcription initiation factor IIB isoform X1 [Ficedula 
albicollis]
 ref|XP_010407371.1| PREDICTED: transcription initiation factor IIB isoform X1 [Corvus 
cornix cornix]
Length=323

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  106  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  165

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  166  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  218

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  219  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  250



>ref|XP_005499022.1| PREDICTED: transcription initiation factor IIB [Columba livia]
Length=337

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  120  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  179

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  180  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  232

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  233  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  264



>gb|EHJ75466.1| hypothetical protein KGM_17256 [Danaus plexippus]
Length=285

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 98/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNRG--GDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRAL+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA
Sbjct  68   SKYQNRRNISSTDRALINAFREINTMADRINLPKTIVDRANNLFKQVHDGKNLKGRANDA  127

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  128  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  180

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
             D++ RFC+NLG+ N   +A      K+ E D
Sbjct  181  ADFMSRFCANLGLPNSVQRAATHIARKAGELD  212



>ref|XP_009883190.1| PREDICTED: transcription initiation factor IIB [Charadrius vociferus]
Length=335

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  118  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  177

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  178  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  230

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  231  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  262



>ref|XP_005238585.1| PREDICTED: transcription initiation factor IIB [Falco peregrinus]
 ref|XP_005445620.1| PREDICTED: transcription initiation factor IIB [Falco cherrug]
Length=327

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  110  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  169

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  170  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  222

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  223  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  254



>ref|XP_009943273.1| PREDICTED: transcription initiation factor IIB [Opisthocomus 
hoazin]
Length=348

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  131  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  190

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  191  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  243

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  244  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  275



>ref|XP_009680860.1| PREDICTED: transcription initiation factor IIB isoform X1 [Struthio 
camelus australis]
Length=361

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  144  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  203

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  204  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  256

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  257  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  288



>ref|XP_003220155.1| PREDICTED: transcription initiation factor IIB [Anolis carolinensis]
Length=316

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK IA+MADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  99   SKYQNRRTMSSSDRAMMNAFKEIASMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  158

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  159  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  211

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  212  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  243



>gb|EGI65813.1| Transcription initiation factor IIB [Acromyrmex echinatior]
Length=308

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 7/140 (5%)
 Frame = +1

Query  31   DRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQ  210
            DR L+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR  DA+ +AC+YIACRQ
Sbjct  103  DRTLLNAFREINGMADRINLPKTIVDRANTLFKQVHDGKNLKGRANDAIASACLYIACRQ  162

Query  211  EGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLG  390
            EG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  GD++ RFCSNLG
Sbjct  163  EGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET------SVDLITTGDFMSRFCSNLG  215

Query  391  MSNEEVKAVQETVXKSEEFD  450
            + N   +A      K+ E D
Sbjct  216  LPNMVQRAATHIARKAVEID  235



>ref|NP_001081115.1| transcription initiation factor IIB [Xenopus laevis]
 sp|P29054.1|TF2B_XENLA RecName: Full=Transcription initiation factor IIB; AltName: Full=General 
transcription factor TFIIB [Xenopus laevis]
 emb|CAA44668.1| TFIIB [Xenopus laevis]
 gb|AAH77495.1| Gtf2b-A protein [Xenopus laevis]
Length=316

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NM+DR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  99   SKYQNRRTMSSSDRAMMNAFKEITNMSDRINLPRNIIDRTNNLFKQVYEQKSLKGRSNDA  158

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  159  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------NVDLITT  211

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG++ +   A      K+ E D
Sbjct  212  GDFMSRFCSNLGLTKQVQMAATHIARKAVELD  243



>ref|XP_009680861.1| PREDICTED: transcription initiation factor IIB isoform X2 [Struthio 
camelus australis]
Length=355

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  138  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  197

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  198  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  250

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  251  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  282



>ref|XP_008481393.1| PREDICTED: transcription initiation factor IIB [Diaphorina citri]
Length=317

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRAL+ A + I +MADR++L  TI DRA+ ++K++ D K  +GR+ DA
Sbjct  100  SKYQNRRTMNSSDRALLNAIREINSMADRINLTKTIVDRANNLFKQVHDGKNLKGRSNDA  159

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  160  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET------SVDLITT  212

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNL + N   KA      K+ E D
Sbjct  213  GDFMSRFCSNLSLPNMVQKAATHIARKAVELD  244



>ref|XP_007423700.1| PREDICTED: transcription initiation factor IIB [Python bivittatus]
Length=316

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 92/140 (66%), Gaps = 7/140 (5%)
 Frame = +1

Query  31   DRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQ  210
            DRA++ AFK IA+MADR++L   I DR + ++K++ +QK  +GR+ DA+ +AC+YIACRQ
Sbjct  111  DRAMMNAFKEIASMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDAIASACLYIACRQ  170

Query  211  EGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLG  390
            EG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  GD++ RFCSNLG
Sbjct  171  EGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITTGDFMSRFCSNLG  223

Query  391  MSNEEVKAVQETVXKSEEFD  450
            +  +   A      K+ E D
Sbjct  224  LPKQVQMAATHIARKAVELD  243



>ref|XP_009874640.1| PREDICTED: transcription initiation factor IIB [Apaloderma vittatum]
Length=372

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  155  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  214

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  215  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  267

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  268  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  299



>ref|XP_005298167.1| PREDICTED: transcription initiation factor IIB [Chrysemys picta 
bellii]
Length=316

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AF+ I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  99   SKYQNRRTMSSSDRAMMNAFREITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  158

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+        +  I  
Sbjct  159  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET------SVDLITT  211

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  212  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  243



>ref|XP_001607291.1| PREDICTED: transcription initiation factor IIB [Nasonia vitripennis]
Length=315

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DR L+ AF+ I  MADR++L  TI DRA+ ++K++ D K  +GR+ DA
Sbjct  98   SKYQNRRTMNSSDRTLINAFREINAMADRINLPRTIVDRANNLFKQVHDGKNLKGRSNDA  157

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  158  IASACLYIACRQEGVPRTFKEICAVSK-ISKKEIGRCFKLILKALET----SVDL--ITT  210

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+ N   +A      K+ + D
Sbjct  211  GDFMSRFCSNLGLPNMVQRAATHIARKAVDID  242



>ref|XP_002129417.1| PREDICTED: transcription initiation factor IIB-like [Ciona intestinalis]
Length=314

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 86/121 (71%), Gaps = 7/121 (6%)
 Frame = +1

Query  31   DRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDALVAACIYIACRQ  210
            DR L+ AF+ I++MADR+SL   I DR+++++K++ D K  RGR  DA+ AAC+YIACRQ
Sbjct  109  DRVLIHAFREISSMADRISLPKNIVDRSNKLFKQVYDSKSLRGRANDAISAACLYIACRQ  168

Query  211  EGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHAGDYLRRFCSNLG  390
            EG PRT KEIC+I+   +KKEIGR+ + IVK L+        +  I +GD++ RFCSNL 
Sbjct  169  EGVPRTFKEICAISR-ISKKEIGRSFKLIVKNLET------NVEVITSGDFMSRFCSNLN  221

Query  391  M  393
            +
Sbjct  222  L  222



>ref|XP_008920209.1| PREDICTED: transcription initiation factor IIB [Manacus vitellinus]
Length=370

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 99/152 (65%), Gaps = 9/152 (6%)
 Frame = +1

Query  1    ARLQNR--GGDPDRALVMAFKAIANMADRLSLVATIKDRASEIYKRLEDQKCTRGRNLDA  174
            ++ QNR      DRA++ AFK I NMADR++L   I DR + ++K++ +QK  +GR+ DA
Sbjct  153  SKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDA  212

Query  175  LVAACIYIACRQEGKPRTVKEICSIANGATKKEIGRAKEFIVKQLKVEMGESMEMGTIHA  354
            + +AC+YIACRQEG PRT KEIC+++   +KKEIGR  + I+K L+     S+++  I  
Sbjct  213  IASACLYIACRQEGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET----SVDL--ITT  265

Query  355  GDYLRRFCSNLGMSNEEVKAVQETVXKSEEFD  450
            GD++ RFCSNLG+  +   A      K+ E D
Sbjct  266  GDFMSRFCSNLGLPKQVQMAATHIARKAVELD  297



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370