BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G15

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABP35528.1|  cyclophilin                                             291   1e-97   Ipomoea batatas [batate]
ref|NP_001275605.1|  peptidyl-prolyl cis-trans isomerase-like           275   5e-91   Solanum tuberosum [potatoes]
ref|XP_004289844.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    275   7e-91   Fragaria vesca subsp. vesca
ref|XP_003522746.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    274   9e-91   Glycine max [soybeans]
ref|XP_011074689.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     273   2e-90   Sesamum indicum [beniseed]
gb|ABK34279.1|  cyclophilin                                             273   4e-90   Solanum sogarandinum
ref|XP_002313736.1|  peptidyl-prolyl cis-trans isomerase family p...    273   5e-90   Populus trichocarpa [western balsam poplar]
ref|XP_011029022.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     272   6e-90   Populus euphratica
gb|ACF48822.1|  cyclophilin                                             272   7e-90   Gossypium hirsutum [American cotton]
ref|XP_011088559.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    272   7e-90   Sesamum indicum [beniseed]
gb|AFK43730.1|  unknown                                                 272   8e-90   Lotus japonicus
ref|NP_001234488.1|  peptidyl-prolyl cis-trans isomerase                272   9e-90   Solanum lycopersicum
gb|KJB12159.1|  hypothetical protein B456_002G003800                    271   2e-89   Gossypium raimondii
ref|XP_009590739.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    271   2e-89   Nicotiana tomentosiformis
ref|XP_011046718.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    271   2e-89   Populus euphratica
ref|XP_009346636.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    271   2e-89   Pyrus x bretschneideri [bai li]
gb|EYU37917.1|  hypothetical protein MIMGU_mgv1a014959mg                271   3e-89   Erythranthe guttata [common monkey flower]
dbj|BAQ21277.1|  cyclophilin                                            270   3e-89   Citrus tamurana
ref|WP_039311101.1|  peptidylprolyl isomerase                           270   3e-89   Paenibacillus sp. IHB B 3415
ref|XP_004248678.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    270   3e-89   Solanum lycopersicum
ref|XP_009759250.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     270   4e-89   Nicotiana sylvestris
ref|XP_008236203.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     270   4e-89   Prunus mume [ume]
ref|XP_010516536.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    270   5e-89   Camelina sativa [gold-of-pleasure]
ref|NP_001276071.1|  uncharacterized protein LOC102623101               270   5e-89   Citrus sinensis [apfelsine]
sp|Q39613.1|CYPH_CATRO  RecName: Full=Peptidyl-prolyl cis-trans i...    270   5e-89   Catharanthus roseus [chatas]
pdb|4JJM|A  Chain A, Structure Of A Cyclophilin From Citrus Sinen...    270   5e-89   Citrus sinensis [apfelsine]
pdb|2MC9|A  Chain A, Cat R 1                                            270   6e-89   Catharanthus roseus [chatas]
gb|ABK96333.1|  unknown                                                 270   7e-89   Populus trichocarpa x Populus deltoides
ref|XP_006367332.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    270   7e-89   Solanum tuberosum [potatoes]
ref|NP_001238688.1|  uncharacterized protein LOC100527355               269   1e-88   
ref|XP_007201241.1|  hypothetical protein PRUPE_ppa012332mg             269   1e-88   
ref|XP_011037275.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    268   2e-88   Populus euphratica
gb|ADG34846.1|  cyclophilin                                             268   2e-88   Vanda hybrid cultivar
gb|AEF01110.1|  cyclophilin 2                                           268   2e-88   Tagetes patula [French marigold]
gb|ABK96400.1|  unknown                                                 268   2e-88   Populus trichocarpa x Populus deltoides
ref|XP_009610666.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     268   2e-88   Nicotiana tomentosiformis
ref|XP_009377655.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     268   2e-88   
ref|XP_002301975.1|  Peptidyl-prolyl cis-trans isomerase family p...    268   2e-88   Populus trichocarpa [western balsam poplar]
gb|AFO67220.1|  putative cyclophilin                                    268   2e-88   Aralia elata
gb|EPS65110.1|  peptidyl-prolyl cis-trans isomerase                     268   2e-88   Genlisea aurea
gb|AAB51386.1|  stress responsive cyclophilin                           268   2e-88   Solanum commersonii
ref|XP_010467390.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    268   2e-88   Camelina sativa [gold-of-pleasure]
gb|ABL67655.1|  putative cyclophilin                                    268   2e-88   (Citrus unshiu x Citrus sinensis) x Citrus reticulata
gb|AEV66153.1|  cyclophilin                                             268   2e-88   Arachis hypogaea [goober]
ref|XP_011083569.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    268   3e-88   Sesamum indicum [beniseed]
ref|XP_008364692.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    268   3e-88   
ref|XP_002510543.1|  cyclophilin, putative                              268   3e-88   Ricinus communis
gb|KJB47605.1|  hypothetical protein B456_008G034100                    268   4e-88   Gossypium raimondii
ref|XP_008372880.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    268   4e-88   
ref|XP_008447986.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     268   4e-88   Cucumis melo [Oriental melon]
ref|XP_009788636.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     268   5e-88   Nicotiana sylvestris
ref|XP_006298687.1|  hypothetical protein CARUB_v10014779mg             267   6e-88   Capsella rubella
gb|ACT63839.1|  cydophilin                                              267   7e-88   Gossypium hirsutum [American cotton]
ref|XP_003631573.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     267   7e-88   Vitis vinifera
gb|KJB77728.1|  hypothetical protein B456_012G153200                    267   1e-87   Gossypium raimondii
ref|XP_010066256.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     266   1e-87   Eucalyptus grandis [rose gum]
gb|AGS78046.1|  cyclophilin 1                                           266   1e-87   Aeschynomene sensitiva
ref|XP_011092880.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    266   2e-87   Sesamum indicum [beniseed]
ref|XP_010526905.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     266   2e-87   Tarenaya hassleriana [spider flower]
gb|ABZ88806.1|  cyclophilin                                             266   2e-87   Hevea brasiliensis [jebe]
dbj|BAB82452.1|  CYP1                                                   266   2e-87   Vigna radiata [mung bean]
ref|XP_002305488.1|  Peptidyl-prolyl cis-trans isomerase family p...    266   2e-87   Populus trichocarpa [western balsam poplar]
gb|ABV26711.1|  cyclophilin                                             266   2e-87   Gerbera hybrid cultivar
gb|AGS78047.1|  cyclophilin 1                                           266   3e-87   Aeschynomene sp. CPI104040
gb|AGL08208.1|  cyclophilin                                             265   3e-87   Arachis hypogaea [goober]
gb|KDP36915.1|  hypothetical protein JCGZ_08206                         265   4e-87   Jatropha curcas
ref|XP_007131600.1|  hypothetical protein PHAVU_011G026900g             265   4e-87   Phaseolus vulgaris [French bean]
ref|XP_010447022.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     265   4e-87   Camelina sativa [gold-of-pleasure]
sp|Q8W171.1|CYP1_SOYBN  RecName: Full=Peptidyl-prolyl cis-trans i...    265   4e-87   Glycine max [soybeans]
emb|CBJ93268.1|  cyclophilin                                            265   4e-87   Vigna mungo [urad dal]
ref|XP_004505696.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    265   5e-87   
ref|XP_010530785.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    265   6e-87   Tarenaya hassleriana [spider flower]
ref|XP_010090292.1|  Peptidyl-prolyl cis-trans isomerase                265   7e-87   Morus notabilis
ref|XP_004500742.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    265   9e-87   Cicer arietinum [garbanzo]
ref|XP_002884009.1|  hypothetical protein ARALYDRAFT_899976             264   9e-87   Arabidopsis lyrata subsp. lyrata
gb|KDP27580.1|  hypothetical protein JCGZ_19585                         264   9e-87   Jatropha curcas
ref|XP_003607272.1|  Peptidyl-prolyl cis-trans isomerase                264   9e-87   Medicago truncatula
gb|ABY57946.1|  cyclophilin                                             264   9e-87   Arachis diogoi
ref|XP_007041920.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    264   9e-87   Theobroma cacao [chocolate]
gb|AGS78042.1|  cyclophilin 1                                           264   1e-86   Aeschynomene indica
gb|AGS78044.1|  cyclophilin 1                                           264   1e-86   Aeschynomene scabra
gb|AEY79726.1|  cyclophilin                                             264   1e-86   Daucus carota [carrots]
emb|CAA52414.1|  cyclophilin                                            264   1e-86   Phaseolus vulgaris [French bean]
gb|ACB05668.1|  cyclophilin                                             264   1e-86   Capsicum annuum
ref|XP_003537761.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    263   2e-86   
emb|CAC84116.1|  peptidylprolyl isomerase (cyclophilin)                 263   2e-86   Betula pendula [white birch]
gb|EYU40419.1|  hypothetical protein MIMGU_mgv1a014991mg                263   3e-86   Erythranthe guttata [common monkey flower]
gb|AAN72439.1|  cyclophilin                                             263   3e-86   Kandelia candel
gb|AIX10768.1|  cyclophilin                                             263   3e-86   Panax notoginseng [san-qi]
ref|XP_011045074.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    263   3e-86   Populus euphratica
gb|AFP44118.1|  cyclophilin                                             263   4e-86   Lycoris longituba
gb|ADV04050.1|  cyclophilin                                             263   4e-86   Hevea brasiliensis [jebe]
gb|AEM44784.1|  cyclophilin                                             263   4e-86   Momordica charantia [balsam pear]
dbj|BAA25755.1|  vcCyP                                                  263   4e-86   Vicia faba [broad bean]
gb|AGS78049.1|  cyclophilin 1                                           262   5e-86   Aeschynomene tambacoundensis
ref|XP_010548088.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    262   5e-86   Tarenaya hassleriana [spider flower]
emb|CDP07390.1|  unnamed protein product                                262   6e-86   Coffea canephora [robusta coffee]
gb|AGS78048.1|  cyclophilin 1                                           262   6e-86   Aeschynomene filosa
gb|ABK21176.1|  unknown                                                 262   7e-86   Picea sitchensis
gb|ABQ14358.1|  putative cyclophilin                                    262   8e-86   Pinus taeda
gb|AFY13527.1|  cyclophilin 1                                           261   9e-86   Aeschynomene evenia
gb|AFY13525.1|  cyclophilin 1                                           261   1e-85   Aeschynomene evenia
ref|XP_010432371.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    261   1e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010268679.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     261   1e-85   Nelumbo nucifera [Indian lotus]
sp|O49886.1|CYPH_LUPLU  RecName: Full=Peptidyl-prolyl cis-trans i...    261   1e-85   Lupinus luteus
gb|AFY13519.1|  cyclophilin 1                                           261   2e-85   Aeschynomene evenia
ref|XP_006409418.1|  hypothetical protein EUTSA_v10022880mg             261   2e-85   Eutrema salsugineum [saltwater cress]
gb|AGS78040.1|  cyclophilin 1                                           261   2e-85   Aeschynomene indica
ref|XP_010489230.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    260   3e-85   Camelina sativa [gold-of-pleasure]
gb|ACU14413.1|  unknown                                                 260   3e-85   Glycine max [soybeans]
gb|AGS78043.1|  cyclophilin 1                                           260   4e-85   Aeschynomene indica
ref|NP_179251.1|  cyclophilin ROC3                                      260   4e-85   
gb|AGS78050.1|  cyclophilin 1                                           260   4e-85   Aeschynomene deamii
gb|AAU87301.1|  cyclophilin                                             260   4e-85   Pinus halepensis [Aleppo pine]
gb|AIZ74330.1|  cyclophilin                                             260   4e-85   Pinus massoniana [Chinese red pine]
ref|XP_002274869.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     260   4e-85   Vitis vinifera
ref|XP_006487422.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    260   4e-85   Citrus sinensis [apfelsine]
gb|ABK26198.1|  unknown                                                 259   6e-85   Picea sitchensis
gb|AGC95053.1|  cyclophilin 1                                           259   7e-85   Aeschynomene ciliata
gb|AGS78045.1|  cyclophilin 1                                           259   8e-85   Aeschynomene rudis
emb|CAA69622.1|  cyclophylin                                            259   1e-84   Digitalis lanata [Grecian foxglove]
ref|XP_010941286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    259   1e-84   Elaeis guineensis
ref|XP_006412177.1|  hypothetical protein EUTSA_v10027585mg             259   2e-84   
ref|XP_009112393.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     258   2e-84   Brassica rapa
ref|XP_010437558.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     258   2e-84   Camelina sativa [gold-of-pleasure]
gb|ACV88654.1|  cyclophilin                                             258   2e-84   Pinus massoniana [Chinese red pine]
dbj|BAE92296.1|  putative peptidyl-prolyl cis-trans isomerase           258   2e-84   Cryptomeria japonica
emb|CAC81066.1|  putative cyclosporin A-binding protein                 258   2e-84   Picea abies
emb|CDY26779.1|  BnaC09g09060D                                          258   4e-84   Brassica napus [oilseed rape]
ref|XP_002306932.1|  Peptidyl-prolyl cis-trans isomerase family p...    257   7e-84   Populus trichocarpa [western balsam poplar]
ref|XP_006286099.1|  hypothetical protein CARUB_v10007642mg             257   7e-84   Capsella rubella
gb|AGT16090.1|  cyclophilin                                             256   9e-84   Saccharum hybrid cultivar R570
ref|XP_010061075.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    256   9e-84   Eucalyptus grandis [rose gum]
ref|XP_010062044.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    256   9e-84   Eucalyptus grandis [rose gum]
gb|AAO63777.1|  cyclophilin                                             256   1e-83   Populus tremuloides
gb|KFK30119.1|  hypothetical protein AALP_AA7G219300                    256   1e-83   Arabis alpina [alpine rockcress]
gb|ACT53879.1|  cyclophilin                                             256   1e-83   Saccharum officinarum [noble cane]
ref|XP_008799420.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     256   2e-83   Phoenix dactylifera
ref|XP_003604030.1|  Peptidyl-prolyl cis-trans isomerase                256   2e-83   Medicago truncatula
ref|XP_007136181.1|  hypothetical protein PHAVU_009G025000g             255   2e-83   Phaseolus vulgaris [French bean]
gb|AAQ87931.1|  Bet v 7-like protein                                    255   3e-83   Curvularia lunata
ref|XP_004952611.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    255   3e-83   Setaria italica
gb|AAT98376.1|  peptidyl-prolyl cis-trans isomerase                     255   3e-83   Populus trichocarpa [western balsam poplar]
ref|XP_002451412.1|  hypothetical protein SORBIDRAFT_04g001740          255   3e-83   Sorghum bicolor [broomcorn]
sp|P24525.2|CYPH_BRANA  RecName: Full=Peptidyl-prolyl cis-trans i...    255   5e-83   Brassica napus [oilseed rape]
gb|ABQ59098.1|  cyclophilin ABH-like protein                            254   5e-83   Panax ginseng [Asiatic ginseng]
ref|XP_002869121.1|  hypothetical protein ARALYDRAFT_491169             254   6e-83   
ref|XP_010233732.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     254   6e-83   Brachypodium distachyon [annual false brome]
emb|CAA69598.1|  cyclophilin                                            254   8e-83   Digitalis lanata [Grecian foxglove]
ref|XP_003139210.1|  cyclophilin Ovcyp-2                                254   9e-83   Loa loa
ref|XP_010429007.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    254   1e-82   Camelina sativa [gold-of-pleasure]
ref|NP_195213.1|  rotamase cyclophilin 5                                254   1e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868859.1|  hypothetical protein ARALYDRAFT_490638             253   1e-82   
ref|XP_010531511.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    253   2e-82   Tarenaya hassleriana [spider flower]
ref|NP_001289049.1|  peptidyl-prolyl cis-trans isomerase CYP18-3        253   2e-82   Brassica rapa
ref|XP_006404551.1|  hypothetical protein EUTSA_v10000350mg             253   2e-82   Eutrema salsugineum [saltwater cress]
gb|AAC47233.1|  cyclophilin Ovcyp-2                                     253   2e-82   Onchocerca volvulus
gb|AAB71402.1|  cyclophilin                                             253   3e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179709.1|  peptidyl-prolyl cis-trans isomerase CYP19-2           253   3e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008678672.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    252   4e-82   Zea mays [maize]
ref|XP_010104463.1|  Peptidyl-prolyl cis-trans isomerase                252   5e-82   Morus notabilis
ref|XP_006411664.1|  hypothetical protein EUTSA_v10026397mg             252   5e-82   Eutrema salsugineum [saltwater cress]
ref|XP_008028418.1|  hypothetical protein SETTUDRAFT_164317             252   6e-82   Exserohilum turcica Et28A
ref|XP_008645736.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     252   6e-82   Zea mays [maize]
ref|XP_001941476.1|  peptidyl-prolyl cis-trans isomerase                252   7e-82   Pyrenophora tritici-repentis Pt-1C-BFP
gb|AAA62706.1|  cyclophilin                                             251   8e-82   Brassica napus [oilseed rape]
ref|XP_009412893.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     251   9e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_195585.1|  peptidyl-prolyl cis-trans isomerase CYP1              251   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30470.1|  hypothetical protein AALP_AA7G265300                    251   1e-81   Arabis alpina [alpine rockcress]
gb|AAK49427.1|AF262983_1  cyclophilin A-2                               251   2e-81   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006282738.1|  hypothetical protein CARUB_v10005879mg             250   2e-81   Capsella rubella
pdb|4HY7|A  Chain A, Structural And Biochemical Characterization ...    250   3e-81   Triticum aestivum [Canadian hard winter wheat]
gb|AAS01735.1|  putative cyclophilin                                    249   3e-81   Populus tremula x Populus alba [gray poplar]
ref|XP_010446391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    250   3e-81   Camelina sativa [gold-of-pleasure]
ref|XP_002880359.1|  peptidyl-prolyl cis-trans isomerase                250   3e-81   
ref|XP_007701371.1|  hypothetical protein COCSADRAFT_92320              250   4e-81   Bipolaris sorokiniana ND90Pr
ref|XP_002452188.1|  hypothetical protein SORBIDRAFT_04g021380          250   4e-81   Sorghum bicolor [broomcorn]
gb|ABI14282.1|  cyclophilin-like protein                                249   5e-81   Pfiesteria piscicida
pdb|4E1Q|A  Chain A, Crystal Structure Of Wheat Cyclophilin A At ...    251   6e-81   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007692567.1|  hypothetical protein COCMIDRAFT_30232              249   6e-81   Bipolaris oryzae ATCC 44560
ref|XP_007714724.1|  hypothetical protein COCCADRAFT_102503             249   8e-81   Bipolaris zeicola 26-R-13
ref|XP_010472091.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   9e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009391979.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   9e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010436974.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010431822.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    249   1e-80   Camelina sativa [gold-of-pleasure]
gb|ACG31960.1|  peptidyl-prolyl cis-trans isomerase                     249   1e-80   Zea mays [maize]
gb|KHN80348.1|  Peptidyl-prolyl cis-trans isomerase 3                   248   2e-80   Toxocara canis
ref|XP_008779401.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    248   2e-80   Phoenix dactylifera
ref|XP_005851021.1|  hypothetical protein CHLNCDRAFT_29941              248   3e-80   Chlorella variabilis
ref|XP_002963528.1|  hypothetical protein SELMODRAFT_165790             248   3e-80   Selaginella moellendorffii
ref|XP_008788379.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    248   3e-80   Phoenix dactylifera
emb|CDX72741.1|  BnaC07g47630D                                          248   3e-80   
gb|ABI18377.1|  cyclophilin                                             248   3e-80   Steinernema carpocapsae
ref|XP_001802932.1|  hypothetical protein SNOG_12712                    247   5e-80   Parastagonospora nodorum SN15
sp|P21569.1|CYPH_MAIZE  RecName: Full=Peptidyl-prolyl cis-trans i...    247   6e-80   Zea mays [maize]
ref|XP_006442714.1|  hypothetical protein CICLE_v10022535mg             247   7e-80   Citrus clementina [clementine]
ref|XP_006487732.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    246   9e-80   Citrus sinensis [apfelsine]
gb|EMD94092.1|  hypothetical protein COCHEDRAFT_1201904                 246   9e-80   Bipolaris maydis C5
gb|ABV22152.1|  cyclophilin                                             246   1e-79   Perkinsus chesapeaki
gb|ABU56008.1|  cyclophilin 3                                           246   1e-79   Dasypyrum villosum
ref|XP_010419253.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    246   1e-79   Camelina sativa [gold-of-pleasure]
gb|ACG70968.1|  cyclophilin                                             246   1e-79   Ziziphus jujuba [Chinese jujube]
ref|XP_003295671.1|  hypothetical protein PTT_02276                     246   2e-79   
gb|KJB77727.1|  hypothetical protein B456_012G153100                    246   2e-79   Gossypium raimondii
gb|ABU56006.1|  cyclophilin 1                                           246   2e-79   Dasypyrum villosum
gb|ABU56007.1|  cyclophilin 2                                           245   2e-79   Dasypyrum villosum
ref|XP_008788633.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    245   2e-79   
ref|XP_009101932.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    245   3e-79   Brassica rapa
ref|XP_006295960.1|  hypothetical protein CARUB_v10025110mg             245   4e-79   Capsella rubella
ref|NP_001267698.1|  peptidyl-prolyl cis-trans isomerase 1-like         244   4e-79   Cucumis sativus [cucumbers]
ref|XP_002521961.1|  cyclophilin, putative                              244   4e-79   
ref|XP_008915854.1|  peptidyl-prolyl cis-trans isomerase                244   5e-79   Phytophthora parasitica INRA-310
gb|ABS85544.1|  cyclophilin                                             244   5e-79   Triticum aestivum [Canadian hard winter wheat]
ref|WP_014393514.1|  peptidylprolyl isomerase                           244   6e-79   Corallococcus coralloides
gb|AHV84998.1|  peptidylprolyl isomerase                                244   7e-79   Brassica rapa
ref|XP_010940596.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    244   8e-79   Elaeis guineensis
ref|XP_010920189.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    244   8e-79   Elaeis guineensis
ref|XP_007159996.1|  hypothetical protein PHAVU_002G284200g             244   8e-79   Phaseolus vulgaris [French bean]
ref|XP_009520427.1|  hypothetical protein PHYSODRAFT_285045             244   1e-78   Phytophthora sojae
ref|XP_001902628.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    243   1e-78   Brugia malayi [agent of lymphatic filariasis]
gb|AAF65770.1|AF242312_1  cyclophilin                                   243   1e-78   Euphorbia esula [wolf's milk]
gb|AEF01109.1|  cyclophilin 1                                           243   2e-78   Tagetes patula [French marigold]
pdb|4JCP|A  Chain A, Structure Of Cyclophilin B From Brugia Malayi      243   2e-78   Brugia malayi [agent of lymphatic filariasis]
gb|ACX47902.1|  cyclophilin                                             243   2e-78   Gnathostoma spinigerum
ref|XP_004302078.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    243   2e-78   Fragaria vesca subsp. vesca
gb|AES82695.2|  peptidyl-prolyl cis-trans isomerase                     243   2e-78   Medicago truncatula
ref|XP_003626477.1|  Peptidyl-prolyl cis-trans isomerase                243   2e-78   
gb|AGH55662.1|  cyclophilin                                             242   2e-78   Atropa belladonna [deadly nightshade]
gb|AAV48823.1|  cyclophilin 1                                           243   3e-78   Codonopsis lanceolata
gb|AEP37836.1|  cyclophilin a                                           242   3e-78   Plasmopara viticola
gb|ERG84468.1|  peptidyl-prolyl cis-trans isomerase 3                   242   4e-78   
gb|AFK44397.1|  unknown                                                 242   4e-78   Lotus japonicus
ref|XP_002905297.1|  peptidyl-prolyl cis-trans isomerase                242   5e-78   Phytophthora infestans T30-4
ref|XP_011036276.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    242   5e-78   Populus euphratica
ref|XP_006577322.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    242   5e-78   Glycine max [soybeans]
ref|XP_009372142.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    242   5e-78   Pyrus x bretschneideri [bai li]
ref|XP_010934181.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     242   6e-78   Elaeis guineensis
ref|XP_008370733.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    242   6e-78   Malus domestica [apple tree]
ref|XP_002638373.1|  C. briggsae CBR-CYN-3 protein                      241   7e-78   Caenorhabditis briggsae
ref|NP_506749.1|  Protein CYN-7                                         241   7e-78   Caenorhabditis elegans [roundworm]
ref|XP_003834284.1|  similar to peptidyl-prolyl cis-trans isomerase     241   9e-78   Leptosphaeria maculans JN3
ref|XP_004296656.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   1e-77   Fragaria vesca subsp. vesca
ref|XP_002788075.1|  cyclophilin 1, putative                            241   1e-77   Perkinsus marinus ATCC 50983
gb|AGI78541.1|  cyclophilin                                             241   1e-77   Suaeda salsa
ref|XP_010043280.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   1e-77   Eucalyptus grandis [rose gum]
gb|EJW85904.1|  cyclophilin-type peptidyl-prolyl cis-trans isomer...    241   1e-77   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|AAC47232.1|  cyclophilin Dicyp-2                                     241   1e-77   Dirofilaria immitis [canine heartworm nematode]
ref|XP_010660113.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   1e-77   Vitis vinifera
ref|XP_003142324.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    241   2e-77   Loa loa
ref|XP_006388902.1|  peptidyl-prolyl cis-trans isomerase family p...    241   2e-77   Populus trichocarpa [western balsam poplar]
gb|AAC47125.1|  cyclophilin                                             240   2e-77   Caenorhabditis elegans [roundworm]
ref|XP_010043281.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    240   2e-77   
ref|XP_010694773.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    240   3e-77   Beta vulgaris subsp. vulgaris [field beet]
gb|AAC05639.1|  cyclophilin 1                                           240   3e-77   Chlamydomonas reinhardtii
ref|XP_010274820.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    240   3e-77   Nelumbo nucifera [Indian lotus]
ref|XP_001700372.1|  peptidyl-prolyl cis-trans isomerase, cycloph...    240   3e-77   Chlamydomonas reinhardtii
ref|XP_005643480.1|  cyclophilin-like protein                           240   3e-77   Coccomyxa subellipsoidea C-169
dbj|BAM13286.1|  CYCLOPHILIN 1                                          240   3e-77   Oryza australiensis
ref|NP_001063993.1|  Os09g0571400                                       240   4e-77   
gb|ERG80132.1|  peptidyl-prolyl cis-trans isomerase 3                   241   4e-77   
gb|ABO47873.1|  cyclophilin                                             239   5e-77   Alexandrium fundyense
ref|XP_002459866.1|  hypothetical protein SORBIDRAFT_02g012590          239   5e-77   Sorghum bicolor [broomcorn]
emb|CDJ82690.1|  Peptidyl-prolyl cis-trans isomerase domain conta...    239   5e-77   Haemonchus contortus [red stomach worm]
ref|XP_008218307.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   6e-77   Prunus mume [ume]
dbj|BAM13285.1|  CYCLOPHILIN 1                                          239   6e-77   Oryza latifolia
ref|XP_007030475.1|  Rotamase cyclophilin 2                             239   6e-77   Theobroma cacao [chocolate]
emb|CDP95518.1|  Protein Bm9806, isoform b                              240   7e-77   
gb|KHJ92301.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    240   7e-77   Oesophagostomum dentatum [nodule worm]
ref|XP_010043279.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   7e-77   Eucalyptus grandis [rose gum]
dbj|BAM13289.1|  CYCLOPHILIN 1                                          239   9e-77   Oryza brachyantha
ref|NP_001236358.1|  uncharacterized protein LOC100306275               239   9e-77   
ref|XP_006646800.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   9e-77   Oryza brachyantha
gb|ETN78289.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    239   1e-76   Necator americanus
dbj|BAM13284.1|  CYCLOPHILIN 1                                          239   1e-76   Oryza officinalis
gb|KDO30624.1|  peptidyl-prolyl cis-trans isomerase                     238   1e-76   Saprolegnia parasitica CBS 223.65
ref|XP_007206000.1|  hypothetical protein PRUPE_ppa012309mg             239   1e-76   Prunus persica
ref|XP_002788074.1|  20 kDa cyclophilin precursor, putative             238   1e-76   Perkinsus marinus ATCC 50983
ref|XP_001900811.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    238   1e-76   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003149163.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    240   1e-76   Loa loa
gb|KDP23701.1|  hypothetical protein JCGZ_23534                         238   2e-76   
ref|XP_010690433.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     238   2e-76   
ref|XP_008616184.1|  peptidyl-prolyl cis-trans isomerase                238   2e-76   
ref|XP_010516206.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    238   2e-76   
ref|XP_006291930.1|  hypothetical protein CARUB_v10018115mg             238   2e-76   
ref|XP_004494752.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    238   3e-76   
ref|XP_004337098.1|  cyclophylin, putative                              238   3e-76   
gb|EFA76366.1|  cyclophilin-type peptidylprolyl cis-trans isomerase     237   3e-76   
ref|WP_017297358.1|  peptidylprolyl isomerase                           237   4e-76   
gb|EJW81456.1|  cyclophilin Ovcyp-2                                     237   4e-76   
ref|XP_010539096.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    237   4e-76   
ref|XP_011077231.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    237   5e-76   
ref|WP_044196140.1|  peptidylprolyl isomerase                           237   5e-76   
ref|XP_010427414.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    237   5e-76   
gb|KJB80889.1|  hypothetical protein B456_013G120200                    237   6e-76   
ref|XP_009844129.1|  peptidyl-prolyl cis-trans isomerase 1              236   6e-76   
gb|KHN73182.1|  Peptidyl-prolyl cis-trans isomerase 3                   239   7e-76   
ref|XP_006403025.1|  hypothetical protein EUTSA_v10006270mg             237   7e-76   
ref|XP_006661010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    237   7e-76   
ref|XP_002632172.1|  Hypothetical protein CBG07031                      236   7e-76   
ref|XP_003115315.1|  hypothetical protein CRE_19071                     236   8e-76   
gb|KJB80891.1|  hypothetical protein B456_013G120200                    237   8e-76   
gb|AER12108.1|  CYP                                                     236   8e-76   
ref|XP_006827506.1|  hypothetical protein AMTR_s00009p00179330          236   9e-76   
gb|KJB80890.1|  hypothetical protein B456_013G120200                    237   9e-76   
ref|NP_001045717.1|  Os02g0121300                                       236   9e-76   
ref|NP_506751.1|  Protein CYN-3                                         236   1e-75   
ref|WP_035985162.1|  peptidylprolyl isomerase                           236   1e-75   
ref|XP_011402103.1|  Peptidyl-prolyl cis-trans isomerase CYP18-4        236   1e-75   
gb|KJB80893.1|  hypothetical protein B456_013G120200                    236   1e-75   
ref|XP_004357939.1|  cyclophilin-type peptidylprolyl cis-trans is...    239   1e-75   
ref|XP_008785095.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     236   1e-75   
ref|XP_003115457.1|  CRE-CYN-7 protein                                  236   1e-75   
ref|XP_001779004.1|  predicted protein                                  236   2e-75   
ref|XP_006646802.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    236   2e-75   
gb|KHG05845.1|  Peptidyl-prolyl cis-trans isomerase CYP19-3 -like...    236   2e-75   
ref|XP_009116305.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    235   3e-75   
gb|AAC47231.1|  cyclophilin Bmcyp-2                                     235   3e-75   
ref|XP_010504491.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    235   3e-75   
ref|XP_009108112.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     234   4e-75   
ref|XP_009364457.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    234   4e-75   
dbj|BAM13283.1|  CYCLOPHILIN 1                                          234   5e-75   
ref|XP_010102251.1|  Peptidyl-prolyl cis-trans isomerase CYP19-3        234   5e-75   
gb|ADY38791.1|  cyclophilin                                             234   5e-75   
gb|AAB96833.1|  cytosolic cyclophilin                                   234   5e-75   
ref|NP_191166.1|  rotamase cyclophilin 2                                234   5e-75   
ref|XP_004956263.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    234   6e-75   
ref|XP_005772559.1|  peptidyl-prolyl cis-trans isomerase putative...    234   7e-75   
gb|EYU19878.1|  hypothetical protein MIMGU_mgv1a014900mg                234   8e-75   
gb|AAA57046.1|  cyclophilin 2                                           234   9e-75   
ref|XP_003294002.1|  hypothetical protein DICPUDRAFT_58785              234   1e-74   
ref|XP_003578700.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    234   1e-74   
ref|XP_002878060.1|  hypothetical protein ARALYDRAFT_907041             233   1e-74   
gb|AAA74096.1|  cyclophilin                                             233   1e-74   
gb|ABZ89184.1|  putative protein                                        233   1e-74   
gb|KHN32305.1|  Peptidyl-prolyl cis-trans isomerase 1                   233   2e-74   
dbj|BAM13287.1|  CYCLOPHILIN 1                                          233   2e-74   
gb|EGT52739.1|  hypothetical protein CAEBREN_15861                      233   2e-74   
emb|CDX75468.1|  BnaA01g02340D                                          233   2e-74   
ref|XP_008877256.1|  peptidyl-prolyl cis-trans isomerase 1              233   2e-74   
ref|XP_002953855.1|  hypothetical protein VOLCADRAFT_109901             233   3e-74   
gb|AFJ92644.1|  ABH-like cyclophilin                                    232   3e-74   
ref|XP_004337460.1|  peptidylprolyl cis-trans isomerase                 232   6e-74   
emb|CDX72175.1|  BnaC08g26990D                                          232   6e-74   
emb|CDX69094.1|  BnaC01g03590D                                          231   6e-74   
ref|XP_005787000.1|  peptidyl-prolyl isomerase                          231   7e-74   
ref|XP_006851976.1|  hypothetical protein AMTR_s00041p00200040          231   8e-74   
emb|CCW63160.1|  unnamed protein product                                232   9e-74   
ref|XP_005770377.1|  peptidyl-prolyl isomerase                          232   1e-73   
ref|XP_002508113.1|  predicted protein                                  242   1e-73   
gb|EGT45293.1|  hypothetical protein CAEBREN_23456                      231   1e-73   
pdb|2HQJ|A  Chain A, Cyclophilin From Leishmania Major                  231   2e-73   
ref|NP_001149489.1|  peptidyl-prolyl cis-trans isomerase CYP19-3        230   3e-73   
ref|XP_640016.1|  cyclophilin-type peptidylprolyl cis-trans isome...    230   3e-73   
gb|AAS20994.1|  cyclophilin                                             229   5e-73   
ref|XP_003370874.1|  peptidyl-prolyl cis-trans isomerase 7              229   5e-73   
ref|XP_001895426.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    229   5e-73   
ref|XP_001683327.1|  putative cyclophilin 11                            233   6e-73   
ref|XP_009034963.1|  cyclophilin                                        229   6e-73   
gb|EGT45232.1|  CBN-CYN-7 protein                                       229   7e-73   
ref|XP_008388706.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    229   8e-73   
emb|CDQ06054.1|  Protein Bm6689                                         229   8e-73   
gb|KHN43153.1|  Protein EIN4                                            246   1e-72   
gb|KIZ00361.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    228   1e-72   
ref|XP_002178047.1|  predicted protein                                  228   2e-72   
gb|AAQ24380.1|  cyclophilin A                                           227   2e-72   
ref|XP_005846877.1|  hypothetical protein CHLNCDRAFT_35742              230   3e-72   
ref|XP_010750880.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    227   4e-72   
ref|XP_003055075.1|  predicted protein                                  228   5e-72   
ref|XP_001562239.1|  putative cyclophilin 11                            231   5e-72   
emb|CBK24925.2|  unnamed protein product                                228   5e-72   
gb|EWM22394.1|  cyclophilin                                             228   6e-72   
ref|XP_003875627.1|  putative cyclophilin                               231   6e-72   
gb|AGZ87977.1|  peptidyl-prolyl cis-trans isomerase A                   226   6e-72   
ref|XP_004952092.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    226   7e-72   
ref|XP_004529666.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   7e-72   
ref|XP_003112830.1|  CRE-CYN-1 protein                                  227   7e-72   
ref|XP_002638374.1|  Hypothetical protein CBG18578                      226   7e-72   
ref|XP_002294514.1|  predicted protein                                  226   8e-72   
ref|XP_010699165.1|  cyclophilin 11, putative                           230   8e-72   
gb|ACG35589.1|  peptidyl-prolyl cis-trans isomerase CYP19-3             226   9e-72   
gb|ESL11216.1|  cyclophilin                                             229   9e-72   
gb|AAR11779.1|  cyclophilin A                                           226   1e-71   
gb|ADC80505.1|  peptidyl prolyl cis-trans isomerase A (II)              225   2e-71   
ref|XP_004529665.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   2e-71   
emb|CBN79758.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin...    225   2e-71   
ref|XP_002765236.1|  20 kDa cyclophilin precursor, putative             225   2e-71   
ref|XP_001465683.1|  putative cyclophilin 11                            229   2e-71   
gb|KFM64859.1|  Peptidyl-prolyl cis-trans isomerase                     226   2e-71   
gb|EMS56634.1|  Peptidyl-prolyl cis-trans isomerase                     227   2e-71   
gb|ACO10800.1|  Peptidyl-prolyl cis-trans isomerase                     224   3e-71   
emb|CCW66249.1|  unnamed protein product                                226   3e-71   
ref|XP_003097196.1|  hypothetical protein CRE_18104                     225   3e-71   
gb|EPY22582.1|  peptidylprolyl isomerase                                225   3e-71   
gb|ESS61689.1|  cyclophilin                                             228   4e-71   
gb|EYC37494.1|  hypothetical protein Y032_0785g2343                     225   4e-71   
ref|XP_003707098.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    226   4e-71   
ref|XP_009772522.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   5e-71   
emb|CBY33767.1|  unnamed protein product                                224   6e-71   
ref|XP_004072879.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   6e-71   
gb|KIZ04415.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    225   7e-71   
emb|CCC91984.1|  putative cyclophilin type peptidyl-prolyl cis-tr...    227   8e-71   
ref|XP_004142527.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   9e-71   
ref|XP_806737.1|  cyclophilin                                           226   9e-71   
ref|XP_011177284.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    226   9e-71   
ref|XP_010253899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   1e-70   
ref|XP_005183997.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     224   1e-70   
emb|CEF66075.1|  Peptidyl-prolyl cis-trans isomerase D                  223   1e-70   
ref|XP_010253898.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    225   1e-70   
emb|CAF94597.1|  unnamed protein product                                223   1e-70   
ref|XP_003974672.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   1e-70   
gb|ADF32017.1|  cyclophilin A                                           223   1e-70   
emb|CAA08988.1|  cyclophilin (TcCYP)                                    226   1e-70   
gb|ABM92916.1|  cyclophilin A                                           223   2e-70   
gb|EKF27152.1|  cyclophilin, putative                                   226   2e-70   
gb|KJB15750.1|  hypothetical protein B456_002G193600                    223   2e-70   
gb|KHJ83952.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    224   2e-70   
emb|CBY08940.1|  unnamed protein product                                222   2e-70   
gb|ADC80504.1|  peptidyl prolyl cis-trans isomerase A (I)               222   2e-70   
ref|XP_010253897.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   2e-70   
ref|XP_002637839.1|  C. briggsae CBR-CYN-1 protein                      223   3e-70   
ref|XP_007540865.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    222   3e-70   
dbj|BAP11150.1|  putative peptidyl-prolyl cis-trans isomerase           221   3e-70   
gb|KIX79265.1|  peptidylprolyl isomerase                                222   3e-70   
gb|ABO87313.1|  cyclophilin                                             222   3e-70   
ref|XP_002067586.1|  GK16511                                            222   3e-70   
ref|XP_003455534.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    222   3e-70   
ref|XP_011208509.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   4e-70   
ref|XP_005756274.1|  peptidyl-prolyl isomerase                          222   4e-70   
pdb|2Z6W|A  Chain A, Crystal Structure Of Human Cyclophilin D In ...    222   4e-70   
gb|ADB04247.1|  cyclophilin                                             222   4e-70   
ref|XP_002730776.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    222   4e-70   
gb|AGZ87978.1|  peptidyl-prolyl cis-trans isomerase A                   221   4e-70   
ref|XP_005749210.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    221   4e-70   
ref|XP_005946817.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    221   5e-70   
ref|XP_004226428.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    221   5e-70   
ref|XP_008605920.1|  peptidylprolyl isomerase                           222   5e-70   
ref|WP_030697934.1|  peptidylprolyl isomerase                           221   5e-70   
gb|AGG11628.1|  hypothetical protein                                    222   6e-70   
gb|EYC37496.1|  hypothetical protein Y032_0785g2343                     225   6e-70   
gb|KJB15749.1|  hypothetical protein B456_002G193600                    221   6e-70   
ref|WP_040528526.1|  peptidylprolyl isomerase                           221   7e-70   
ref|WP_023422139.1|  Peptidyl-prolyl cis-trans isomerase                221   7e-70   
ref|XP_005846492.1|  hypothetical protein CHLNCDRAFT_24996              221   7e-70   
ref|XP_008417631.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    221   8e-70   
ref|WP_030006986.1|  peptidylprolyl isomerase                           221   8e-70   
gb|ABM55516.1|  putative peptidyl-prolyl cis-trans isomerase            221   8e-70   
ref|XP_008797942.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    222   9e-70   
ref|XP_008797941.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    222   9e-70   
gb|AEP83534.1|  cyclophilin A                                           220   1e-69   
emb|CDW53642.1|  peptidyl prolyl cis trans isomerase 7                  221   1e-69   
gb|ACD62432.1|  peptidyl-prolyl cis-trans isomerase 2                   221   1e-69   
gb|AFY36667.1|  peptidyl-prolyl cis-trans isomerase cyclophilin type    221   1e-69   
ref|XP_009310577.1|  putative cyclophilin                               224   1e-69   
ref|XP_805696.1|  cyclophilin                                           223   1e-69   
ref|WP_023418050.1|  Peptidyl-prolyl cis-trans isomerase                221   1e-69   
ref|XP_001567958.1|  putative cyclophilin 4                             221   1e-69   
ref|WP_030908558.1|  peptidylprolyl isomerase                           221   1e-69   
ref|NP_506561.1|  Protein CYN-1                                         221   1e-69   
emb|CCC49541.1|  putative peptidyl-prolyl cis-trans isomerase           223   1e-69   
ref|XP_002010827.1|  GI21755                                            220   1e-69   
ref|XP_004571665.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    220   2e-69   
ref|XP_009623610.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    221   2e-69   
ref|XP_010702264.1|  cyclophilin 4, putative                            221   2e-69   
ref|WP_033950859.1|  peptidylprolyl isomerase                           220   2e-69   
gb|AGG11540.1|  hypothetical protein                                    221   2e-69   
gb|AGC84404.1|  peptidyl-prolyl isomerase-1                             219   3e-69   
ref|WP_002619414.1|  peptidylprolyl isomerase                           219   3e-69   
ref|XP_011177285.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    222   3e-69   
pdb|3R49|A  Chain A, Human Cyclophilin D Complexed With Quinolin-...    219   3e-69   
gb|KDO25832.1|  hypothetical protein SPRG_08776                         220   3e-69   
ref|WP_024545194.1|  peptidylprolyl isomerase                           220   3e-69   
gb|ACU83230.1|  cyclophilin A isoform 2                                 219   3e-69   
gb|ABV90639.1|  cyclophilin A                                           219   3e-69   
gb|EGT34029.1|  CBN-CYN-1 protein                                       220   3e-69   
pdb|2BIT|X  Chain X, Crystal Structure Of Human Cyclophilin D At ...    219   3e-69   
gb|ACO12823.1|  Peptidyl-prolyl cis-trans isomerase                     219   3e-69   
pdb|3QYU|A  Chain A, Crystal Structure Of Human Cyclophilin D At ...    219   3e-69   
ref|XP_003062024.1|  predicted protein                                  223   3e-69   
ref|XP_002772409.1|  20 kDa cyclophilin precursor, putative             220   4e-69   
ref|WP_012307239.1|  peptidylprolyl isomerase                           219   4e-69   
ref|XP_011208511.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    221   4e-69   
ref|WP_010643742.1|  peptidylprolyl isomerase                           219   4e-69   
ref|XP_001685924.1|  putative cyclophilin 4                             221   4e-69   
emb|CDJ57377.1|  20 kDa cyclophilin precursor, putative                 219   4e-69   
gb|EGT35378.1|  hypothetical protein CAEBREN_18953                      219   4e-69   
gb|AFU72274.1|  peptidylprolyl isomerase A                              219   4e-69   
gb|AGS46493.1|  cyclophilin A                                           219   4e-69   
ref|XP_001745409.1|  hypothetical protein                               219   4e-69   
ref|WP_030767285.1|  peptidylprolyl isomerase                           219   4e-69   
gb|AFI24615.1|  cyclophilin A                                           219   4e-69   
gb|AAX34045.1|  Mal s 6 allergen                                        219   4e-69   
ref|XP_002597453.1|  hypothetical protein BRAFLDRAFT_122621             219   4e-69   
ref|XP_004249914.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   5e-69   
ref|XP_004294264.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    220   5e-69   
ref|XP_002613737.1|  hypothetical protein BRAFLDRAFT_114823             219   5e-69   
emb|CDI79350.1|  20 kDa cyclophilin precursor, putative                 219   5e-69   
ref|WP_008406003.1|  MULTISPECIES: peptidylprolyl isomerase             219   5e-69   
ref|WP_018471384.1|  peptidylprolyl isomerase                           219   5e-69   
ref|XP_005644933.1|  hypothetical protein COCSUDRAFT_18417              221   5e-69   
gb|ADY69343.1|  cyclophilin A                                           219   5e-69   



>gb|ABP35528.1| cyclophilin [Ipomoea batatas]
Length=172

 Score =   291 bits (746),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            MGNPRVFFD+T+GGQP GRIVMELFADTTPQTAENFRA CTGEKGVGKSGKPLHYKGSTF
Sbjct  1    MGNPRVFFDMTIGGQPAGRIVMELFADTTPQTAENFRAFCTGEKGVGKSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKFKDENFV+KHTGPGILSMANAGPNTNG QFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFKDENFVEKHTGPGILSMANAGPNTNGFQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  160



>ref|NP_001275605.1| peptidyl-prolyl cis-trans isomerase-like [Solanum tuberosum]
 gb|AAD22975.1|AF126551_1 cyclophilin [Solanum tuberosum]
 gb|ABB29940.1| cyclophilin-like [Solanum tuberosum]
 gb|AFW90623.1| stress responsive cyclophilin [Solanum tuberosum]
Length=171

 Score =   275 bits (703),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+T+GG P GR+VMELFADTTP+TAENFRALCTGEKGVGK GKPLHYKGSTF
Sbjct  1    MANPRVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KFKDENFVKKHTG GILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFVKKHTGTGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEGLDV+KK E VGS SGRCS
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGLDVIKKAEAVGSSSGRCS  160



>ref|XP_004289844.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1 [Fragaria vesca 
subsp. vesca]
Length=174

 Score =   275 bits (702),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFD+T+GGQP GRIVMEL+ADTTP+TAENFRALCTGEKG G+SGKPLHYKGS FHR
Sbjct  5    NPKVFFDMTIGGQPAGRIVMELYADTTPRTAENFRALCTGEKGTGRSGKPLHYKGSAFHR  64

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFFIC
Sbjct  65   VIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFFIC  124

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            TAKTEWLDGKHVVFGQVVEGLDVVK +E+VGSGSGRCS
Sbjct  125  TAKTEWLDGKHVVFGQVVEGLDVVKNIEKVGSGSGRCS  162



>ref|XP_003522746.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like [Glycine 
max]
Length=172

 Score =   274 bits (701),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+T+GGQP GRIVMEL+ADTTP+TAENFRALCTGEKGVG+SGKPLHYKGSTF
Sbjct  1    MANPKVYFDMTIGGQPAGRIVMELYADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEGLDVVK +E+VGS SG+ S
Sbjct  121  ICTVKTEWLDGKHVVFGQVVEGLDVVKDIEKVGSSSGKTS  160



>ref|XP_011074689.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Sesamum indicum]
Length=172

 Score =   273 bits (699),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFDIT+GGQP GR+VMELFADTTP+TAENFRALCTGEKGVG+SGKPLHYKGSTF
Sbjct  1    MPNPRVFFDITIGGQPAGRVVMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENF+K+HTGPGILSMAN+GPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFIKQHTGPGILSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKT WLDGKHVVFGQVVEGLDVVK +E+VGS SGR +
Sbjct  121  ICTAKTAWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGRTA  160



>gb|ABK34279.1| cyclophilin [Solanum sogarandinum]
Length=171

 Score =   273 bits (697),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+T+GG   GR+VMELFADTTP+TAENFRALCTGEKG+GK GKPLHYKGSTF
Sbjct  1    MANPRVFFDLTIGGASAGRVVMELFADTTPKTAENFRALCTGEKGIGKMGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KFKDENFVKKHTG GILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFVKKHTGAGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEGLDV+KK E VGS SGRCS
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGLDVIKKTEAVGSSSGRCS  160



>ref|XP_002313736.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
 ref|XP_006379277.1| hypothetical protein POPTR_0009s13270g [Populus trichocarpa]
 gb|ABK92619.1| unknown [Populus trichocarpa]
 gb|ABK93502.1| unknown [Populus trichocarpa]
 gb|EEE87691.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
 gb|ERP57074.1| hypothetical protein POPTR_0009s13270g [Populus trichocarpa]
Length=172

 Score =   273 bits (697),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD++VGGQP GRIVMELFAD  P+TAENFRALCTGEKGVGKSGKPLHYKGS+F
Sbjct  1    MANPRVFFDMSVGGQPAGRIVMELFADIVPKTAENFRALCTGEKGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CT KTEWLDGKHVVFGQVVEGLDVVK +E+VGSGSG+ S
Sbjct  121  VCTVKTEWLDGKHVVFGQVVEGLDVVKAIEKVGSGSGKTS  160



>ref|XP_011029022.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Populus euphratica]
Length=172

 Score =   272 bits (696),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+T+GGQPTGRIVMELFADTTP+TAENFRALCTGEKG G+SGKPLHYKGSTF
Sbjct  1    MANPRVYFDMTIGGQPTGRIVMELFADTTPRTAENFRALCTGEKGKGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFG+VVEGLDVVK +E+ GS SGR S
Sbjct  121  ICTAKTEWLDGKHVVFGRVVEGLDVVKAIEKFGSSSGRTS  160



>gb|ACF48822.1| cyclophilin [Gossypium hirsutum]
Length=173

 Score =   272 bits (696),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFD+T+GGQP GRIVMELFAD TP+TAENFRALCTGEKGVG+SGKPLHYKGS+FHR
Sbjct  4    NPKVFFDMTIGGQPAGRIVMELFADCTPRTAENFRALCTGEKGVGRSGKPLHYKGSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIPNFMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFFIC
Sbjct  64   VIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            TAKTEWLDGKHVVFGQVVEG+DVVK +E+VGS SGR S
Sbjct  124  TAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTS  161



>ref|XP_011088559.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1 [Sesamum indicum]
Length=172

 Score =   272 bits (696),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ VGGQP GRIVMEL+AD  P+TAENFRALCTGEKGVG+SGKPLHYKGSTF
Sbjct  1    MANPKVFFDMAVGGQPAGRIVMELYADVVPKTAENFRALCTGEKGVGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEG DVVK +E+VGSGSGR S
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGYDVVKAIEKVGSGSGRTS  160



>gb|AFK43730.1| unknown [Lotus japonicus]
Length=171

 Score =   272 bits (695),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP GRIVMELFAD TP+TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPKVFFDMTIGGQPAGRIVMELFADVTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF D NFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADGNFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVV+GLDVVK +E+VGS SG+CS
Sbjct  121  ICTAKTEWLDGKHVVFGQVVKGLDVVKNIEKVGSSSGKCS  160



>ref|NP_001234488.1| peptidyl-prolyl cis-trans isomerase [Solanum lycopersicum]
 sp|P21568.1|CYPH_SOLLC RecName: Full=Peptidyl-prolyl cis-trans isomerase; Short=PPIase; 
AltName: Full=Cyclophilin; AltName: Full=Cyclosporin A-binding 
protein; AltName: Full=Rotamase [Solanum lycopersicum]
 gb|AAA63543.1| cyclophilin [Solanum lycopersicum]
Length=171

 Score =   272 bits (695),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GG P GR+VMELFADTTP+TAENFRALCTGEKGVGK GKPLHYKGSTF
Sbjct  1    MANPKVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWL+GKHVVFGQVVEG+DV+KK E VGS SGRCS
Sbjct  121  ICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCS  160



>gb|KJB12159.1| hypothetical protein B456_002G003800 [Gossypium raimondii]
Length=171

 Score =   271 bits (693),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            MGNP+VFFD+T+GGQP GRIVMELFAD TP+TAENFRALCTGEKGVG+SGKPLHYKGSTF
Sbjct  1    MGNPKVFFDMTIGGQPAGRIVMELFADCTPRTAENFRALCTGEKGVGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF+DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFEDENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVV+ +E+VGS  GR S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGMDVVRDIEKVGSSGGRTS  160



>ref|XP_009590739.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Nicotiana 
tomentosiformis]
Length=172

 Score =   271 bits (693),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T GGQPTGR+VMELF D  P+TA+NFRALCTGEKGVGKSGKPLHYKGS+F
Sbjct  1    MANPKVFFDLTTGGQPTGRVVMELFNDVVPKTADNFRALCTGEKGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQV+EG+DV+KKVE VGS SGRCS
Sbjct  121  ICTAKTEWLDGKHVVFGQVIEGMDVIKKVEAVGSSSGRCS  160



>ref|XP_011046718.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1 [Populus euphratica]
Length=172

 Score =   271 bits (692),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD++VGGQP GRIVMELFAD  P+TAENFRALCTGEKGVGKSGKPLH+KGSTF
Sbjct  1    MANPKVFFDMSVGGQPAGRIVMELFADIVPKTAENFRALCTGEKGVGKSGKPLHFKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEGLDVVK +E+VGSGSG+ S
Sbjct  121  ICTVKTEWLDGKHVVFGQVVEGLDVVKAIEKVGSGSGKTS  160



>ref|XP_009346636.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1 [Pyrus x bretschneideri]
Length=172

 Score =   271 bits (692),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP GRIVMEL+ADTTP+TAENFRALCTGEKGVG+SGKPLHYKGS F
Sbjct  1    MANPKVFFDMTIGGQPAGRIVMELYADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFNKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEGLDVVK +E+VGSG GR S
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGLDVVKNIEKVGSGQGRTS  160



>gb|EYU37917.1| hypothetical protein MIMGU_mgv1a014959mg [Erythranthe guttata]
Length=172

 Score =   271 bits (692),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGGQP GRIVMEL+AD  P+TAENFRALCTGEKGVG+SGKPLHYKGS F
Sbjct  1    MANPRVFFDMTVGGQPAGRIVMELYADVVPKTAENFRALCTGEKGVGRSGKPLHYKGSCF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CTAKTEWLDGKHVVFGQVVEG +VVK +E+VGSGSGR S
Sbjct  121  VCTAKTEWLDGKHVVFGQVVEGYEVVKAIEKVGSGSGRTS  160



>dbj|BAQ21277.1| cyclophilin [Citrus tamurana]
Length=172

 Score =   270 bits (691),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQP GRIVMELFAD TP+TAENFRALCTGEKGVGKSGKPLHYKGS+F
Sbjct  1    MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            +CTAKTEWLDGKHVVFGQVVEG+DVVK +E+VGS SGR
Sbjct  121  VCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGR  158



>ref|WP_039311101.1| peptidylprolyl isomerase [Paenibacillus sp. IHB B 3415]
 gb|KHL91146.1| peptidylprolyl isomerase [Paenibacillus sp. IHB B 3415]
Length=172

 Score =   270 bits (691),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ VGGQP GRIVMEL+ADTTP+TAENFRALCTGEKGVGKSGKPLHYKGS+F
Sbjct  1    MANPKVFFDMAVGGQPAGRIVMELYADTTPRTAENFRALCTGEKGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CTAKTEWLDGKHVVFGQVVEG++VVK +E+VGS +GR S
Sbjct  121  VCTAKTEWLDGKHVVFGQVVEGMEVVKAIEKVGSSTGRTS  160



>ref|XP_004248678.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Solanum 
lycopersicum]
Length=172

 Score =   270 bits (691),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQ  GR+VMELF D TP+TAENFRALCTGEKGVGK+GKPLHYKGS+F
Sbjct  1    MANPKVFFDLTIGGQAAGRVVMELFNDATPKTAENFRALCTGEKGVGKAGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEG+DV+KK E VGS SG+CS
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGMDVIKKAEAVGSSSGKCS  160



>ref|XP_009759250.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Nicotiana sylvestris]
Length=172

 Score =   270 bits (691),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGG PTGR+VMELF D  P+TA+NFRALCTGEKGVGKSGKPLHYKGS+F
Sbjct  1    MANPKVFFDLTVGGLPTGRVVMELFNDVVPKTADNFRALCTGEKGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQV+EG+DV+KKVE VGS SGRCS
Sbjct  121  ICTAKTEWLDGKHVVFGQVIEGMDVIKKVEAVGSSSGRCS  160



>ref|XP_008236203.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Prunus mume]
Length=173

 Score =   270 bits (691),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFD+T+GGQP GRIVMELFADTTP+TAENFRALCTGEKGVG+SGKPLHYKGS+FHR
Sbjct  4    NPKVFFDMTIGGQPAGRIVMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF+C
Sbjct  64   VIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFFVC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            TAKTEWLDGKHVVFGQV EGLDVVK +E+VGS SGR S
Sbjct  124  TAKTEWLDGKHVVFGQVTEGLDVVKNIEKVGSSSGRTS  161



>ref|XP_010516536.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-1 [Camelina 
sativa]
Length=172

 Score =   270 bits (690),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            MGNP+VFFD+TVGGQP GRIVMEL+ADTTP+TAENFRALCTGE+GVGKSGKPLHYKGS+F
Sbjct  1    MGNPKVFFDMTVGGQPAGRIVMELYADTTPETAENFRALCTGERGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG KFKDENF+KKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENFIKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEGL+VV+ +E+VGS +GR S
Sbjct  121  ICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDAGRTS  160



>ref|NP_001276071.1| uncharacterized protein LOC102623101 [Citrus sinensis]
 ref|XP_006423607.1| hypothetical protein CICLE_v10029386mg [Citrus clementina]
 gb|ACX37092.1| cyclophilin [Citrus sinensis]
 gb|ESR36847.1| hypothetical protein CICLE_v10029386mg [Citrus clementina]
Length=172

 Score =   270 bits (690),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQP GRIVMELFAD TP+TAENFRALCTGEKG+GKSGKPLHYKGS+F
Sbjct  1    MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            +CTAKTEWLDGKHVVFGQVVEG+DVVK +E+VGS SGR
Sbjct  121  VCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGR  158



>sp|Q39613.1|CYPH_CATRO RecName: Full=Peptidyl-prolyl cis-trans isomerase; Short=PPIase; 
AltName: Full=Cyclophilin; AltName: Full=Cyclosporin A-binding 
protein; AltName: Full=Rotamase [Catharanthus roseus]
 emb|CAA59468.1| cyclophilin [Catharanthus roseus]
 gb|AFI56997.1| peptidyl-prolyl cis-trans isomerase [Catharanthus roseus]
Length=172

 Score =   270 bits (690),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD++VGGQP GRIVMELFADTTP+TAENFRALCTGEKG G+SGKPLHYK S+F
Sbjct  1    MPNPRVFFDMSVGGQPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLHYKDSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEG+DVVK +E+VGS SGR +
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTA  160



>pdb|4JJM|A Chain A, Structure Of A Cyclophilin From Citrus Sinensis (cscyp) 
In Complex With Cycloporin A
 pdb|4JJM|B Chain B, Structure Of A Cyclophilin From Citrus Sinensis (cscyp) 
In Complex With Cycloporin A
Length=175

 Score =   270 bits (690),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQP GRIVMELFAD TP+TAENFRALCTGEKG+GKSGKPLHYKGS+F
Sbjct  4    MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSF  63

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  64   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF  123

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            +CTAKTEWLDGKHVVFGQVVEG+DVVK +E+VGS SGR
Sbjct  124  VCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGR  161



>pdb|2MC9|A Chain A, Cat R 1
Length=178

 Score =   270 bits (690),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD++VGGQP GRIVMELFADTTP+TAENFRALCTGEKG G+SGKPLHYK S+F
Sbjct  7    MPNPRVFFDMSVGGQPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLHYKDSSF  66

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGPNTNGSQFF
Sbjct  67   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPNTNGSQFF  126

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEG+DVVK +E+VGS SGR +
Sbjct  127  ICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTA  166



>gb|ABK96333.1| unknown [Populus trichocarpa x Populus deltoides]
Length=172

 Score =   270 bits (689),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQP GRIVMELFAD  P+TAENFRALCTGEKGVGKSGKPLH+KGS+F
Sbjct  1    MSNPKVFFDMTVGGQPAGRIVMELFADIVPRTAENFRALCTGEKGVGKSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK +E+VGSG+GR S
Sbjct  121  ICTVKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSGNGRTS  160



>ref|XP_006367332.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Solanum 
tuberosum]
Length=172

 Score =   270 bits (689),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQ  GR+VMELF D TP+TAENFRALCTGEKGVGK+GKPLHYKGS+F
Sbjct  1    MANPKVFFDLTIGGQAAGRVVMELFNDATPKTAENFRALCTGEKGVGKTGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CTAKTEWLDGKHVVFGQVVEG+DV+KK E VGS SG+CS
Sbjct  121  VCTAKTEWLDGKHVVFGQVVEGMDVIKKAEAVGSSSGKCS  160



>ref|NP_001238688.1| uncharacterized protein LOC100527355 [Glycine max]
 gb|ACU16431.1| unknown [Glycine max]
Length=172

 Score =   269 bits (688),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+T+GGQP GRIVMEL+ADTTP+TAENFRALCTGEKGVG+SGKPLHYKGS F
Sbjct  1    MPNPKVYFDMTIGGQPAGRIVMELYADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENF+KK+TGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKYTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEGLDVVK +E+VGS SG+ S
Sbjct  121  ICTVKTEWLDGKHVVFGQVVEGLDVVKDIEKVGSSSGKTS  160



>ref|XP_007201241.1| hypothetical protein PRUPE_ppa012332mg [Prunus persica]
 gb|EMJ02440.1| hypothetical protein PRUPE_ppa012332mg [Prunus persica]
Length=173

 Score =   269 bits (687),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFD+T+GGQP GRIVMELFADTTP+TAENFRALCTGEKG G+SGKPLHYKGS+FHR
Sbjct  4    NPKVFFDMTIGGQPAGRIVMELFADTTPRTAENFRALCTGEKGAGRSGKPLHYKGSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFF+C
Sbjct  64   VIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFFVC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            TAKTEWLDGKHVVFGQV EGLDVVK +E+VGS SGR S
Sbjct  124  TAKTEWLDGKHVVFGQVTEGLDVVKNIEKVGSSSGRTS  161



>ref|XP_011037275.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1 [Populus euphratica]
Length=172

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQP GRIVMELFAD  P+TAENFRALCTGEKGVG+SGKPLH+KGS+F
Sbjct  1    MSNPKVFFDMTVGGQPVGRIVMELFADVVPRTAENFRALCTGEKGVGRSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK +E+VGSG+GR S
Sbjct  121  ICTVKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSGNGRTS  160



>gb|ADG34846.1| cyclophilin [Vanda hybrid cultivar]
Length=173

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NPRVFFD+T+GG P GRIVMELFADTTP+TAENFRALCTGEKG+GKSGKPLHYKGSTFHR
Sbjct  4    NPRVFFDMTIGGSPAGRIVMELFADTTPRTAENFRALCTGEKGIGKSGKPLHYKGSTFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGGESIYG+KF DENF KKHTGPGILSMANAG NTNGSQFFIC
Sbjct  64   VIPQFMCQGGDFTAGNGTGGESIYGAKFADENFTKKHTGPGILSMANAGSNTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            T KT WLDGKHVVFGQVVEGLDVVK +E+VGS SGR S
Sbjct  124  TEKTSWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGRTS  161



>gb|AEF01110.1| cyclophilin 2 [Tagetes patula]
Length=171

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGG P GRIVMELFADTTP+TAENFRALCTGEKG G SGKPLH+KGS+F
Sbjct  1    MANPKVFFDMTVGGAPAGRIVMELFADTTPRTAENFRALCTGEKGKGSSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFT GNGTGGESIYG+KF DENFVKKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTRGNGTGGESIYGNKFADENFVKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFG+V+EG+DVVK +E+VGSGSG  S
Sbjct  121  ICTAKTEWLDGKHVVFGKVIEGMDVVKAIEKVGSGSGSTS  160



>gb|ABK96400.1| unknown [Populus trichocarpa x Populus deltoides]
Length=172

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+T+GGQP GRIVMELFADTTP+TAENFRALCTGEKG G+SGKPLHYKGSTF
Sbjct  1    MANPRVYFDMTIGGQPAGRIVMELFADTTPRTAENFRALCTGEKGKGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CTAKTEWLDGKHVVFG+VVEGLDVVK +E+ GS +GR S
Sbjct  121  VCTAKTEWLDGKHVVFGRVVEGLDVVKAIEKFGSSNGRTS  160



>ref|XP_009610666.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Nicotiana tomentosiformis]
Length=172

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GG P GR+VMEL+ADT P+TAENFRALCTGEKGVG+ GKPLHYKGSTF
Sbjct  1    MANPKVFFDLTIGGAPAGRVVMELYADTVPKTAENFRALCTGEKGVGRMGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF +KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFKRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEG DV+KK E VGSGSGRCS
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGYDVIKKAEAVGSGSGRCS  160



>ref|XP_009377655.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Pyrus x bretschneideri]
 ref|XP_009377661.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Pyrus x bretschneideri]
Length=172

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP GRIVMELFADTTP+TAENFRALCTGEKG G+SGKPLHYKGS F
Sbjct  1    MVNPKVFFDMTIGGQPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFNKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQV+EGLDVVK +E+VGSG GR S
Sbjct  121  ICTAKTEWLDGKHVVFGQVIEGLDVVKNIEKVGSGQGRTS  160



>ref|XP_002301975.1| Peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
 gb|ABK92981.1| unknown [Populus trichocarpa]
 gb|EEE81248.1| Peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
Length=172

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+T+GGQP GRIVMELFADTTP+TAENFRALCTGEKG G+SGKPLHYKGSTF
Sbjct  1    MANPRVYFDMTIGGQPAGRIVMELFADTTPRTAENFRALCTGEKGKGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CTAKTEWLDGKHVVFG+VVEGLDVVK +E+ GS +GR S
Sbjct  121  VCTAKTEWLDGKHVVFGRVVEGLDVVKAIEKFGSSNGRTS  160



>gb|AFO67220.1| putative cyclophilin [Aralia elata]
Length=172

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ +GG P GRIVMEL+ADTTP+TAENFRALCTGEKG+GKSGKPLHYKGS+F
Sbjct  1    MANPKVFFDMAIGGTPAGRIVMELYADTTPKTAENFRALCTGEKGIGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPQFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWL+GKHVVFGQVVEGLDVVK +E+VGS SGR S
Sbjct  121  ICTAKTEWLNGKHVVFGQVVEGLDVVKAIEKVGSSSGRTS  160



>gb|EPS65110.1| peptidyl-prolyl cis-trans isomerase [Genlisea aurea]
Length=172

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ VGGQP GRIVMEL+AD  P+TAENFRALCTGEKGVGKSGKPLH+KGS+F
Sbjct  1    MANPKVFFDMAVGGQPAGRIVMELYADVVPRTAENFRALCTGEKGVGKSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENF++KHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIRKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEG DVVK VE+VGSGSG+ S
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGFDVVKAVEKVGSGSGKTS  160



>gb|AAB51386.1| stress responsive cyclophilin [Solanum commersonii]
Length=172

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+T+GG P GR+VMELFADTTP+TAENFRALCTGEKGVGK GKPLHYKGSTF
Sbjct  1    MANPRVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggE-SIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            HRVIP FMCQGGDFTAGNGTG E SIYG+KFKDENFVKKHTG GILSMANAGP TNGSQF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGEEKSIYGAKFKDENFVKKHTGAGILSMANAGPGTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
             IC+AKTEWLDGKHVVFGQVVEGLDV+KK E VGS SGRCS
Sbjct  121  LICSAKTEWLDGKHVVFGQVVEGLDVIKKAEAVGSSSGRCS  161



>ref|XP_010467390.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-1-like [Camelina 
sativa]
Length=172

 Score =   268 bits (685),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQP GRIVMEL+ADTTP+TAENFRALCTGEKGVGKSGKPLHYKGS+F
Sbjct  1    MVNPKVFFDMTVGGQPAGRIVMELYADTTPETAENFRALCTGEKGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG KFKDENFVKKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPKFMCQGGDFTAGNGTGGESIYGLKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEGL+VV+ +E+VGS +GR S
Sbjct  121  ICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDAGRTS  160



>gb|ABL67655.1| putative cyclophilin [Citrus hybrid cultivar]
Length=172

 Score =   268 bits (685),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQP GRIVMELFA+ TP+TAENFRALCTGEKG+GKSGKPLHYKGS+F
Sbjct  1    MPNPKVFFDMTVGGQPAGRIVMELFAEVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            +CTAKTEWLDGKHVVFGQVVEG+DVVK +E+VGS SGR
Sbjct  121  VCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGR  158



>gb|AEV66153.1| cyclophilin [Arachis hypogaea]
Length=172

 Score =   268 bits (685),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+++GGQP GR+V ELFADT P+TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPKVYFDMSIGGQPAGRVVFELFADTVPRTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT+KTEWLDGKHVVFGQVVEGLDVVK VE+VGS SG+ S
Sbjct  121  ICTSKTEWLDGKHVVFGQVVEGLDVVKAVEKVGSSSGKTS  160



>ref|XP_011083569.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Sesamum 
indicum]
Length=172

 Score =   268 bits (685),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FDIT+GGQP GRIVMELFA+TTP+TAENFRALCTGEKGVG+SGK LH+KGSTF
Sbjct  1    MANPKVYFDITIGGQPAGRIVMELFAETTPRTAENFRALCTGEKGVGRSGKKLHFKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKT WLDGKHVVFGQVVEG+DVVK VE+VGS SGR +
Sbjct  121  ICTAKTAWLDGKHVVFGQVVEGMDVVKGVEKVGSSSGRTA  160



>ref|XP_008364692.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
1-like [Malus domestica]
Length=172

 Score =   268 bits (685),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP GRIVMELFADTTP TAENFRALCTGEKG G+SGKPLHYKGS F
Sbjct  1    MANPKVFFDMTIGGQPAGRIVMELFADTTPXTAENFRALCTGEKGNGRSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFKKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQV+EGLDVVK +E+VGSG GR S
Sbjct  121  ICTAKTEWLDGKHVVFGQVIEGLDVVKNIEKVGSGQGRTS  160



>ref|XP_002510543.1| cyclophilin, putative [Ricinus communis]
 emb|CAC80550.1| cyclophilin [Ricinus communis]
 gb|EEF52730.1| cyclophilin, putative [Ricinus communis]
Length=173

 Score =   268 bits (685),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            +  NP+VFFD+TVGG P GRIVMELFADTTP+TAENFRALCTGEKGVG+SGKPLHYKGS+
Sbjct  1    MAANPKVFFDMTVGGAPAGRIVMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSS  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQF
Sbjct  61   FHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            FICTAKTEWLDGKHVVFG+VVEG+D+VK +E+VGS SGR S
Sbjct  121  FICTAKTEWLDGKHVVFGRVVEGMDIVKAIEKVGSSSGRTS  161



>gb|KJB47605.1| hypothetical protein B456_008G034100 [Gossypium raimondii]
Length=172

 Score =   268 bits (684),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFD+TVGGQP GRIVMELFAD TP+TAENFRALCTGEKGVG+SGKPLHYKGS+FHR
Sbjct  4    NPKVFFDMTVGGQPAGRIVMELFADCTPRTAENFRALCTGEKGVGRSGKPLHYKGSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIPNFMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFFIC
Sbjct  64   VIPNFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            T KTEWLDGKHVVFGQVVEG+DVVK +E+VGS  GR S
Sbjct  124  TTKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSGGRTS  161



>ref|XP_008372880.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
1-like [Malus domestica]
 ref|XP_008356339.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
1-like [Malus domestica]
Length=172

 Score =   268 bits (684),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP GRIVMEL+ADTTP TAENFRALCTGEKGVG+SGKPLHYKGS F
Sbjct  1    MANPKVFFDMTIGGQPAGRIVMELYADTTPXTAENFRALCTGEKGVGRSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMC GGDFTAGNGTGGESIYG+KF DENF KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCXGGDFTAGNGTGGESIYGAKFADENFNKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEGLDVVK +E+VGSG GR S
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGLDVVKNIEKVGSGQGRTS  160



>ref|XP_008447986.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Cucumis melo]
Length=172

 Score =   268 bits (684),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+++GG P GRIVMEL+AD TP+TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MPNPKVFFDMSIGGAPAGRIVMELYADVTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKT+WLDGKHVVFGQVVEG+DVVK VE+VGS SGR S
Sbjct  121  ICTAKTDWLDGKHVVFGQVVEGMDVVKAVEKVGSSSGRTS  160



>ref|XP_009788636.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Nicotiana sylvestris]
Length=172

 Score =   268 bits (684),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GG P GR+VMEL+ADT P+TAENFRALCTGEKGVG+ GKPLHYKGSTF
Sbjct  1    MANPKVFFDLTIGGTPAGRVVMELYADTVPKTAENFRALCTGEKGVGRMGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF +KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFKRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEG DV+KK E VGSGSGRCS
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGYDVIKKAEAVGSGSGRCS  160



>ref|XP_006298687.1| hypothetical protein CARUB_v10014779mg [Capsella rubella]
 gb|EOA31585.1| hypothetical protein CARUB_v10014779mg [Capsella rubella]
Length=172

 Score =   267 bits (683),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQ  GRIVMELFADTTP+TAENFRALCTGE+G+GKSGKPLHYKGS+F
Sbjct  1    MANPKVFFDMTVGGQSAGRIVMELFADTTPETAENFRALCTGERGMGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG KFKDENF+KKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENFIKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEGL+VV+ +E+VGS SGR S
Sbjct  121  ICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTS  160



>gb|ACT63839.1| cydophilin [Gossypium hirsutum]
Length=173

 Score =   267 bits (682),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            +  NP+VFFD+T+GGQP GRIVME FAD TP+TAENFRALCTGEKGVG+SGKPLHYK S+
Sbjct  1    MASNPKVFFDMTIGGQPAGRIVMEPFADCTPRTAENFRALCTGEKGVGRSGKPLHYKSSS  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQF
Sbjct  61   FHRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            FICTAKTEWLDGKHVVFGQVVEG+DVVK +E+VGS SGR S
Sbjct  121  FICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTS  161



>ref|XP_003631573.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Vitis vinifera]
 emb|CAN77164.1| hypothetical protein VITISV_029833 [Vitis vinifera]
Length=172

 Score =   267 bits (682),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+++GG P GRIVMEL+ADTTP+TAENFRALCTGEKGVG+SGKPLH+KGS F
Sbjct  1    MTNPRVFFDVSIGGAPAGRIVMELYADTTPRTAENFRALCTGEKGVGRSGKPLHFKGSIF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFT G+GTGGESIYG+KF+DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPSFMCQGGDFTRGDGTGGESIYGAKFEDENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK VE+VGSGSGR +
Sbjct  121  ICTDKTEWLDGKHVVFGQVVEGMDVVKAVEKVGSGSGRTA  160



>gb|KJB77728.1| hypothetical protein B456_012G153200 [Gossypium raimondii]
Length=173

 Score =   267 bits (682),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFD+T+GGQP GRIVMELFAD TP+TAENFRALCTGEKGVG+SGKPLHYKGS FHR
Sbjct  4    NPKVFFDMTIGGQPAGRIVMELFADVTPRTAENFRALCTGEKGVGRSGKPLHYKGSKFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP+FMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFFIC
Sbjct  64   VIPDFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            TAKTEWLDG HVVFGQVVEG+DVVK +E+VGS SGR +
Sbjct  124  TAKTEWLDGMHVVFGQVVEGMDVVKAIEKVGSSSGRTA  161



>ref|XP_010066256.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Eucalyptus grandis]
Length=172

 Score =   266 bits (681),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            MGNP+VFFD+++GGQP GRIVMEL+AD  P+TAENFRALCTGEKG G+SGKPLHYKGS+F
Sbjct  1    MGNPKVFFDMSIGGQPAGRIVMELYADVVPRTAENFRALCTGEKGAGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CTAKTEWLDGKHVVFGQ+V+G+DVVK +E+VGS SGR S
Sbjct  121  VCTAKTEWLDGKHVVFGQIVDGMDVVKAIEKVGSSSGRTS  160



>gb|AGS78046.1| cyclophilin 1 [Aeschynomene sensitiva]
 gb|AGS78051.1| cyclophilin 1 [Aeschynomene pratensis]
Length=172

 Score =   266 bits (681),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQP GR+V ELF DTTP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQPVGRVVFELFKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENF++KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEGLDVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGLDVVKEIEKVGSSSGKTS  160



>ref|XP_011092880.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like [Sesamum 
indicum]
Length=171

 Score =   266 bits (680),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TV GQP GRIVMEL+AD  P+TAENFRALCTGEKG GKSGKPLH+KGSTF
Sbjct  1    MANPKVFFDMTVDGQPAGRIVMELYADVVPKTAENFRALCTGEKGTGKSGKPLHFKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF+DENFVKKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFEDENFVKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEG DVVK +E+VGSG G+ S
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGYDVVKAIEKVGSGGGKTS  160



>ref|XP_010526905.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Tarenaya hassleriana]
Length=172

 Score =   266 bits (680),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+ VGG P GRIVMELFADTTP+TAENFRALCTGEKGVG+ GKPLHYKGSTF
Sbjct  1    MPNPRVFFDMAVGGAPAGRIVMELFADTTPETAENFRALCTGEKGVGRMGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KFKDENF+KKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFIKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTA+T WLDGKHVVFGQVVEGLDVVK +E VGS SG+ +
Sbjct  121  ICTAQTSWLDGKHVVFGQVVEGLDVVKGIEGVGSQSGKTA  160



>gb|ABZ88806.1| cyclophilin [Hevea brasiliensis]
Length=172

 Score =   266 bits (679),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GG P GRIVMELFADTTP+TAENFRALCTGEKG+G+S KPLHYKGS+F
Sbjct  1    MANPKVFFDMTIGGAPAGRIVMELFADTTPRTAENFRALCTGEKGIGRSRKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFG+VVEG+DVVK +E+VGS SGR S
Sbjct  121  ICTAKTEWLDGKHVVFGRVVEGMDVVKTIEKVGSSSGRTS  160



>dbj|BAB82452.1| CYP1 [Vigna radiata]
Length=172

 Score =   266 bits (679),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP G+IV ELFADTTP+TAENFRALCTGEKGVG+SGKPLHYKGS F
Sbjct  1    MPNPKVFFDMTIGGQPAGKIVFELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSIF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEGL+VVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGLNVVKEIEKVGSSSGKTS  160



>ref|XP_002305488.1| Peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
 gb|ABK92717.1| unknown [Populus trichocarpa]
 gb|ABK94781.1| unknown [Populus trichocarpa]
 gb|EEE85999.1| Peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
Length=172

 Score =   266 bits (679),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQ  GRIVMELFAD  P+TAENFRALCTGEKGVGKSGKPLH+KGS+F
Sbjct  1    MSNPKVFFDMTVGGQSVGRIVMELFADIVPRTAENFRALCTGEKGVGKSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CT KTEWLDGKHVVFGQVVEG+DVVK +E+VGSG+GR S
Sbjct  121  VCTVKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSGNGRTS  160



>gb|ABV26711.1| cyclophilin [Gerbera hybrid cultivar]
Length=172

 Score =   266 bits (679),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGG P GRIVMEL+ADTTP+TAENFRALCTGEKG G SGKPLH+KGS+F
Sbjct  1    MANPKVFFDMTVGGAPAGRIVMELYADTTPRTAENFRALCTGEKGKGSSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFT GNGTGGESIYG+KF DENF+KKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTRGNGTGGESIYGNKFADENFIKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFG+V++G+DVVK +E+VGSGSG  S
Sbjct  121  ICTAKTEWLDGKHVVFGKVIDGMDVVKAIEKVGSGSGTTS  160



>gb|AGS78047.1| cyclophilin 1 [Aeschynomene sp. CPI104040]
Length=172

 Score =   266 bits (679),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQP GR+V ELF DTTP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQPVGRVVFELFKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF++KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFIRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEGLDVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGLDVVKEIEKVGSSSGKTS  160



>gb|AGL08208.1| cyclophilin [Arachis hypogaea]
 gb|AGL08219.1| cyclophilin [Arachis hypogaea]
Length=172

 Score =   265 bits (678),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+++GGQP GR+V ELFADT P+TAENFRALCTGEKGVG+ GKPLHYKGS+F
Sbjct  1    MANPKVYFDMSIGGQPAGRVVFELFADTVPRTAENFRALCTGEKGVGRGGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT+KTEWLDGKHVVFGQVVEG+DVVK VE+VGS SG+ S
Sbjct  121  ICTSKTEWLDGKHVVFGQVVEGMDVVKAVEKVGSSSGKTS  160



>gb|KDP36915.1| hypothetical protein JCGZ_08206 [Jatropha curcas]
Length=172

 Score =   265 bits (678),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+T+GG P GRIVMELFADTTP+TAENFRALCTGEKG+G+S KPLHYKGSTF
Sbjct  1    MANPKVYFDMTIGGAPAGRIVMELFADTTPRTAENFRALCTGEKGIGRSRKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFG++VEG+DVVK +E+VGS SGR S
Sbjct  121  ICTAKTEWLDGKHVVFGRIVEGMDVVKAIEKVGSSSGRTS  160



>ref|XP_007131600.1| hypothetical protein PHAVU_011G026900g [Phaseolus vulgaris]
 gb|ESW03594.1| hypothetical protein PHAVU_011G026900g [Phaseolus vulgaris]
Length=172

 Score =   265 bits (678),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP GRIV EL+AD TP+TAENFRALCTGEKGVG+SGKPLH+KGS F
Sbjct  1    MPNPKVFFDMTIGGQPAGRIVFELYADVTPRTAENFRALCTGEKGVGRSGKPLHFKGSIF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEGLDVVK +E+VGSGSG+ +
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGLDVVKDIEKVGSGSGKTA  160



>ref|XP_010447022.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Camelina sativa]
Length=171

 Score =   265 bits (677),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD++VGG P GRI+MEL+ADTTP TAENFRALCTGEKGVGK GKPLH+KGS+F
Sbjct  1    MANPKVFFDMSVGGAPAGRILMELYADTTPNTAENFRALCTGEKGVGKMGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KFKDENFVKKHTG GILSMAN+GPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFVKKHTGAGILSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKT WLDGKHVVFGQVVEGLDVVK +E+VGS SGR S
Sbjct  121  ICTAKTSWLDGKHVVFGQVVEGLDVVKAIEKVGSDSGRTS  160



>sp|Q8W171.1|CYP1_SOYBN RecName: Full=Peptidyl-prolyl cis-trans isomerase 1; Short=PPIase 
1; AltName: Full=Cyclophilin 1; AltName: Full=Cyclosporin 
A-binding protein 1; AltName: Full=Rotamase 1 [Glycine max]
 gb|AAL51087.1|AF456323_1 cyclophilin [Glycine max]
Length=172

 Score =   265 bits (677),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQ  GRIVMEL+AD TP+TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MPNPKVFFDMTIGGQSAGRIVMELYADVTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPSFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQV+EGL+VVK +E+VGSGSGR S
Sbjct  121  ICTEKTEWLDGKHVVFGQVIEGLNVVKDIEKVGSGSGRTS  160



>emb|CBJ93268.1| cyclophilin [Vigna mungo]
Length=172

 Score =   265 bits (677),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP GRIV EL+ADTTP+TAENFRALCTGEKGVG+SGKPLHYKGS F
Sbjct  1    MPNPKVFFDMTIGGQPAGRIVFELYADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSIF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEGL+VVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGLNVVKEIEKVGSCSGKTS  160



>ref|XP_004505696.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like [Cicer 
arietinum]
Length=172

 Score =   265 bits (677),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG   GRIV ELFAD TP+TAENFRALCTGEKGVG+SGKPLH+KGS+F
Sbjct  1    MPNPRVFFDMTVGGTAAGRIVFELFADVTPRTAENFRALCTGEKGVGRSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CTAKTEWLDGKHVVFGQVVEGLDVVK++E+VGS SG+ S
Sbjct  121  VCTAKTEWLDGKHVVFGQVVEGLDVVKEIEKVGSSSGKTS  160



>ref|XP_010530785.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Tarenaya 
hassleriana]
Length=172

 Score =   265 bits (676),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ VG  P GRIVMELFADTTP TAENFRALCTGEKGVG+SGKPLHYKGSTF
Sbjct  1    MPNPKVFFDMAVGDAPAGRIVMELFADTTPDTAENFRALCTGEKGVGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KFKDENF+KKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFIKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEGLDVV+ +E+VGS SG+ S
Sbjct  121  ICTEKTSWLDGKHVVFGQVVEGLDVVRAIEKVGSQSGKTS  160



>ref|XP_010090292.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
 gb|EXB39262.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
Length=173

 Score =   265 bits (676),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            +  NP+VFFDI +GGQP GRIV+EL+AD TP+TAENFRALCTGEKG+G+SGKPLHYKGS+
Sbjct  1    MAANPKVFFDIAIGGQPVGRIVIELYADVTPRTAENFRALCTGEKGIGRSGKPLHYKGSS  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHRVIP FMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQF
Sbjct  61   FHRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            FICTAKTEWLDGKHVVFG+VVEG DVVK  E+VGS SGR S
Sbjct  121  FICTAKTEWLDGKHVVFGKVVEGYDVVKAAEKVGSSSGRVS  161



>ref|XP_004500742.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Cicer arietinum]
Length=196

 Score =   265 bits (678),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQP GRIVMEL++DTTP TA+NFRALCTGEKG G+SGKPLHYKGS+F
Sbjct  25   MSNPKVFFDMTVGGQPAGRIVMELYSDTTPLTADNFRALCTGEKGTGRSGKPLHYKGSSF  84

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF+K HTGPG+LSMANAGP TNGSQFF
Sbjct  85   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFIKTHTGPGVLSMANAGPGTNGSQFF  144

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ S
Sbjct  145  ICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTS  184



>ref|XP_002884009.1| hypothetical protein ARALYDRAFT_899976 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60268.1| hypothetical protein ARALYDRAFT_899976 [Arabidopsis lyrata subsp. 
lyrata]
Length=173

 Score =   264 bits (675),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+V+FD+TVGGQP GRIVMELFADTTP+TAENFRALCTGEKG+GKSGKPLHYKGS+FHR
Sbjct  4    NPKVYFDMTVGGQPAGRIVMELFADTTPETAENFRALCTGEKGIGKSGKPLHYKGSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGGESIYG KFKDENFVKKHTGPGILSMANAG NTNGSQFFIC
Sbjct  64   VIPKFMCQGGDFTAGNGTGGESIYGLKFKDENFVKKHTGPGILSMANAGINTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            T KT WLDGKHVVFGQVVEGL+VV+ +E+VGS SGR S
Sbjct  124  TEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTS  161



>gb|KDP27580.1| hypothetical protein JCGZ_19585 [Jatropha curcas]
Length=172

 Score =   264 bits (675),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ VGGQP GRIVMEL+ D  P+TAENFRALCTGEKG+GKSGKPLHYKGS+F
Sbjct  1    MANPKVFFDMAVGGQPVGRIVMELYQDVVPRTAENFRALCTGEKGIGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            IC AKTEWLDGKHVVFGQVVEG+DVVK +E+VGS SGR S
Sbjct  121  ICVAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTS  160



>ref|XP_003607272.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
 gb|AES89469.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
 gb|AFK46952.1| unknown [Medicago truncatula]
Length=172

 Score =   264 bits (675),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD++VGG P GRI+ ELFAD TP+TAENFRALCTGEKGVG+SGKPLH+KGS+F
Sbjct  1    MVNPKVFFDMSVGGNPAGRIIFELFADVTPRTAENFRALCTGEKGVGRSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPQFMCQGGDFTNGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEGLD+VK++E+VGSGSG+ S
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGLDIVKEIEKVGSGSGKTS  160



>gb|ABY57946.1| cyclophilin [Arachis diogoi]
Length=172

 Score =   264 bits (675),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+++GGQP GR+V ELFADT P+TAENFRALCTGEKGVG+ GKPLHYKGS+F
Sbjct  1    MANPKVYFDMSIGGQPAGRVVFELFADTVPRTAENFRALCTGEKGVGRGGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT+KTEWLDGKHVVFGQVVEG+DVVK VE+VGS SG+ +
Sbjct  121  ICTSKTEWLDGKHVVFGQVVEGMDVVKAVEKVGSSSGKTT  160



>ref|XP_007041920.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
 gb|EOX97751.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Theobroma cacao]
Length=173

 Score =   264 bits (675),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFD+T+GGQP GRIVMELFAD TP+TAENFRALCTGEKGVG+SGKPLHYKGS+FHR
Sbjct  4    NPKVFFDMTIGGQPAGRIVMELFADCTPRTAENFRALCTGEKGVGRSGKPLHYKGSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIPNFMCQGGDFTAGNGTGGESIYG+KF DENF KKHTGPG+LSMANAGP TNGSQFF+C
Sbjct  64   VIPNFMCQGGDFTAGNGTGGESIYGAKFADENFEKKHTGPGVLSMANAGPGTNGSQFFVC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            T KTEWLDGKHVVFGQVVEG+DVVK +E+VGS  GR S
Sbjct  124  TTKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSGGRTS  161



>gb|AGS78042.1| cyclophilin 1 [Aeschynomene indica]
 gb|AGS78053.1| cyclophilin 1 [Aeschynomene virginica]
Length=172

 Score =   264 bits (675),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQP GRIV EL+ DTTP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQPVGRIVFELYKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF++KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGTKFADENFIRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTS  160



>gb|AGS78044.1| cyclophilin 1 [Aeschynomene scabra]
Length=172

 Score =   264 bits (674),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQP GRIV EL+ DTTP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQPVGRIVFELYKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF++KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGTKFADENFIRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTS  160



>gb|AEY79726.1| cyclophilin [Daucus carota]
Length=171

 Score =   264 bits (674),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GG P G+IVMEL+ADTTP+TAENFRALCTGEKG GKSGKPLHYKGS+F
Sbjct  1    MANPKVFFDMTIGGTPAGKIVMELYADTTPKTAENFRALCTGEKGTGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF +KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFERKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFG+VVEG+DVVK +E+VGSGSG+ S
Sbjct  121  ICTAKTEWLDGKHVVFGKVVEGMDVVKAIEKVGSGSGKTS  160



>emb|CAA52414.1| cyclophilin [Phaseolus vulgaris]
Length=172

 Score =   264 bits (674),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP GRIV EL+AD TP+TAENFRALCTGEKGVG+SGKP+H+KGS F
Sbjct  1    MPNPKVFFDMTIGGQPAGRIVFELYADVTPRTAENFRALCTGEKGVGRSGKPVHFKGSIF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEGLDVVK +E+VGSGSG+ +
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGLDVVKDIEKVGSGSGKTA  160



>gb|ACB05668.1| cyclophilin [Capsicum annuum]
Length=172

 Score =   264 bits (674),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP GR+VMELFA+  P+TAENFRALCTGEKGVG+ GKPLHYKGSTF
Sbjct  1    MANPKVFFDLTIGGQPAGRVVMELFANDVPKTAENFRALCTGEKGVGRMGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF +KHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFKRKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEG DV+KK E VGS SGRCS
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGFDVIKKAEAVGSSSGRCS  160



>ref|XP_003537761.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like [Glycine 
max]
Length=172

 Score =   263 bits (673),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQ  GRIVMEL+AD TP+TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MPNPKVFFDMTIGGQSAGRIVMELYADVTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPSFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQV+EGL+VVK +E+VGS SGR S
Sbjct  121  ICTEKTEWLDGKHVVFGQVIEGLNVVKDIEKVGSSSGRTS  160



>emb|CAC84116.1| peptidylprolyl isomerase (cyclophilin) [Betula pendula]
Length=173

 Score =   263 bits (673),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFD+ VGGQP GRIVMEL+ADTTP+TAENFRALCTGEKG G+SGKPLHYK S+FHR
Sbjct  4    NPKVFFDMEVGGQPVGRIVMELYADTTPRTAENFRALCTGEKGNGRSGKPLHYKKSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFFIC
Sbjct  64   VIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            TAKTEWLDGKHVVFGQVVEGLD+VK +E+VGS SGR S
Sbjct  124  TAKTEWLDGKHVVFGQVVEGLDIVKAIEKVGSSSGRTS  161



>gb|EYU40419.1| hypothetical protein MIMGU_mgv1a014991mg [Erythranthe guttata]
Length=171

 Score =   263 bits (672),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+T+GGQP GRI+MEL+AD  P+TAENFRALCTGEKGVGK GKPLHYKGS F
Sbjct  1    MANPRVFFDLTIGGQPAGRIIMELYADVVPKTAENFRALCTGEKGVGKCGKPLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPGILSMAN+GP TNGSQFF
Sbjct  61   HRVIPDFMCQGGDFTAGNGTGGESIYGSKFNDENFVKKHTGPGILSMANSGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT+KTEWLDGKHVVFG+VVEG +VVK  E+VGSGSGR S
Sbjct  121  ICTSKTEWLDGKHVVFGKVVEGYEVVKAAEKVGSGSGRTS  160



>gb|AAN72439.1| cyclophilin [Kandelia candel]
Length=172

 Score =   263 bits (672),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD++VGG P GRIVMELFAD  P+T ENFRALCTGEKG G+SGKPLHYKGSTF
Sbjct  1    MANPRVYFDMSVGGSPAGRIVMELFADVVPRTTENFRALCTGEKGKGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            H VIPNFMCQGGDFTAGN TGGESIYGSKF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HLVIPNFMCQGGDFTAGNETGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVV G+DVVK +E+VGSG+GR S
Sbjct  121  ICTAKTEWLDGKHVVFGQVVYGMDVVKAIEKVGSGNGRTS  160



>gb|AIX10768.1| cyclophilin [Panax notoginseng]
Length=172

 Score =   263 bits (672),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ +GG P GRI+MEL+ADTTP+TAENFRALCTGEKG+GK+GKPLHYKGS+F
Sbjct  1    MANPKVFFDMAIGGTPAGRIIMELYADTTPKTAENFRALCTGEKGIGKAGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTG GILSMANAGP TNGSQFF
Sbjct  61   HRVIPQFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGAGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWL+GKHVVFGQV+EGLDVVK +E++GS SGR S
Sbjct  121  ICTAKTEWLNGKHVVFGQVIEGLDVVKAIEKMGSSSGRTS  160



>ref|XP_011045074.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Populus 
euphratica]
Length=172

 Score =   263 bits (672),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+T+GG P GRIVMELFADTTP+TAENFRALCTGEKG G+SGKPLHYKGSTF
Sbjct  1    MANPKVYFDMTIGGAPAGRIVMELFADTTPRTAENFRALCTGEKGKGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFG+VVEG++VVK +E+VGS SGR S
Sbjct  121  ICTDKTEWLDGKHVVFGRVVEGMNVVKAIEKVGSSSGRTS  160



>gb|AFP44118.1| cyclophilin [Lycoris longituba]
Length=173

 Score =   263 bits (671),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            +  NP+VFFD+TVGG P GRIVMELFAD  P+T ENFRALCTGEKGVG+SGKPLHYKGS+
Sbjct  1    MAANPKVFFDMTVGGAPAGRIVMELFADVVPRTTENFRALCTGEKGVGRSGKPLHYKGSS  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENFV+KHTGPGILSMANAGPNTNGSQF
Sbjct  61   FHRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVRKHTGPGILSMANAGPNTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            F+CT KT WLDGKHVVFGQVVEG+DVV+ +E+VGS SGR S
Sbjct  121  FVCTEKTAWLDGKHVVFGQVVEGMDVVRAIEKVGSQSGRTS  161



>gb|ADV04050.1| cyclophilin [Hevea brasiliensis]
Length=172

 Score =   263 bits (671),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD++VGG P G+IVMEL+AD  P+TAENFRALCTGEKG+GKSGKPLHYKGS+F
Sbjct  1    MANPKVFFDMSVGGHPAGKIVMELYADVVPRTAENFRALCTGEKGIGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF KKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFTKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CTAKTEWLDGKHVVFGQVVEG+DVVK +E+VGS SGR S
Sbjct  121  VCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTS  160



>gb|AEM44784.1| cyclophilin [Momordica charantia]
Length=172

 Score =   263 bits (671),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP GRIVMEL+A+  P+TAENFRALCTGEKG G+SGKPLHYKGS+F
Sbjct  1    MANPKVFFDMTIGGQPAGRIVMELYANVVPRTAENFRALCTGEKGNGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQ+V+G+DVVK VE+VGS SGR S
Sbjct  121  ICTAKTEWLDGKHVVFGQIVDGMDVVKAVEKVGSSSGRTS  160



>dbj|BAA25755.1| vcCyP [Vicia faba]
Length=171

 Score =   263 bits (671),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQ  GRI+ ELFAD TP+TAENFRALCTGEKGVG+SGKPLH+KGS+F
Sbjct  1    MSNPKVFFDMTVGGQNAGRIIFELFADVTPRTAENFRALCTGEKGVGRSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKT+WLDGKHVVFGQVV+GL+VV+ +E+VGSGSG+ S
Sbjct  121  ICTAKTDWLDGKHVVFGQVVDGLNVVRDIEKVGSGSGKTS  160



>gb|AGS78049.1| cyclophilin 1 [Aeschynomene tambacoundensis]
Length=172

 Score =   262 bits (670),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQP GRIV EL+ DTTP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQPVGRIVFELYKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF++KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFPDENFIRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ +
Sbjct  121  ICTEKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTA  160



>ref|XP_010548088.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Tarenaya 
hassleriana]
Length=172

 Score =   262 bits (670),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+ VG  P GRIVMELFADTTP TAENFRALCTGEKGVG+SGKPLHYKGSTF
Sbjct  1    MPNPRVFFDMAVGDAPAGRIVMELFADTTPVTAENFRALCTGEKGVGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KFKDENF++KHTGPG+LSMAN+GPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFIRKHTGPGVLSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CT +T WLDGKHVVFGQVVEG+DVVK +E+VGS SGR S
Sbjct  121  VCTEQTAWLDGKHVVFGQVVEGMDVVKAIEKVGSQSGRTS  160



>emb|CDP07390.1| unnamed protein product [Coffea canephora]
Length=172

 Score =   262 bits (670),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+++GG P GRI MEL+ADTTP+TAENFRALCTGEKGVG+SGKPLH+KGSTF
Sbjct  1    MSNPKVFFDMSIGGSPAGRICMELYADTTPRTAENFRALCTGEKGVGRSGKPLHFKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF+DENF+KKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFEDENFIKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFG++ EG+DVVK VE+VGS SGR S
Sbjct  121  ICTDKTAWLDGKHVVFGRITEGMDVVKAVEKVGSSSGRTS  160



>gb|AGS78048.1| cyclophilin 1 [Aeschynomene filosa]
Length=172

 Score =   262 bits (670),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQP GRIV EL+ DTTP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQPVGRIVFELYKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF++KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFIRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVV+++E+VGS SG+ +
Sbjct  121  ICTEKTEWLDGKHVVFGQVVEGMDVVREIEKVGSSSGKTA  160



>gb|ABK21176.1| unknown [Picea sitchensis]
 gb|ABK21935.1| unknown [Picea sitchensis]
 gb|ABK22303.1| unknown [Picea sitchensis]
 gb|ABK25721.1| unknown [Picea sitchensis]
 gb|ACN40344.1| unknown [Picea sitchensis]
Length=171

 Score =   262 bits (669),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+F++TVGG P GRIVMELFAD TP+TAENFRALCTGE GVGKSGKPLHYKGS+F
Sbjct  1    MPNPKVYFEMTVGGAPVGRIVMELFADVTPKTAENFRALCTGEIGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFPDENFVKKHTGPGILSMANAGKNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CTAKTEWLDGKHVVFGQVVEGLDVVK +E VGS SGR S
Sbjct  121  VCTAKTEWLDGKHVVFGQVVEGLDVVKVIEGVGSSSGRTS  160



>gb|ABQ14358.1| putative cyclophilin [Pinus taeda]
Length=171

 Score =   262 bits (669),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD++VGG P GRIVMELFAD TP+TAENFRALCTGE GVGKSGKPLHYKGS F
Sbjct  1    MPNPKVYFDMSVGGAPAGRIVMELFADVTPKTAENFRALCTGEIGVGKSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGNKFPDENFVKKHTGPGILSMANAGKNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQVVEGLDVVK +E VGS SGR S
Sbjct  121  ICTAKTEWLDGKHVVFGQVVEGLDVVKAIEGVGSSSGRTS  160



>gb|AFY13527.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AFY13528.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AFY13529.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AFY13530.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AGC95051.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AGC95052.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AGS78039.1| cyclophilin 1 [Aeschynomene indica]
 gb|AGS78041.1| cyclophilin 1 [Aeschynomene indica]
Length=172

 Score =   261 bits (668),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQ  GRIV EL+ DTTP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQSVGRIVFELYKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF++KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFIRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTS  160



>gb|AFY13525.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AFY13526.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AFY13531.1| cyclophilin 1 [Aeschynomene denticulata]
 gb|AGS78052.1| cyclophilin 1 [Aeschynomene virginica]
Length=172

 Score =   261 bits (668),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQ  GRIV EL+ DTTP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQSVGRIVFELYKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF++KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGTKFADENFIRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTS  160



>ref|XP_010432371.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Camelina 
sativa]
Length=171

 Score =   261 bits (667),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+++GG   GRIVMELFADTTP TAENFRALCTGEKGVGK GKPLHYKGS+F
Sbjct  1    MPNPKVFFDMSLGGASAGRIVMELFADTTPDTAENFRALCTGEKGVGKMGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KFKDENFVK+HTGPGILSMAN+GPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFVKRHTGPGILSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEGLDVV+ +E+VGS SGR S
Sbjct  121  ICTEKTSWLDGKHVVFGQVVEGLDVVRAIEKVGSDSGRTS  160



>ref|XP_010268679.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Nelumbo nucifera]
Length=173

 Score =   261 bits (667),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            +  NP+VFFD+++GG P GRIVMEL++D TP+TAENFRALCTGEKGVG+SGKPLHYKGS+
Sbjct  1    MAANPKVFFDMSIGGAPAGRIVMELYSDVTPRTAENFRALCTGEKGVGRSGKPLHYKGSS  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHR+IP FMCQGGDFTAGNGTGGESIYGSKF DENF++KHTGPG+LSMANAGP TNGSQF
Sbjct  61   FHRIIPGFMCQGGDFTAGNGTGGESIYGSKFADENFIRKHTGPGVLSMANAGPGTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            FICTAKTEWLDGKHVVFG+VVEG+DVVK +E+VGS SGR S
Sbjct  121  FICTAKTEWLDGKHVVFGRVVEGMDVVKALEKVGSSSGRTS  161



>sp|O49886.1|CYPH_LUPLU RecName: Full=Peptidyl-prolyl cis-trans isomerase; Short=PPIase; 
AltName: Full=Cyclophilin; AltName: Full=Cyclosporin A-binding 
protein; AltName: Full=Rotamase [Lupinus luteus]
 emb|CAA76054.1| cytosolic form of cyclophilin [Lupinus luteus]
 gb|AAF00471.1| cytosolic cyclophilin [Lupinus luteus]
Length=172

 Score =   261 bits (667),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ + G P GRIVMEL+ADTTP+TAENFRALCTGEKGVG+SGKPLHYKGSTF
Sbjct  1    MSNPKVFFDMAIAGNPAGRIVMELYADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTG ESIYG+KF DENF+K+HTGPGILSMANAG  TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGAESIYGAKFADENFIKRHTGPGILSMANAGAGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFG+V+EG++VV+ +E+VGSGSG+ S
Sbjct  121  ICTEKTEWLDGKHVVFGKVIEGMNVVRDIEKVGSGSGKTS  160



>gb|AFY13519.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AFY13520.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AFY13521.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AFY13522.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AFY13523.1| cyclophilin 1 [Aeschynomene evenia]
 gb|AFY13524.1| cyclophilin 1 [Aeschynomene evenia]
Length=172

 Score =   261 bits (667),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQ  GRIV EL+ DTTP TAENFRALCTGEKGVG+SGKPLHYKGS F
Sbjct  1    MANPRVYFDMAIGGQSVGRIVFELYKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF++KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGTKFADENFIRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTS  160



>ref|XP_006409418.1| hypothetical protein EUTSA_v10022880mg [Eutrema salsugineum]
 gb|AAR27291.1| cyclophilin [Eutrema halophilum]
 gb|ESQ50871.1| hypothetical protein EUTSA_v10022880mg [Eutrema salsugineum]
Length=173

 Score =   261 bits (667),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            +  NP+VFFD+TVGG P GRIVMEL+ADTTP+TAENFRALCTGEKG+GKSGKPLHYKGS 
Sbjct  1    MAANPKVFFDMTVGGSPAGRIVMELYADTTPETAENFRALCTGEKGMGKSGKPLHYKGSA  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHRVIP FMCQGGDFT GNGTGGESIYG KFKDENF KKHTGPGILSMANAG NTNGSQF
Sbjct  61   FHRVIPKFMCQGGDFTKGNGTGGESIYGMKFKDENFTKKHTGPGILSMANAGANTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            FICT KT WLDGKHVVFGQV+EG+DVV+ +E+VGS SG+ S
Sbjct  121  FICTEKTSWLDGKHVVFGQVIEGMDVVRAIEKVGSDSGKTS  161



>gb|AGS78040.1| cyclophilin 1 [Aeschynomene indica]
Length=172

 Score =   261 bits (666),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQP GRIV EL+ DTTP TAENFRALC GEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQPVGRIVFELYKDTTPNTAENFRALCAGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF++KHTGPG LSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGTKFADENFIRKHTGPGTLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTS  160



>ref|XP_010489230.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-1-like [Camelina 
sativa]
Length=172

 Score =   260 bits (665),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGG+  GRIVMEL+ADTTP+TAENFRALCT E+GVGKSGKPLHYKGS+F
Sbjct  1    MANPKVFFDMTVGGKLAGRIVMELYADTTPETAENFRALCTRERGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG KFKDENF+KKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPKFMCQGGDFTAGNGTGGESIYGLKFKDENFIKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEGL+VV+ +E+VGS +GR S
Sbjct  121  ICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDAGRTS  160



>gb|ACU14413.1| unknown [Glycine max]
Length=172

 Score =   260 bits (665),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQ  GRIVMEL+AD TP+TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MPNPKVFFDMTIGGQSAGRIVMELYADVTPRTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPSFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQV+EGL+VVK +E+VG  SGR S
Sbjct  121  ICTEKTEWLDGKHVVFGQVIEGLNVVKDIEKVGFSSGRTS  160



>gb|AGS78043.1| cyclophilin 1 [Aeschynomene indica]
Length=172

 Score =   260 bits (665),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQ  GRIV EL+ DTTP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQSVGRIVFELYKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF+ KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFIGKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTS  160



>ref|NP_179251.1| cyclophilin ROC3 [Arabidopsis thaliana]
 sp|Q38900.1|CP19A_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP19-1; Short=PPIase 
CYP19-1; AltName: Full=Cyclophilin of 19 kDa 1; AltName: 
Full=Rotamase cyclophilin-3 [Arabidopsis thaliana]
 gb|AAB96832.1| cytosolic cyclophilin [Arabidopsis thaliana]
 gb|AAD24594.1| cytosolic cyclophilin (ROC3) [Arabidopsis thaliana]
 gb|AAK82478.1| At2g16600/T24I21.1 [Arabidopsis thaliana]
 gb|AAM10293.1| At2g16600/T24I21.1 [Arabidopsis thaliana]
 gb|AAM64399.1| cytosolic cyclophilin ROC3 [Arabidopsis thaliana]
 gb|AEC06517.1| cyclophilin ROC3 [Arabidopsis thaliana]
Length=173

 Score =   260 bits (664),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+V+FD+TVGG+  GRIVMEL+ADTTP+TAENFRALCTGE+G+GK GKPLHYKGS+FHR
Sbjct  4    NPKVYFDMTVGGKSAGRIVMELYADTTPETAENFRALCTGERGIGKQGKPLHYKGSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGGESIYGSKFKDENF+KKHTGPGILSMANAG NTNGSQFFIC
Sbjct  64   VIPKFMCQGGDFTAGNGTGGESIYGSKFKDENFIKKHTGPGILSMANAGANTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            T KT WLDGKHVVFGQVVEGL+VV+ +E+VGS SGR S
Sbjct  124  TEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTS  161



>gb|AGS78050.1| cyclophilin 1 [Aeschynomene deamii]
Length=172

 Score =   260 bits (664),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQ  GRIV ELF DTTP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQSVGRIVFELFKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF+KKHT PGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTVPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTS  160



>gb|AAU87301.1| cyclophilin [Pinus halepensis]
Length=172

 Score =   260 bits (664),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ VGG P GRIVMEL+AD  P+TAENFRALCTGEKG G+SGKPLH+KGS+F
Sbjct  1    MPNPKVFFDMQVGGAPAGRIVMELYADVVPKTAENFRALCTGEKGTGRSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DENFVKKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTRGNGTGGESIYGEKFADENFVKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTA+T WLDGKHVVFGQVVEGL+VV+++E+VGSGSGR S
Sbjct  121  ICTAQTSWLDGKHVVFGQVVEGLEVVREIEKVGSGSGRTS  160



>gb|AIZ74330.1| cyclophilin [Pinus massoniana]
Length=172

 Score =   260 bits (664),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ VGG P GRIVMEL+AD  P+TAENFRALCTGEKG G+SGKPLH+KGS+F
Sbjct  1    MPNPKVFFDMQVGGAPAGRIVMELYADVVPKTAENFRALCTGEKGTGRSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DENFVKKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTRGNGTGGESIYGEKFADENFVKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTA+T WLDGKHVVFGQVVEGL+VV+++E+VGSGSGR S
Sbjct  121  ICTAQTSWLDGKHVVFGQVVEGLEVVREIEKVGSGSGRTS  160



>ref|XP_002274869.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Vitis vinifera]
 emb|CAN64643.1| hypothetical protein VITISV_030108 [Vitis vinifera]
Length=172

 Score =   260 bits (664),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD++VGG P GRIVMELFADTTP+TAENFRALCTGEKG G+SGKPLHYKGS F
Sbjct  1    MANPKVFFDMSVGGVPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENF+ KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFIHKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICTAKT WLDGKHVVFG+V+EGLDVVK +E+VGS SG
Sbjct  121  ICTAKTSWLDGKHVVFGKVIEGLDVVKAIEKVGSSSG  157



>ref|XP_006487422.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like [Citrus 
sinensis]
 gb|KDO38753.1| hypothetical protein CISIN_1g030245mg [Citrus sinensis]
Length=180

 Score =   260 bits (665),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGGQP GRIVMELFAD TP+TAENFRALCTGEKG+GKSGKPLHYKGS+F
Sbjct  1    MANPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            I   KTEWLDGKHV FGQVVEG++VVK +E++GS SGR
Sbjct  121  ISAGKTEWLDGKHVAFGQVVEGMNVVKAIEKMGSRSGR  158



>gb|ABK26198.1| unknown [Picea sitchensis]
Length=171

 Score =   259 bits (663),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+F++TVGG P GRIVMELFAD  P+TAENFRALCTGE GVGKSGKPLHYKGS+F
Sbjct  1    MPNPKVYFEMTVGGAPVGRIVMELFADVRPKTAENFRALCTGEIGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENFVKKHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFPDENFVKKHTGPGILSMANAGKNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CTAKTEWLDGKHVVFGQVVEGLDVVK +E VGS SGR S
Sbjct  121  VCTAKTEWLDGKHVVFGQVVEGLDVVKVIEGVGSSSGRTS  160



>gb|AGC95053.1| cyclophilin 1 [Aeschynomene ciliata]
Length=172

 Score =   259 bits (663),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +GGQ  GRIV EL+ D TP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGGQSVGRIVFELYKDITPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF++KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGTKFADENFIRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTS  160



>gb|AGS78045.1| cyclophilin 1 [Aeschynomene rudis]
Length=172

 Score =   259 bits (662),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+FD+ +G Q  GRIV EL+ DTTP TAENFRALCTGEKGVG+SGKPLHYKGS+F
Sbjct  1    MANPRVYFDMAIGSQSVGRIVFELYKDTTPNTAENFRALCTGEKGVGRSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF++KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGTKFADENFIRKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFGQVVEG+DVVK++E+VGS SG+ S
Sbjct  121  ICTTKTEWLDGKHVVFGQVVEGMDVVKEIEKVGSSSGKTS  160



>emb|CAA69622.1| cyclophylin [Digitalis lanata]
Length=172

 Score =   259 bits (661),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GGQP GRIVMEL+AD  P+TAENFRALCTGEKGVGK+GKPLHYKGS F
Sbjct  1    MSNPKVFFDMTIGGQPCGRIVMELYADVVPKTAENFRALCTGEKGVGKTGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            ICT KT WLDGKHVVFGQVVEG+DVV+ +E+VGS SG+
Sbjct  121  ICTEKTSWLDGKHVVFGQVVEGMDVVRAIEKVGSQSGK  158



>ref|XP_010941286.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-1 [Elaeis 
guineensis]
Length=173

 Score =   259 bits (661),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NPRVFFD+ +GG P GRIVMEL+AD  P+TAENFRALCTGEKGVG+SGKPLHYKGSTFHR
Sbjct  4    NPRVFFDMAIGGAPAGRIVMELYADVVPRTAENFRALCTGEKGVGRSGKPLHYKGSTFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGGESIYG+KF+DENF+KKHTG G+LSMANAG NTNGSQFFIC
Sbjct  64   VIPGFMCQGGDFTAGNGTGGESIYGAKFQDENFIKKHTGSGVLSMANAGANTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            TA T WLDGKHVVFGQVVEGLDVV+ +E+VGS SGR S
Sbjct  124  TATTSWLDGKHVVFGQVVEGLDVVRSIEKVGSQSGRTS  161



>ref|XP_006412177.1| hypothetical protein EUTSA_v10027585mg, partial [Eutrema salsugineum]
 gb|ESQ53630.1| hypothetical protein EUTSA_v10027585mg, partial [Eutrema salsugineum]
Length=202

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NPRVFFD+T+ G P GRIVMELFADTTP TAENFRALCTGEKGVGK GKPLHYKGSTFHR
Sbjct  33   NPRVFFDMTIDGAPAGRIVMELFADTTPNTAENFRALCTGEKGVGKLGKPLHYKGSTFHR  92

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFT+GNGTGGESIYG+KFKDENF+KKHTGPGILSMAN+GPNTNGSQFFIC
Sbjct  93   VIPGFMCQGGDFTSGNGTGGESIYGTKFKDENFIKKHTGPGILSMANSGPNTNGSQFFIC  152

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            T+ T WLDG HVVFGQVVEG+DV+K +E+VGS SGR S
Sbjct  153  TSVTSWLDGAHVVFGQVVEGIDVLKPIERVGSESGRTS  190



>ref|XP_009112393.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Brassica rapa]
 emb|CDY47469.1| BnaA09g08780D [Brassica napus]
Length=171

 Score =   258 bits (660),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+TVG +  GRIVMEL+ADT P+TAENFRALCTGEKG+GKSGKPLHYKGS F
Sbjct  1    MVNPKVYFDMTVGDKAAGRIVMELYADTVPETAENFRALCTGEKGIGKSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG KFKDENFVKKHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENFVKKHTGPGILSMANAGSNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEG+DVV+ +E+VGS SGR S
Sbjct  121  ICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSGRTS  160



>ref|XP_010437558.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Camelina sativa]
Length=171

 Score =   258 bits (660),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+++GG   GRIVMELFADTTP TAENFRALCTGEKGVG+ GKPLHYKGS+F
Sbjct  1    MPNPKVFFDMSLGGASAGRIVMELFADTTPDTAENFRALCTGEKGVGRMGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KFKDENFVKKHTG GILSMAN+GPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFVKKHTGAGILSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEGLDVV+ +E+VGS SGR S
Sbjct  121  ICTEKTSWLDGKHVVFGQVVEGLDVVRAIEKVGSESGRTS  160



>gb|ACV88654.1| cyclophilin [Pinus massoniana]
Length=172

 Score =   258 bits (660),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ VGG P GRIVMEL+AD  P+TAENFRALCTGEKG G+SGKPLH+KGS+F
Sbjct  1    MPNPKVFFDMQVGGAPAGRIVMELYADVVPKTAENFRALCTGEKGTGRSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DENFVKKHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTRGNGTGGESIYGEKFADENFVKKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTA+T WLDGKHVVFG+VVEGL+VV+++E+VGSGSGR S
Sbjct  121  ICTAQTSWLDGKHVVFGRVVEGLEVVREIEKVGSGSGRTS  160



>dbj|BAE92296.1| putative peptidyl-prolyl cis-trans isomerase [Cryptomeria japonica]
Length=171

 Score =   258 bits (660),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFF++ VGG P GRIVMEL+AD TP+TAENFRALCTGEKG GKSGKPLH+KGS+F
Sbjct  1    MANPRVFFEMAVGGAPAGRIVMELYADVTPKTAENFRALCTGEKGTGKSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYGSKF DENF K+HTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGSKFPDENFQKRHTGPGILSMANAGKNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFGQ+V+G+DVV+ +E+VGS SGR S
Sbjct  121  ICTAKTEWLDGKHVVFGQIVDGMDVVRAIERVGSSSGRTS  160



>emb|CAC81066.1| putative cyclosporin A-binding protein [Picea abies]
 gb|ABK25001.1| unknown [Picea sitchensis]
 gb|ABK25084.1| unknown [Picea sitchensis]
 gb|ABK26413.1| unknown [Picea sitchensis]
Length=172

 Score =   258 bits (660),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+ VGG P GRIVMEL+AD  P+TAENFRALCTGE+G G+SGKPLH+K STF
Sbjct  1    MSNPKVFFDMQVGGAPAGRIVMELYADVVPKTAENFRALCTGERGTGRSGKPLHFKSSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DENF +KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTRGNGTGGESIYGEKFADENFARKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTA+T WLDGKHVVFGQVVEGLDVV+++E+VGSGSGR S
Sbjct  121  ICTAQTSWLDGKHVVFGQVVEGLDVVREIEKVGSGSGRTS  160



>emb|CDY26779.1| BnaC09g09060D [Brassica napus]
Length=171

 Score =   258 bits (658),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+TVG +  GRIVMEL+ADT P+TAENFRALCTGE+G+GKSGKPLHYKGS F
Sbjct  1    MVNPKVYFDMTVGDKAAGRIVMELYADTVPETAENFRALCTGERGIGKSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG KFKDENFVKKHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENFVKKHTGPGILSMANAGSNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEG+DVV+ +E+VGS SGR S
Sbjct  121  ICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSGRTS  160



>ref|XP_002306932.1| Peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
 gb|ABK92489.1| unknown [Populus trichocarpa]
 gb|EEE93928.1| Peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
Length=172

 Score =   257 bits (656),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+T+GG P GRIV+ELFADTTP+TAENFRALCTGEKG G+SGKPLHYKGSTF
Sbjct  1    MANPKVYFDMTIGGVPAGRIVIELFADTTPRTAENFRALCTGEKGKGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMAN+GP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANSGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFG+VVEG++VVK +E+VGS  GR S
Sbjct  121  ICTDKTEWLDGKHVVFGKVVEGMNVVKAIEKVGSSGGRTS  160



>ref|XP_006286099.1| hypothetical protein CARUB_v10007642mg [Capsella rubella]
 gb|EOA18997.1| hypothetical protein CARUB_v10007642mg [Capsella rubella]
Length=172

 Score =   257 bits (656),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+++ G PTGRIVMELFAD TP TAENFRALCTGEKG+GK GKPLH+KGSTF
Sbjct  1    MPNPKVFFDMSLNGAPTGRIVMELFADVTPNTAENFRALCTGEKGIGKMGKPLHFKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KFKDENF+KKHTG GILSMAN+GPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFIKKHTGAGILSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTA T WLDGKHVVFGQVVEGL+VVK +E+VGS SGR S
Sbjct  121  ICTAPTSWLDGKHVVFGQVVEGLNVVKAIEKVGSDSGRTS  160



>gb|AGT16090.1| cyclophilin [Saccharum hybrid cultivar R570]
 gb|AGT17009.1| cyclophilin [Saccharum hybrid cultivar R570]
 gb|AGT17208.1| cyclophilin [Saccharum hybrid cultivar R570]
 gb|AGT17331.1| cyclophilin [Saccharum hybrid cultivar R570]
Length=172

 Score =   256 bits (655),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+A+  P+TAENFRALCTGEKGVGKSGKPLHYKGSTF
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DE FV+KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPQFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT +T WLDGKHVVFGQVVEG+DVVK +E+VGS SG  S
Sbjct  121  ICTVETPWLDGKHVVFGQVVEGMDVVKAIEKVGSRSGSTS  160



>ref|XP_010061075.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like [Eucalyptus 
grandis]
 gb|KCW67974.1| hypothetical protein EUGRSUZ_F01666 [Eucalyptus grandis]
Length=172

 Score =   256 bits (655),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GG   GR+VMEL+ADTTP+TAENFRALCTGEKGVG+S KPLHYKGS F
Sbjct  1    MPNPKVFFDMTIGGAAAGRVVMELYADTTPRTAENFRALCTGEKGVGRSRKPLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPSFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFG+VVEG++VVK +E+VGS SGR S
Sbjct  121  ICTTKTEWLDGKHVVFGKVVEGMEVVKAIEKVGSSSGRTS  160



>ref|XP_010062044.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1 [Eucalyptus 
grandis]
 gb|KCW69115.1| hypothetical protein EUGRSUZ_F02659 [Eucalyptus grandis]
Length=172

 Score =   256 bits (655),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GG   GR+VMEL+ADTTP+TAENFRALCTGEKGVG+S KPLHYKGS F
Sbjct  1    MPNPKVFFDMTIGGAAAGRVVMELYADTTPRTAENFRALCTGEKGVGRSRKPLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPSFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFG+VVEG++VVK +E+VGS SGR S
Sbjct  121  ICTTKTEWLDGKHVVFGKVVEGMEVVKAIEKVGSSSGRTS  160



>gb|AAO63777.1| cyclophilin [Populus tremuloides]
Length=172

 Score =   256 bits (655),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+T+GG P GRIVMELFADTTP+TAENFRALCTGEKG  +SGKPLHYKGSTF
Sbjct  1    MANPKVYFDMTIGGAPAGRIVMELFADTTPRTAENFRALCTGEKGKVRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG+KF DENFVKKHTGPGILSMAN+GP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTEGNGTGGESIYGAKFADENFVKKHTGPGILSMANSGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFG+VVEG++VVK +E+VGS  GR S
Sbjct  121  ICTDKTEWLDGKHVVFGRVVEGMNVVKAIEKVGSSGGRTS  160



>gb|KFK30119.1| hypothetical protein AALP_AA7G219300 [Arabis alpina]
Length=172

 Score =   256 bits (655),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+T+GG P GRIVMELFADTTP+TAENFRALCTGEKG+GKSGKPLH+KGS F
Sbjct  1    MTNPRVFFDMTLGGTPAGRIVMELFADTTPRTAENFRALCTGEKGLGKSGKPLHFKGSIF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMAN+G NTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFTDENFIKKHTGPGILSMANSGVNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTA+T WLD KHVVFGQ+VEG+DVVK +E+VGS SG+ S
Sbjct  121  ICTAETSWLDRKHVVFGQIVEGMDVVKAIEKVGSQSGKTS  160



>gb|ACT53879.1| cyclophilin [Saccharum officinarum]
 gb|AGT16915.1| cyclophilin [Saccharum hybrid cultivar R570]
Length=172

 Score =   256 bits (654),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+A+  P+TAENFRALCTGEKGVGKSGKPLHYKGSTF
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DE FV+KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPQFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CT +T WLDGKHVVFGQVVEG+DVVK +E+VGS SG  S
Sbjct  121  VCTVETPWLDGKHVVFGQVVEGMDVVKAIEKVGSRSGSTS  160



>ref|XP_008799420.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Phoenix dactylifera]
Length=173

 Score =   256 bits (654),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFD+ VGG P GRIVMELFAD  P+TAENFRALCTGEKG G+SGKPLHYKGS+FHR
Sbjct  4    NPKVFFDMAVGGVPAGRIVMELFADVVPRTAENFRALCTGEKGTGRSGKPLHYKGSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGGESIYGSKF+DENFVKKHTGPG+LSMANAG NTNGSQFFIC
Sbjct  64   VIPGFMCQGGDFTAGNGTGGESIYGSKFEDENFVKKHTGPGVLSMANAGRNTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            TA T WLDGKHVVFGQVVEGL+VV+ +E+VGS SGR S
Sbjct  124  TATTSWLDGKHVVFGQVVEGLEVVRAIEKVGSQSGRTS  161



>ref|XP_003604030.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
 gb|AES74281.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
 gb|AFK46425.1| unknown [Medicago truncatula]
Length=191

 Score =   256 bits (654),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +3

Query  75   RVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHRVI  254
            +VFFD+TVG +P GRIVMEL+ADTTP TA+NFRALCTGEKG+G SGKPLHYKGSTFHRVI
Sbjct  13   KVFFDMTVGDEPVGRIVMELYADTTPLTADNFRALCTGEKGLGSSGKPLHYKGSTFHRVI  72

Query  255  PNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFICTA  434
            P+FMCQGGDFTAGNGTGGESIYGSKF DENF+K HTGPG+LSMANAGP TNGSQFFICTA
Sbjct  73   PDFMCQGGDFTAGNGTGGESIYGSKFADENFIKTHTGPGVLSMANAGPGTNGSQFFICTA  132

Query  435  KTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            KTEWLDGKHVVFG+VVEG++VVK++E+VGSGSG+ S
Sbjct  133  KTEWLDGKHVVFGEVVEGMEVVKEIEKVGSGSGKTS  168



>ref|XP_007136181.1| hypothetical protein PHAVU_009G025000g [Phaseolus vulgaris]
 gb|ESW08175.1| hypothetical protein PHAVU_009G025000g [Phaseolus vulgaris]
Length=172

 Score =   255 bits (652),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+++  +P GRIVMEL+ADT P+TAENFRALCTGEKG+G+SG  LHYKGS F
Sbjct  1    MPNPRVFFDMSISAKPVGRIVMELYADTVPRTAENFRALCTGEKGIGRSGMALHYKGSCF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            ICT KTEWLDGKHVVFG+VVEGLDVVK++E++GS SG+
Sbjct  121  ICTVKTEWLDGKHVVFGEVVEGLDVVKEIEKIGSSSGK  158



>gb|AAQ87931.1| Bet v 7-like protein [Curvularia lunata]
Length=171

 Score =   255 bits (652),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFDI++ GQP GR+VMELFAD  P+TAENFRALCTGEKG GKSGKPLHY+GSTF
Sbjct  1    MSNPRVFFDISIAGQPAGRVVMELFADKVPKTAENFRALCTGEKGTGKSGKPLHYEGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FM QGGDFT GNGTGGESIYG KF+DENF  KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPQFMLQGGDFTRGNGTGGESIYGEKFEDENFALKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEG+DVV+ VE+VGS SG+ S
Sbjct  121  ICTVKTSWLDGKHVVFGQVVEGMDVVQAVEKVGSQSGQTS  160



>ref|XP_004952611.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Setaria 
italica]
Length=172

 Score =   255 bits (652),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+A+  P+TAENFRALCTGEKGVGKSGKPLHYKGSTF
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYANEVPRTAENFRALCTGEKGVGKSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFT GNGTGGESIYG KF DE FV+KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPDFMCQGGDFTRGNGTGGESIYGEKFADEKFVRKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT  T WLDGKHVVFGQVVEG++VVK +E+VGS SG
Sbjct  121  ICTVATPWLDGKHVVFGQVVEGMNVVKAIEKVGSRSG  157



>gb|AAT98376.1| peptidyl-prolyl cis-trans isomerase [Populus trichocarpa]
Length=172

 Score =   255 bits (652),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+ D+T+GG P GRIV+ELFADTTP+TAENFRALCTGEKG G+SGKPLHYKGSTF
Sbjct  1    MANPKVYLDMTIGGVPAGRIVIELFADTTPRTAENFRALCTGEKGKGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMAN+GP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANSGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDGKHVVFG+VVEG++VVK +E+VGS  GR S
Sbjct  121  ICTDKTEWLDGKHVVFGRVVEGMNVVKAIEKVGSSGGRTS  160



>ref|XP_002451412.1| hypothetical protein SORBIDRAFT_04g001740 [Sorghum bicolor]
 gb|EES04388.1| hypothetical protein SORBIDRAFT_04g001740 [Sorghum bicolor]
Length=171

 Score =   255 bits (652),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+A+  P+TAENFRALCTGEKGVGKSGKPLHYKGSTF
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYANEVPRTAENFRALCTGEKGVGKSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFT GNGTGGESIYG KF DE FV+KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPDFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT  T WLDGKHVVFGQVVEG+DVVK +E+VGS SG
Sbjct  121  ICTVPTPWLDGKHVVFGQVVEGMDVVKAIEKVGSRSG  157



>sp|P24525.2|CYPH_BRANA RecName: Full=Peptidyl-prolyl cis-trans isomerase; Short=PPIase; 
AltName: Full=Cyclophilin; AltName: Full=Cyclosporin A-binding 
protein; AltName: Full=Rotamase [Brassica napus]
Length=171

 Score =   255 bits (651),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+V+FD+TVG +  GRIVMEL+ADT P+TAENFRALCTGE+G+GKSGKPLHYKGS F
Sbjct  1    MVNPKVYFDMTVGDKAAGRIVMELYADTVPETAENFRALCTGERGIGKSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG KFKDENFVKKHTGPGILSM NAG NTNGSQFF
Sbjct  61   HRVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENFVKKHTGPGILSMRNAGSNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEG+DVV+ +E+VGS SGR S
Sbjct  121  ICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSGRTS  160



>gb|ABQ59098.1| cyclophilin ABH-like protein [Panax ginseng]
Length=172

 Score =   254 bits (650),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M N +VFFD+ +GG P GRIVMEL+ADTTP+TAENFRAL TGEKG+GK+GKPLH KGS+F
Sbjct  1    MANHKVFFDMAIGGTPAGRIVMELYADTTPKTAENFRALRTGEKGIGKAGKPLHSKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPPFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWL+GKHVVFGQV+EGLDVVK +E+VGS SGR S
Sbjct  121  ICTAKTEWLNGKHVVFGQVIEGLDVVKAIEKVGSSSGRTS  160



>ref|XP_002869121.1| hypothetical protein ARALYDRAFT_491169 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45380.1| hypothetical protein ARALYDRAFT_491169 [Arabidopsis lyrata subsp. 
lyrata]
Length=172

 Score =   254 bits (650),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+++ G P GRI MELFADTTP TAENFRALCTGEKG+GK GKPLHYKGS F
Sbjct  1    MANPRVFFDMSLSGTPIGRIEMELFADTTPNTAENFRALCTGEKGIGKMGKPLHYKGSIF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTA NGTGGESIYG+KFKDENF+KKHTG GILSMAN+G NTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAKNGTGGESIYGAKFKDENFIKKHTGAGILSMANSGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVV+GLDVVK +E+VGS SG+ S
Sbjct  121  ICTDKTSWLDGKHVVFGQVVKGLDVVKAIEKVGSDSGKTS  160



>ref|XP_010233732.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Brachypodium 
distachyon]
Length=172

 Score =   254 bits (650),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD++VGG P GRIVMEL+ADT P+TAENFRALCTGEKGVGK GKPLHYKGS+F
Sbjct  1    MVNPKVFFDMSVGGAPAGRIVMELYADTVPRTAENFRALCTGEKGVGKCGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVI +FMCQGGDFT GNGTGGESIYG KF DE FV KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVITDFMCQGGDFTKGNGTGGESIYGEKFADEKFVHKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVV+GLDVVK +E+VGSGSG+ S
Sbjct  121  ICTVKTPWLDGKHVVFGQVVDGLDVVKAIEKVGSGSGKTS  160



>emb|CAA69598.1| cyclophilin [Digitalis lanata]
Length=172

 Score =   254 bits (649),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFD+++GGQP GRIVMEL+AD  P+TA+NFRALCTGEKGVGKSGKPLHYKGS F
Sbjct  1    MSLPKVFFDMSIGGQPCGRIVMELYADVVPKTADNFRALCTGEKGVGKSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF DENFVKKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            ICT KT WLDGKHVVFGQVVEG+DVV+ +E+VGS SG+
Sbjct  121  ICTEKTAWLDGKHVVFGQVVEGMDVVRAIEKVGSQSGK  158



>ref|XP_003139210.1| cyclophilin Ovcyp-2 [Loa loa]
 gb|EFO24859.1| peptidyl-prolyl cis-trans isomerase 3 [Loa loa]
 gb|EJD75189.1| peptidyl-prolyl cis-trans isomerase 3, variant [Loa loa]
Length=171

 Score =   254 bits (649),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  PRVFFDIT+GG  +GRIVMELF+D  P+TAENFRALCTGEKG+GKSGKPLHYKGS F
Sbjct  1    MTRPRVFFDITIGGNASGRIVMELFSDVVPKTAENFRALCTGEKGIGKSGKPLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFT  NGTGGESIYG KF+DENF +KH GPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTRSNGTGGESIYGEKFEDENFKEKHNGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CT KT+WLDGKHVVFG+VVEG+DVV+K+E VGS SG+ S
Sbjct  121  LCTVKTDWLDGKHVVFGRVVEGMDVVQKIEAVGSQSGKTS  160



>ref|XP_010429007.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-2-like [Camelina 
sativa]
Length=172

 Score =   254 bits (648),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            +P+VFFD+T+GG P G+IVMEL+ D TP+TAENFRALCTGEKGVG+SGKPLH+KGS FHR
Sbjct  4    HPKVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSAFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIPNFMCQGGDFT GN TGGESIYG+KF DENF +KHTGPGILSMANAG NTNGSQFFIC
Sbjct  64   VIPNFMCQGGDFTLGNSTGGESIYGNKFADENFERKHTGPGILSMANAGANTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            T KT+WLDGKHVVFGQV+EGLDVVK +E+VGS SG+ S
Sbjct  124  TVKTDWLDGKHVVFGQVIEGLDVVKAIEKVGSSSGKLS  161



>ref|NP_195213.1| rotamase cyclophilin 5 [Arabidopsis thaliana]
 sp|Q42406.1|CP18D_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP18-4; Short=PPIase 
CYP18-4; AltName: Full=Cyclophilin of 18 kDa 4; Short=Cyclophilin-1; 
AltName: Full=Rotamase cyclophilin-5 [Arabidopsis 
thaliana]
 gb|AAA66197.1| peptidyl-prolyl cis-trans isomerase [Arabidopsis thaliana]
 gb|AAA75512.1| cyclophilin [Arabidopsis thaliana]
 emb|CAB45448.1| peptidylprolyl isomerase (cyclophilin) [Arabidopsis thaliana]
 emb|CAB80204.1| peptidylprolyl isomerase (cyclophilin) [Arabidopsis thaliana]
 gb|AAK96660.1| peptidylprolyl isomerase (cyclophilin) [Arabidopsis thaliana]
 gb|AAM65147.1| peptidylprolyl isomerase (cyclophilin) [Arabidopsis thaliana]
 gb|AAP21368.1| At4g34870 [Arabidopsis thaliana]
 dbj|BAF00180.1| cyclophilin [Arabidopsis thaliana]
 gb|AEE86431.1| rotamase cyclophilin 5 [Arabidopsis thaliana]
 prf||2021266A peptidyl-Pro cis-trans isomerase
Length=172

 Score =   254 bits (648),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+++ G P GRI MELFADTTP TAENFRALCTGEKG+GK GKPLH+KGS F
Sbjct  1    MSNPRVFFDMSLSGTPIGRIEMELFADTTPNTAENFRALCTGEKGMGKLGKPLHFKGSIF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTA NGTGGESIYG+KFKDENF+KKHTG GILSMAN+GPNTNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTAKNGTGGESIYGAKFKDENFIKKHTGAGILSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVV+GLDVVK +E+VGS SG+ S
Sbjct  121  ICTDKTSWLDGKHVVFGQVVKGLDVVKAIEKVGSDSGKTS  160



>ref|XP_002868859.1| hypothetical protein ARALYDRAFT_490638 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45118.1| hypothetical protein ARALYDRAFT_490638 [Arabidopsis lyrata subsp. 
lyrata]
Length=172

 Score =   253 bits (647),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+V+FD+T+ GQP GRIVMEL+ D TP+TAENFRALCTGEKGVG SGKPLH+KGS F
Sbjct  1    MAFPKVYFDMTIDGQPAGRIVMELYTDKTPKTAENFRALCTGEKGVGSSGKPLHFKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KFKDENF +KHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGTKFKDENFERKHTGPGILSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            ICT KT+WLDGKHVVFGQVVEGLDVVK +E+VGS SG+
Sbjct  121  ICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGK  158



>ref|XP_010531511.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP18-3 [Tarenaya 
hassleriana]
Length=172

 Score =   253 bits (647),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFDIT+GGQP GRIVMEL+ D TPQTAENFRALCTGEKGVG+ GKPLH+KGS+F
Sbjct  1    MAFPKVFFDITIGGQPAGRIVMELYTDKTPQTAENFRALCTGEKGVGRKGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+I  FMCQGGDFTAGNGTGGESIYG KFKDE+F +KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRIITEFMCQGGDFTAGNGTGGESIYGDKFKDEDFTRKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEG+DVVK +E+VGS SG+ S
Sbjct  121  ICTVKTSWLDGKHVVFGQVVEGMDVVKAMEKVGSSSGKPS  160



>ref|NP_001289049.1| peptidyl-prolyl cis-trans isomerase CYP18-3 [Brassica rapa]
 gb|AHV84999.1| peptidylprolyl isomerase [Brassica rapa]
 emb|CDY12100.1| BnaC03g60160D [Brassica napus]
 emb|CDX90292.1| BnaA08g16920D [Brassica napus]
Length=172

 Score =   253 bits (647),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFD+TV G+P GRIVMEL+ D TP+TAENFRALCTGEKGVG  GKPLH+KGS+F
Sbjct  1    MAFPKVFFDMTVDGKPAGRIVMELYTDKTPKTAENFRALCTGEKGVGSKGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG KF DENF +KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGEKFADENFERKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT+WLDGKHVVFGQVVEGLDVVK +E+VGS SG+ S
Sbjct  121  ICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSASGKPS  160



>ref|XP_006404551.1| hypothetical protein EUTSA_v10000350mg [Eutrema salsugineum]
 gb|ESQ46004.1| hypothetical protein EUTSA_v10000350mg [Eutrema salsugineum]
Length=172

 Score =   253 bits (647),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M +P+VFFD+T+GG P GRIVMEL+ D TP+TAENFRALCTGEKGVG+SGKPLH+KGS+F
Sbjct  1    MAHPKVFFDMTIGGNPAGRIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF+DENF +KHTG GILSMANAG NTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFEDENFERKHTGAGILSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            ICT KT+WLDGKHVVFGQV+EGLDVVK +E++GS SG+
Sbjct  121  ICTVKTDWLDGKHVVFGQVIEGLDVVKAIEKIGSSSGK  158



>gb|AAC47233.1| cyclophilin Ovcyp-2 [Onchocerca volvulus]
Length=171

 Score =   253 bits (647),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  PRVFFDIT+GGQ +GRIVMELF D  P+TAENFRALCTGEKGVGKSGKPLHYKGS F
Sbjct  1    MTRPRVFFDITIGGQQSGRIVMELFNDIVPKTAENFRALCTGEKGVGKSGKPLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFT GNGTGGESIYG KF+DENF +KHTGPG+LSMANAGP+TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTRGNGTGGESIYGEKFEDENFKEKHTGPGVLSMANAGPDTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CT KT+WLDGKHVVFG+VV+G+DVV+K+E VGS SG+ S
Sbjct  121  LCTVKTDWLDGKHVVFGRVVDGMDVVQKIEAVGSQSGKTS  160



>gb|AAB71402.1| cyclophilin [Arabidopsis thaliana]
Length=174

 Score =   253 bits (645),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            +  +P+VFFD+T+GG P G+IVMEL+ D TP+TAENFRALCTGEKGVG+SGKPLH+KGS+
Sbjct  1    MASHPKVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSS  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHRVIPNFMCQGGDFT GNGTGGESIYG+KF+DENF +KHTGPGILSMANAG NTNGSQF
Sbjct  61   FHRVIPNFMCQGGDFTKGNGTGGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            FICT KT+WLDGKHVVFGQVVEGLDVVK +E++GS SG+
Sbjct  121  FICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSGK  159



>ref|NP_179709.1| peptidyl-prolyl cis-trans isomerase CYP19-2 [Arabidopsis thaliana]
 sp|Q9SKQ0.1|CP19B_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP19-2; Short=PPIase 
CYP19-2; AltName: Full=Cyclophilin of 19 kDa 2; Short=Cyclophilin-2; 
AltName: Full=Rotamase cyclophilin-6 [Arabidopsis 
thaliana]
 gb|AAD29803.1| cyclophilin (CYP2) [Arabidopsis thaliana]
 gb|AAM65000.1| cyclophilin CYP2 [Arabidopsis thaliana]
 gb|ABF58945.1| At2g21130 [Arabidopsis thaliana]
 gb|AEC07126.1| peptidyl-prolyl cis-trans isomerase CYP19-2 [Arabidopsis thaliana]
Length=174

 Score =   253 bits (645),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            +  +P+VFFD+T+GG P G+IVMEL+ D TP+TAENFRALCTGEKGVG+SGKPLH+KGS+
Sbjct  1    MASHPKVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSS  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHRVIPNFMCQGGDFT GNGTGGESIYG+KF+DENF +KHTGPGILSMANAG NTNGSQF
Sbjct  61   FHRVIPNFMCQGGDFTKGNGTGGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            FICT KT+WLDGKHVVFGQVVEGLDVVK +E++GS SG+
Sbjct  121  FICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSGK  159



>ref|XP_008678672.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Zea mays]
 gb|AFW62508.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea 
mays]
Length=171

 Score =   252 bits (644),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP VFFD+TVGG P GRIVMEL+A+  P+TAENFRALCTGEKGVGKSGKPLHYKGSTF
Sbjct  1    MANPHVFFDMTVGGAPAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DE FV+KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPQFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT +T WLDGKHVVFGQVVEG++VVK +E+VGS SG  S
Sbjct  121  ICTVETPWLDGKHVVFGQVVEGMEVVKAIEKVGSRSGATS  160



>ref|XP_010104463.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
 gb|EXC00996.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
Length=172

 Score =   252 bits (644),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M   +VFFDI +GG P GRIVMEL+AD TP+TAENFRALCTGEKG G+SGKPLHYKGSTF
Sbjct  1    MSKSKVFFDIAIGGSPAGRIVMELYADVTPRTAENFRALCTGEKGTGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IP FMCQGGDFTAGNGTGGESIYGSKF DENF+KKHTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRIIPGFMCQGGDFTAGNGTGGESIYGSKFPDENFIKKHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT +T WLDGKHVVFG+VVEG+DVV+ +E+VGS +GR S
Sbjct  121  ICTGETPWLDGKHVVFGKVVEGMDVVRAMEKVGSSTGRTS  160



>ref|XP_006411664.1| hypothetical protein EUTSA_v10026397mg [Eutrema salsugineum]
 gb|ESQ53117.1| hypothetical protein EUTSA_v10026397mg [Eutrema salsugineum]
Length=172

 Score =   252 bits (644),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFD+T+ GQP GRIVMEL+ D TP+TAENFRALCTGEKG+G++GKPLH+KGS+F
Sbjct  1    MAFPKVFFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGMGRNGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF+DENF +KHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGNKFEDENFERKHTGPGILSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT+WLDGKHVVFGQVVEGLDVVK +E+VGS SG+ S
Sbjct  121  ICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPS  160



>ref|XP_008028418.1| hypothetical protein SETTUDRAFT_164317 [Setosphaeria turcica 
Et28A]
 gb|EOA83983.1| hypothetical protein SETTUDRAFT_164317 [Setosphaeria turcica 
Et28A]
Length=171

 Score =   252 bits (643),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFDIT+  QP GRIVMELFAD  P+TAENFRALCTGEKGVGKSGKPLHYKGS+F
Sbjct  1    MSNPRVFFDITINNQPAGRIVMELFADKVPKTAENFRALCTGEKGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FM QGGDFT GNGTGGESIYG KF+DENF  +HTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPQFMLQGGDFTRGNGTGGESIYGEKFEDENFELRHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEG+DVV+ VE+ GSGSG+ +
Sbjct  121  ICTVKTSWLDGKHVVFGQVVEGMDVVQAVERQGSGSGKTN  160



>ref|XP_008645736.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Zea mays]
 gb|ACF87685.1| unknown [Zea mays]
 gb|ACG35201.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
 gb|ACG39721.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
 gb|ACG48475.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
 gb|AFW71632.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea 
mays]
Length=172

 Score =   252 bits (643),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+A+  P+TAENFRALCTGEKGVGKSGKPLHYKGSTF
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DE FV+KHT PG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPEFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKHTAPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT  T WLDGKHVVFGQVVEG+DVVK +E+VG+ +G  S
Sbjct  121  ICTVATPWLDGKHVVFGQVVEGMDVVKAIEKVGTRNGSTS  160



>ref|XP_001941476.1| peptidyl-prolyl cis-trans isomerase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU44195.1| peptidyl-prolyl cis-trans isomerase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=171

 Score =   252 bits (643),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFDIT+GG P GRIVMELFAD  P+TAENFRALCTGEKG G SGKPLHYKGS+F
Sbjct  1    MSNPRVFFDITIGGAPAGRIVMELFADVVPKTAENFRALCTGEKGTGSSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FM QGGDFT GNGTGGESIYG KF DENF  KHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPQFMLQGGDFTRGNGTGGESIYGEKFADENFQLKHTGPGILSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQV EGLDVV+ VE+VGSGSG  S
Sbjct  121  ICTVKTAWLDGKHVVFGQVKEGLDVVQAVEKVGSGSGSTS  160



>gb|AAA62706.1| cyclophilin, partial [Brassica napus]
Length=168

 Score =   251 bits (642),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +3

Query  72   PRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHRV  251
            P+V+FD+TVG +  GRIVMEL+ADT P+TAENFRALCTGE+G+GKSGKPLHYKGS FHRV
Sbjct  1    PKVYFDMTVGDKAAGRIVMELYADTVPETAENFRALCTGERGIGKSGKPLHYKGSAFHRV  60

Query  252  IPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFICT  431
            IP FMCQGGDFTAGNGTGGESIYG KFKDENFVKKHTGPGILSM NAG NTNGSQFFICT
Sbjct  61   IPKFMCQGGDFTAGNGTGGESIYGMKFKDENFVKKHTGPGILSMRNAGSNTNGSQFFICT  120

Query  432  AKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
             KT WLDGKHVVFGQVVEG+DVV+ +E+VGS SGR S
Sbjct  121  EKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSGRTS  157



>ref|XP_009412893.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Musa acuminata 
subsp. malaccensis]
Length=173

 Score =   251 bits (642),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            +  NP VFFD+ VGG P GRIVMEL+AD TP+TAENFRALCTGEKGVG+SGKPLHYKGST
Sbjct  1    MAANPCVFFDMAVGGAPVGRIVMELYADVTPKTAENFRALCTGEKGVGRSGKPLHYKGST  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHRVIP FMCQGGDFT GNGTGGESIYG KF DENFVKKHTGPG+LSMANAG NTNGSQF
Sbjct  61   FHRVIPGFMCQGGDFTCGNGTGGESIYGEKFADENFVKKHTGPGVLSMANAGKNTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            F+CTA+T WLDGKHVVFG+VVEG+DVVK +E VGS SG
Sbjct  121  FVCTAQTSWLDGKHVVFGRVVEGMDVVKSIEAVGSHSG  158



>ref|NP_195585.1| peptidyl-prolyl cis-trans isomerase CYP1 [Arabidopsis thaliana]
 sp|P34790.1|CP18C_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP18-3; Short=PPIase 
CYP18-3; AltName: Full=Cyclophilin of 18 kDa 3; AltName: 
Full=Cyclosporin A-binding protein; AltName: Full=Rotamase 
cyclophilin-1 [Arabidopsis thaliana]
 gb|AAA20047.1| cyclophilin [Arabidopsis thaliana]
 emb|CAB38608.1| peptidylprolyl isomerase ROC1 [Arabidopsis thaliana]
 emb|CAB80537.1| peptidylprolyl isomerase ROC1 [Arabidopsis thaliana]
 gb|AAM13226.1| peptidylprolyl isomerase ROC1 [Arabidopsis thaliana]
 gb|AAM65649.1| peptidylprolyl isomerase ROC1 [Arabidopsis thaliana]
 gb|AAO30060.1| peptidylprolyl isomerase ROC1 [Arabidopsis thaliana]
 dbj|BAE98538.1| cyclophilin [Arabidopsis thaliana]
 gb|AEE86970.1| peptidyl-prolyl cis-trans isomerase CYP1 [Arabidopsis thaliana]
Length=172

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+V+FD+T+ GQP GRIVMEL+ D TP+TAENFRALCTGEKGVG +GKPLH+KGS F
Sbjct  1    MAFPKVYFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGGTGKPLHFKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYGSKF+DENF +KHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGSKFEDENFERKHTGPGILSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            ICT KT+WLDGKHVVFGQVVEGLDVVK +E+VGS SG+
Sbjct  121  ICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGK  158



>gb|KFK30470.1| hypothetical protein AALP_AA7G265300 [Arabis alpina]
Length=172

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFD+T+ G   GRIVMEL+ D TP+TAENFRALCTGEKG+G+SGKPLH+KGS F
Sbjct  1    MAFPKVFFDMTIDGAQAGRIVMELYTDKTPETAENFRALCTGEKGLGRSGKPLHFKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KFKDENF +KHT PGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFKDENFERKHTAPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            ICT KT+WLDGKHVVFGQVVEGLDVVK +E+VGS SG+
Sbjct  121  ICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGK  158



>gb|AAK49427.1|AF262983_1 cyclophilin A-2 [Triticum aestivum]
 gb|AAS17067.1| cyclophilin A [Triticum aestivum]
 gb|AEP25121.1| cyclophilin [Secale cereale x Triticum turgidum subsp. durum]
Length=171

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+ D  P+T ENFRALCTGEKGVGKSGKPLHYKGS+F
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYKDAVPRTVENFRALCTGEKGVGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFT GNGTGGESIYG KF DE FV KHT PGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPDFMCQGGDFTKGNGTGGESIYGEKFADEKFVHKHTKPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT    WLDGKHVVFG+VVEG+DVVK +E+VGS SG CS
Sbjct  121  ICTVPCNWLDGKHVVFGEVVEGMDVVKNIEKVGSRSGTCS  160



>ref|XP_006282738.1| hypothetical protein CARUB_v10005879mg [Capsella rubella]
 gb|EOA15636.1| hypothetical protein CARUB_v10005879mg [Capsella rubella]
Length=173

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+V+FD+T+ GQP GRIVMEL+ D TP+TAENFRALCTGEKGVG+ GKPLH+KGS F
Sbjct  1    MAFPKVYFDMTIDGQPAGRIVMELYTDKTPKTAENFRALCTGEKGVGRGGKPLHFKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF+DENF +KHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT+WLDGKHVVFGQVV+GLDVVK +E+VGS SG+ S
Sbjct  121  ICTVKTDWLDGKHVVFGQVVQGLDVVKAIEKVGSSSGKPS  160



>pdb|4HY7|A Chain A, Structural And Biochemical Characterization Of A Cytosolic 
Wheat Cyclophilin Tacypa-1
 gb|AAK49426.1|AF262982_1 cyclophilin A-1 [Triticum aestivum]
 gb|AAK49428.1|AF262984_1 cyclophilin A-3 [Triticum aestivum]
 gb|ABU56010.1| cyclophilin 5 [Dasypyrum villosum]
 gb|AFS50133.1| peptidylprolyl cis-trans isomerase [Triticum aestivum]
 dbj|BAN09078.1| cyclophilin A-1 [Triticum aestivum]
 gb|EMT05961.1| Peptidyl-prolyl cis-trans isomerase [Aegilops tauschii]
Length=171

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+ D  P+T ENFRALCTGEKGVGKSGKPLHYKGS F
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYKDAVPRTVENFRALCTGEKGVGKSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFT GNGTGGESIYG KF DE FV KHT PGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPDFMCQGGDFTRGNGTGGESIYGEKFADEKFVHKHTKPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT    WLDGKHVVFG+VVEG+DVVK +E+VGS SG CS
Sbjct  121  ICTVPCNWLDGKHVVFGEVVEGMDVVKNIEKVGSRSGTCS  160



>gb|AAS01735.1| putative cyclophilin [Populus tremula x Populus alba]
 gb|AAS01736.1| putative cyclophilin [Populus tremula x Populus alba]
Length=151

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  72   PRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHRV  251
            P  FFD+TVGGQP GRIVMELFAD  P+TAENFRALCTGEKGVG+ GKPLH+KGS+FHRV
Sbjct  1    PNPFFDMTVGGQPVGRIVMELFADVVPRTAENFRALCTGEKGVGRLGKPLHFKGSSFHRV  60

Query  252  IPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFICT  431
            IPNFMCQGGDFTAGNGTGGESIYG+KF DENFV+KHTGPG+LSMANAGP TNGSQFFICT
Sbjct  61   IPNFMCQGGDFTAGNGTGGESIYGAKFADENFVRKHTGPGVLSMANAGPGTNGSQFFICT  120

Query  432  AKTEWLDGKHVVFGQVVEGLDVVKKVEQVGS  524
             KTEWLDGKHVVFGQVVEG+DVVK +E+VGS
Sbjct  121  VKTEWLDGKHVVFGQVVEGMDVVKAIEKVGS  151



>ref|XP_010446391.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP18-3 [Camelina 
sativa]
Length=172

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+V+FD+T+ GQP GRIVMEL+ D TP+TAENFRALCTGEKGVG++GKPLH+KGS F
Sbjct  1    MAFPKVYFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGRAGKPLHFKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF+DENF +KHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGNKFEDENFERKHTGPGILSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT+WLDGKHVVFGQVVEG DVVK +E+VGS SG+ S
Sbjct  121  ICTVKTDWLDGKHVVFGQVVEGFDVVKAIEKVGSSSGKPS  160



>ref|XP_002880359.1| peptidyl-prolyl cis-trans isomerase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56618.1| peptidyl-prolyl cis-trans isomerase [Arabidopsis lyrata subsp. 
lyrata]
Length=174

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            +P+VFFD+T+GG P G+IVMEL+ D TP+TAENFRALCTGEKGVG+SGKPLH+KGS FHR
Sbjct  4    HPKVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSAFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIPNFMCQGGDFT GNGTGGESIYGSKF+DENF +KHTGPGILSMANAG NTNGSQFFIC
Sbjct  64   VIPNFMCQGGDFTNGNGTGGESIYGSKFEDENFERKHTGPGILSMANAGANTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            T KT+WLDGKHVVFGQV+EGLDVVK +E+ GS +G+
Sbjct  124  TVKTDWLDGKHVVFGQVIEGLDVVKAIEKSGSSAGK  159



>ref|XP_007701371.1| hypothetical protein COCSADRAFT_92320 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD63126.1| hypothetical protein COCSADRAFT_92320 [Bipolaris sorokiniana 
ND90Pr]
Length=171

 Score =   250 bits (638),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+++GGQP GR+VMELFAD  P+TAENFRALCTGEKG GKSGKPLHY+GS F
Sbjct  1    MTNPRVFFDVSIGGQPAGRVVMELFADQVPKTAENFRALCTGEKGTGKSGKPLHYQGSVF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FM QGGDFT GNGTGGESIYG KF+DENF  +HTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPQFMLQGGDFTRGNGTGGESIYGEKFEDENFKLRHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEG+DVV+ VE+VGS +G+ S
Sbjct  121  ICTVKTSWLDGKHVVFGQVVEGMDVVQAVEKVGSQTGKTS  160



>ref|XP_002452188.1| hypothetical protein SORBIDRAFT_04g021380 [Sorghum bicolor]
 gb|ACD93011.1| cyclophilin [Sorghum bicolor]
 gb|EES05164.1| hypothetical protein SORBIDRAFT_04g021380 [Sorghum bicolor]
Length=172

 Score =   250 bits (638),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG   GRIVMEL+A+  P+TAENFRALCTGEKGVGKSGKPLHYKGSTF
Sbjct  1    MANPRVFFDMTVGGAAAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DE FV+ HT PG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPQFMCQGGDFTRGNGTGGESIYGDKFPDEKFVRNHTAPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT  T WLDGKHVVFGQVVEG+DVVK +E+VGS SG  S
Sbjct  121  ICTVDTPWLDGKHVVFGQVVEGMDVVKAIEKVGSRSGSTS  160



>gb|ABI14282.1| cyclophilin-like protein [Pfiesteria piscicida]
 gb|ABI14283.1| cyclophilin-like protein [Pfiesteria piscicida]
 gb|ABI14284.1| cyclophilin-like protein [Pfiesteria piscicida]
Length=171

 Score =   249 bits (637),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GG P GRI MEL AD  P+TAENFRALCTGEKGVGKSGKPLH+KGS+F
Sbjct  1    MANPKVFFDMTIGGSPAGRITMELRADVAPKTAENFRALCTGEKGVGKSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFT  N TGGESIYG+KF DENF  KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPDFMCQGGDFTNHNSTGGESIYGAKFADENFTLKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CT KT WLDGKHVVFG VV+G+DVVKK+E VGS SG+ +
Sbjct  121  LCTVKTAWLDGKHVVFGSVVDGMDVVKKIEAVGSQSGKTA  160



>pdb|4E1Q|A Chain A, Crystal Structure Of Wheat Cyclophilin A At 1.25 A Resolution
Length=207

 Score =   251 bits (640),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+ D  P+T ENFRALCTGEKGVGKSGKPLHYKGS F
Sbjct  37   MANPRVFFDMTVGGAPAGRIVMELYKDAVPRTVENFRALCTGEKGVGKSGKPLHYKGSAF  96

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFT GNGTGGESIYG KF DE FV KHT PGILSMANAGPNTNGSQFF
Sbjct  97   HRVIPDFMCQGGDFTRGNGTGGESIYGEKFADEKFVHKHTKPGILSMANAGPNTNGSQFF  156

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT    WLDGKHVVFG+VVEG+DVVK +E+VGS SG CS
Sbjct  157  ICTVPCNWLDGKHVVFGEVVEGMDVVKNIEKVGSRSGTCS  196



>ref|XP_007692567.1| hypothetical protein COCMIDRAFT_30232 [Bipolaris oryzae ATCC 
44560]
 gb|EUC40922.1| hypothetical protein COCMIDRAFT_30232 [Bipolaris oryzae ATCC 
44560]
Length=171

 Score =   249 bits (636),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+++GGQP GRIVMELFAD  P+TAENFRALCTGEKG GKSGKPLHY+GS F
Sbjct  1    MSNPRVFFDVSIGGQPAGRIVMELFADQVPKTAENFRALCTGEKGTGKSGKPLHYQGSVF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FM QGGDFT GNGTGGESIYG KF+DENF   HTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPQFMLQGGDFTRGNGTGGESIYGDKFEDENFKLSHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFG+VVEGLDVV+ VE+VGS +G+ S
Sbjct  121  ICTVKTSWLDGKHVVFGKVVEGLDVVQAVEKVGSQTGKTS  160



>ref|XP_007714724.1| hypothetical protein COCCADRAFT_102503 [Bipolaris zeicola 26-R-13]
 gb|EUC30988.1| hypothetical protein COCCADRAFT_102503 [Bipolaris zeicola 26-R-13]
 gb|EUN26048.1| hypothetical protein COCVIDRAFT_102007 [Bipolaris victoriae FI3]
Length=171

 Score =   249 bits (636),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+++GGQP GRIVMEL+AD  P+TAENFRALCTGEKG GKSGKPLHY+GS F
Sbjct  1    MSNPRVFFDVSIGGQPAGRIVMELYADKVPKTAENFRALCTGEKGTGKSGKPLHYEGSVF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FM QGGDFT GNGTGGESIYG KF+DENF  +HTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPQFMLQGGDFTRGNGTGGESIYGEKFEDENFNLRHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEG+DVV+ VE+VGS +G+ S
Sbjct  121  ICTVKTSWLDGKHVVFGQVVEGMDVVQAVEKVGSQTGKTS  160



>ref|XP_010472091.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-2 [Camelina 
sativa]
Length=174

 Score =   249 bits (636),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            +  +P+VFFD+T+GG P G+IVMEL+ D TP+TAENFRALCTGEKGVG+SGKPLH+K S 
Sbjct  1    MASHPKVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKASA  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHRVIP+FMCQGGDFT GNGTGGESIYG+KF+DENF +KHTGPGILSMANAG NTNGSQF
Sbjct  61   FHRVIPDFMCQGGDFTVGNGTGGESIYGNKFEDENFERKHTGPGILSMANAGANTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            FICT KT+WLDGKHVVFGQV+EGLDVVK +E+VGS SG+
Sbjct  121  FICTVKTDWLDGKHVVFGQVIEGLDVVKAIEKVGSSSGK  159



>ref|XP_009391979.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   249 bits (635),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRV+F+++VGG P GRIVMEL+AD TP+TAENFRALCTGEKG+G+ GKPLHYKGS+F
Sbjct  1    MANPRVYFEMSVGGSPVGRIVMELYADVTPKTAENFRALCTGEKGMGRCGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DENFVKKHTGPG+LSMANAG +TNGSQFF
Sbjct  61   HRVIPGFMCQGGDFTRGNGTGGESIYGEKFADENFVKKHTGPGVLSMANAGKHTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICTA+T WLDGKHVVFG+VVEGL+VVK +E VGS SG
Sbjct  121  ICTAQTSWLDGKHVVFGRVVEGLEVVKAIEAVGSQSG  157



>ref|XP_010436974.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP18-3-like [Camelina 
sativa]
Length=172

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+V+FD+T+ GQP GRIVMEL+ D TP+TAENFRALCTGEKGVG+ GKPLH+KGS F
Sbjct  1    MAFPKVYFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGRGGKPLHFKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFTAGNGTGGESIYG+KF+DENF +KHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPKFMCQGGDFTAGNGTGGESIYGNKFEDENFERKHTGPGILSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT+WLDGKHVVFGQVVEGLDVVK +E+VGS SG+ S
Sbjct  121  ICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPS  160



>ref|XP_010431822.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP18-3-like [Camelina 
sativa]
Length=173

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +3

Query  72   PRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHRV  251
            P+V+FD+T+ GQP GRIVMEL+ D TP+TAENFRALCTGEKGVG++GKPLH+KGS FHRV
Sbjct  5    PKVYFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGRAGKPLHFKGSKFHRV  64

Query  252  IPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFICT  431
            IPNFMCQGGDFTAGNGTGGESIYG+KF+DENF +KHT PGILSMANAG NTNGSQFFICT
Sbjct  65   IPNFMCQGGDFTAGNGTGGESIYGNKFEDENFERKHTEPGILSMANAGANTNGSQFFICT  124

Query  432  AKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
             KT+WLDGKHVVFGQVVEGLDVVK +E+VGS SG+ S
Sbjct  125  VKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPS  161



>gb|ACG31960.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
Length=172

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+A+  P+TAENFRALCTGEKGVGKSGKPLHYKGSTF
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DE FV+K T PG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPEFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKXTAPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT  T WLDGKHVVFGQVVEG+DVVK +E+VG+ +G  S
Sbjct  121  ICTVATPWLDGKHVVFGQVVEGMDVVKAIEKVGTRNGSTS  160



>gb|KHN80348.1| Peptidyl-prolyl cis-trans isomerase 3 [Toxocara canis]
Length=172

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P VFFDIT+GG+  GRIVMELF+D  P+TAENFRALCTGEKGVGKSGKPLHYKGS F
Sbjct  1    MSRPTVFFDITIGGKAAGRIVMELFSDIVPRTAENFRALCTGEKGVGKSGKPLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFT GNGTGGESIYG KF DENF +KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTRGNGTGGESIYGEKFDDENFKEKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CT KT+WLDGKHVVFG+V EG++VVK++E VGS +G+ S
Sbjct  121  LCTVKTDWLDGKHVVFGRVTEGMNVVKEIESVGSQNGKTS  160



>ref|XP_008779401.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Phoenix 
dactylifera]
 ref|XP_008779405.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Phoenix 
dactylifera]
Length=174

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFDI +G    GR+VMELFAD TP+TAENFR LCTGEKG+G+SGKPLHYKGSTF
Sbjct  1    MANPRVFFDILIGKAKAGRVVMELFADVTPKTAENFRCLCTGEKGIGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IP+FMCQGGDFT GNGTGGESIYG KF+DENF KKHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRIIPSFMCQGGDFTRGNGTGGESIYGLKFEDENFKKKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFG+VV+G  VV+ +E+VGS SGR S
Sbjct  121  ICTEKTSWLDGKHVVFGKVVDGYSVVQAMEEVGSESGRTS  160



>ref|XP_005851021.1| hypothetical protein CHLNCDRAFT_29941 [Chlorella variabilis]
 gb|EFN58919.1| hypothetical protein CHLNCDRAFT_29941 [Chlorella variabilis]
Length=172

 Score =   248 bits (632),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            MGNPRVFFD+T G  P GRIVMEL AD  P+TAENFR LCTGEKG G+SGKPLH+KGSTF
Sbjct  1    MGNPRVFFDVTAGSTPLGRIVMELRADVVPKTAENFRCLCTGEKGTGRSGKPLHFKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DENF  KHTG G+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPQFMCQGGDFTRGNGTGGESIYGEKFADENFQLKHTGAGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CT  T WLDGKHVVFGQVVEGLDVVKKVE  GSGSG+ S
Sbjct  121  LCTVSTPWLDGKHVVFGQVVEGLDVVKKVESYGSGSGKTS  160



>ref|XP_002963528.1| hypothetical protein SELMODRAFT_165790 [Selaginella moellendorffii]
 ref|XP_002981553.1| hypothetical protein SELMODRAFT_444930 [Selaginella moellendorffii]
 gb|EFJ17368.1| hypothetical protein SELMODRAFT_444930 [Selaginella moellendorffii]
 gb|EFJ35399.1| hypothetical protein SELMODRAFT_165790 [Selaginella moellendorffii]
Length=173

 Score =   248 bits (632),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            +  NP+VFFDI +GG P GRIVMEL+ADT P+TAENFRALCTGEKG+GKSGKPLHYKGS 
Sbjct  1    MAANPKVFFDIAIGGSPAGRIVMELYADTVPKTAENFRALCTGEKGIGKSGKPLHYKGSK  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHRVIP+FMCQGGDFTAGNGTGGESIYG KF DENF KKHTG G+LSMANAG NTNGSQF
Sbjct  61   FHRVIPDFMCQGGDFTAGNGTGGESIYGMKFADENFNKKHTGAGVLSMANAGANTNGSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            F+CT    WLDGKHVVFGQVVEGL++VK +E+VGS SG+ S
Sbjct  121  FLCTVPCSWLDGKHVVFGQVVEGLNIVKDIEKVGSSSGKTS  161



>ref|XP_008788379.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Phoenix 
dactylifera]
Length=189

 Score =   248 bits (634),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NPRV+FDIT+GG P GRIVMELFAD TP+TAENFRALCTGEKG+G+S KPLHYKGSTFHR
Sbjct  4    NPRVYFDITIGGAPAGRIVMELFADVTPKTAENFRALCTGEKGLGRSRKPLHYKGSTFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGGESIYG+KF DENFV +H GPG +SMANAGPNTNGSQFFIC
Sbjct  64   VIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVNRHKGPGFVSMANAGPNTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            TA   WLDG+HVVFGQVVEG+DVV  +E+VGS  GR S
Sbjct  124  TAGAPWLDGRHVVFGQVVEGMDVVIAIEKVGSRGGRTS  161



>emb|CDX72741.1| BnaC07g47630D [Brassica napus]
Length=172

 Score =   248 bits (632),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFDI++ GQ  GRIVMEL+ D TP+TAENFRALCTGEKGVG+ GKPLH+KGS+F
Sbjct  1    MAFPKVFFDISINGQAAGRIVMELYTDKTPKTAENFRALCTGEKGVGRKGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG KF+DENF +KHTGPG LSMANAG NTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGDKFEDENFERKHTGPGNLSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT+WLDGKHVVFGQVVEGLDVVK +E+VGS SG+ S
Sbjct  121  ICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPS  160



>gb|ABI18377.1| cyclophilin [Steinernema carpocapsae]
Length=170

 Score =   248 bits (632),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   PRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHRV  251
            PRVFFD+T+GG+  GRIVMEL+ D  P+TAENFRALCTGEKG+GKSGKPLHYKGS FHRV
Sbjct  3    PRVFFDLTIGGKAAGRIVMELYNDIVPRTAENFRALCTGEKGMGKSGKPLHYKGSKFHRV  62

Query  252  IPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFICT  431
            IPNFM QGGDFT GNGTGGESIYG KF DENF ++HTGPGILSMANAGPNTNGSQFF+CT
Sbjct  63   IPNFMIQGGDFTRGNGTGGESIYGEKFNDENFKERHTGPGILSMANAGPNTNGSQFFLCT  122

Query  432  AKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
             KTEWLDGKHVVFGQVVEGLD+VKKVE  GS SG+
Sbjct  123  VKTEWLDGKHVVFGQVVEGLDIVKKVESQGSQSGK  157



>ref|XP_001802932.1| hypothetical protein SNOG_12712 [Phaeosphaeria nodorum SN15]
 gb|EAT80010.1| hypothetical protein SNOG_12712 [Phaeosphaeria nodorum SN15]
Length=171

 Score =   247 bits (631),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+++GG P GRI+MELF D  P+TAENFRALCTGEKG G+SGKPLHY+GS+F
Sbjct  1    MSNPKVFFDVSIGGAPAGRIIMELFQDQVPKTAENFRALCTGEKGTGRSGKPLHYQGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FM QGGDFT GNGTGGESIYG KF+DENF  KHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPQFMLQGGDFTRGNGTGGESIYGEKFEDENFNLKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEGLDVV+ VE+VGS SG+ +
Sbjct  121  ICTVKTSWLDGKHVVFGQVVEGLDVVQAVERVGSSSGKTA  160



>sp|P21569.1|CYPH_MAIZE RecName: Full=Peptidyl-prolyl cis-trans isomerase; Short=PPIase; 
AltName: Full=Cyclophilin; AltName: Full=Cyclosporin A-binding 
protein; AltName: Full=Rotamase [Zea mays]
 gb|AAA63403.1| cyclophilin [Zea mays]
 emb|CAA48638.1| cyclophilin [Zea mays]
Length=172

 Score =   247 bits (630),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+A+  P+TAENFRALCTGEKGVGKSGKPLHYKGSTF
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FMCQGGDFT GNGTGGESIYG KF DE FV+K   PG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPEFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKQPAPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT  T WLDGKHVVFGQVVEG+DVVK +E+VG+ +G  S
Sbjct  121  ICTVATPWLDGKHVVFGQVVEGMDVVKAIEKVGTRNGSTS  160



>ref|XP_006442714.1| hypothetical protein CICLE_v10022535mg [Citrus clementina]
 gb|ESR55954.1| hypothetical protein CICLE_v10022535mg [Citrus clementina]
Length=174

 Score =   247 bits (630),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFDI +G    GR+VMELFAD TP+TAENFRALCTGEKG+G SGKPLHYKGSTF
Sbjct  1    MTNPRVFFDILIGKMNKGRVVMELFADVTPKTAENFRALCTGEKGIGTSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESIYG KF DENF  KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRGNGTGGESIYGMKFADENFKMKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFG+VV+G  V+K +E+VGS SGR S
Sbjct  121  ICTQKTPWLDGKHVVFGKVVDGYSVIKDMEKVGSESGRTS  160



>ref|XP_006487732.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like [Citrus 
sinensis]
 gb|KDO50002.1| hypothetical protein CISIN_1g030603mg [Citrus sinensis]
Length=174

 Score =   246 bits (629),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFDI +G    GR+VMELFAD TP+TAENFRALCTGEKG+G SGKPLHYKGSTF
Sbjct  1    MTNPRVFFDILIGKMNKGRVVMELFADVTPKTAENFRALCTGEKGIGMSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESIYG KF DENF  KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRGNGTGGESIYGMKFADENFKMKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFG+VV+G  V+K +E+VGS SGR S
Sbjct  121  ICTQKTPWLDGKHVVFGKVVDGYSVIKDMEKVGSESGRTS  160



>gb|EMD94092.1| hypothetical protein COCHEDRAFT_1201904 [Bipolaris maydis C5]
 gb|ENI07606.1| hypothetical protein COCC4DRAFT_30972 [Bipolaris maydis ATCC 
48331]
Length=171

 Score =   246 bits (629),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+++GG P GRIVMEL+AD  P+TAENFRALCTGEKG GKSGKPLHY+GS F
Sbjct  1    MSNPRVFFDVSIGGDPAGRIVMELYADKVPKTAENFRALCTGEKGTGKSGKPLHYEGSVF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FM QGGDFT GNGTGGESIYG KF+DENF   HTGPG+LSMANAGP TNGSQFF
Sbjct  61   HRVIPQFMLQGGDFTRGNGTGGESIYGEKFEDENFKLSHTGPGVLSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQVVEG+DVV+ VE+VGS +G+ S
Sbjct  121  ICTVKTSWLDGKHVVFGQVVEGMDVVQAVEKVGSQTGKTS  160



>gb|ABV22152.1| cyclophilin [Perkinsus chesapeaki]
Length=182

 Score =   246 bits (629),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP VFFDIT+GG P GRI  ELFAD  PQTAENFR LCTGEKG GKSGKPLH+KGS F
Sbjct  1    MPNPTVFFDITIGGSPAGRITFELFADVVPQTAENFRCLCTGEKGTGKSGKPLHFKGSGF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IP FMCQGGDFT GNGTGGESIYGSKFKDENF  KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRIIPKFMCQGGDFTNGNGTGGESIYGSKFKDENFQLKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFG+VV+G+DVV+K+E VGS SG  S
Sbjct  121  ICTEKTSWLDGKHVVFGKVVDGMDVVRKMEGVGSSSGATS  160



>gb|ABU56008.1| cyclophilin 3 [Dasypyrum villosum]
 gb|ABU56009.1| cyclophilin 4 [Dasypyrum villosum]
Length=171

 Score =   246 bits (628),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+ D  P+T ENFRALCTGEKGVGKSGKPLHYKGS F
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYKDAVPRTVENFRALCTGEKGVGKSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFT GNGTGGESIYG KF DE FV KHT PGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPDFMCQGGDFTRGNGTGGESIYGEKFADEKFVHKHTKPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT    WLDGKHVVFG+VVEG+DVVK +E+VGS SG
Sbjct  121  ICTVPCNWLDGKHVVFGEVVEGMDVVKNIEKVGSRSG  157



>ref|XP_010419253.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-2-like [Camelina 
sativa]
Length=164

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            +P+VFFD+T+GG P G+IVMEL+ D TP+TAENFRALCTGEKGVG+SGKPLH+KGS FHR
Sbjct  4    HPKVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSAFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIPNFMCQGGDFTAGNGTGGESIYGSKF DENF +KHTGPGILSMANAG NTNGSQFFIC
Sbjct  64   VIPNFMCQGGDFTAGNGTGGESIYGSKFADENFERKHTGPGILSMANAGANTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQV  518
            T KT+WLDGKHVVFGQV+EGLDVVK +E+V
Sbjct  124  TVKTDWLDGKHVVFGQVIEGLDVVKAIEKV  153



>gb|ACG70968.1| cyclophilin [Ziziphus jujuba]
Length=174

 Score =   246 bits (628),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    GR+VMELFAD TP+TAENFR LCTGEKG+G SGKPLHYKGSTF
Sbjct  1    MSNPKVFFDILIGKMKAGRVVMELFADVTPKTAENFRVLCTGEKGIGISGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESIYG+KF DENF  KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRGNGTGGESIYGTKFADENFKLKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFG+VV+G +VVK++E+VGS SGR S
Sbjct  121  ICTEKTPWLDGKHVVFGKVVDGYNVVKEMEKVGSDSGRTS  160



>ref|XP_003295671.1| hypothetical protein PTT_02276 [Pyrenophora teres f. teres 0-1]
 gb|EFQ96228.1| hypothetical protein PTT_02276 [Pyrenophora teres f. teres 0-1]
Length=171

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+++GG P GRIVMELFAD  P+TAENFRALCTGEKG GKSGKPLHYKGS+F
Sbjct  1    MSNPKVFFDLSIGGAPAGRIVMELFADEVPKTAENFRALCTGEKGTGKSGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FM QGGDFT GNGTGGESIYG KF DENF  KHTGPGILSMANAG NTNGSQFF
Sbjct  61   HRVIPQFMLQGGDFTRGNGTGGESIYGEKFADENFNLKHTGPGILSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFGQV EGLD+V+ VE+VGS SG  S
Sbjct  121  ICTVKTGWLDGKHVVFGQVKEGLDIVQAVEKVGSSSGATS  160



>gb|KJB77727.1| hypothetical protein B456_012G153100 [Gossypium raimondii]
Length=173

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +3

Query  60   IMGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGST  239
            ++ NP+VFF++T+GG+P GRIVMELFAD TP+TAENFRALCTGEKGVG+SGKPLHYKGS 
Sbjct  1    MVSNPKVFFEVTIGGEPAGRIVMELFADVTPRTAENFRALCTGEKGVGRSGKPLHYKGSK  60

Query  240  FHRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQF  419
            FHRVIP+F+CQGGDFTAGNGTGGESIYGS F DENF+KKH GPG+LSMANAGP TN SQF
Sbjct  61   FHRVIPDFICQGGDFTAGNGTGGESIYGSNFADENFIKKHIGPGVLSMANAGPGTNKSQF  120

Query  420  FICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            FICT K EWLDGKHVVFG+VVEG+ VV+ +E+VGS  G+ +
Sbjct  121  FICTTKAEWLDGKHVVFGRVVEGMKVVRDIEKVGSSRGKTT  161



>gb|ABU56006.1| cyclophilin 1 [Dasypyrum villosum]
Length=171

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+ D  P+T ENFRALCTGEKGVGKSGKPLHYKGS F
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYKDAVPRTVENFRALCTGEKGVGKSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFT GNGTGGESIYG KF DE FV KHT PGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPDFMCQGGDFTRGNGTGGESIYGEKFADEKFVYKHTKPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT    WLDGKHVVFG+VVEG+DVVK +E+VGS SG
Sbjct  121  ICTVPCNWLDGKHVVFGEVVEGMDVVKNIEKVGSRSG  157



>gb|ABU56007.1| cyclophilin 2 [Dasypyrum villosum]
Length=171

 Score =   245 bits (626),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFD+TVGG P GRIVMEL+ D  P+T ENFRALC GEKGVGKSGKPLHYKGS F
Sbjct  1    MANPRVFFDMTVGGAPAGRIVMELYKDAVPRTVENFRALCAGEKGVGKSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFT GNGTGGESIYG KF DE FV+KHT PGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPDFMCQGGDFTRGNGTGGESIYGEKFADEKFVQKHTKPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT    WLDGKHVVFG+VVEG+DVVK +E+VGS SG
Sbjct  121  ICTVPCNWLDGKHVVFGEVVEGMDVVKNIEKVGSRSG  157



>ref|XP_008788633.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
[Phoenix dactylifera]
Length=173

 Score =   245 bits (626),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NPRV+FDI++GG P GRIVMELFAD  P+TAENFRALCTGEKG+G+ GKPLHY GS FHR
Sbjct  4    NPRVYFDISIGGAPAGRIVMELFADVVPRTAENFRALCTGEKGIGRFGKPLHYXGSVFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGG+  YG KF+DE+FVKKHTGPG+LSMANAGPNTNGSQFFIC
Sbjct  64   VIPEFMCQGGDFTAGNGTGGDCNYGPKFQDESFVKKHTGPGVLSMANAGPNTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            TA T WLDGKHVVFGQVVEG+DVVK +E VGS +GR
Sbjct  124  TATTSWLDGKHVVFGQVVEGMDVVKAIENVGSPTGR  159



>ref|XP_009101932.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP18-3-like [Brassica 
rapa]
 emb|CDY22414.1| BnaA06g37360D [Brassica napus]
Length=172

 Score =   245 bits (625),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFDI + GQ  GRIVMEL+ D TP+TAENFRALCTGEKGVG+ GKPLH+KGS+F
Sbjct  1    MAFPKVFFDININGQAAGRIVMELYTDKTPKTAENFRALCTGEKGVGRKGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFTAGNGTGGESIYG KF+DENF +KHTGPG LSMANAG NTNGSQFF
Sbjct  61   HRVIPSFMCQGGDFTAGNGTGGESIYGDKFEDENFERKHTGPGNLSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT+WLDGKHVVFGQVVEGLDVVK +E+VGS SG+ S
Sbjct  121  ICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPS  160



>ref|XP_006295960.1| hypothetical protein CARUB_v10025110mg [Capsella rubella]
 gb|EOA28858.1| hypothetical protein CARUB_v10025110mg [Capsella rubella]
Length=174

 Score =   245 bits (625),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            +P+VFFD+T+GG   G+IVMEL+ D TP+TAENFRALCTGEKGVG+SGKPLH+KGS+FHR
Sbjct  4    HPKVFFDMTIGGAAAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP+FMCQGGDFTAGNGTGGESIYG+KF+DENF +KHTGPGILSMANAG NTNGSQFFIC
Sbjct  64   VIPDFMCQGGDFTAGNGTGGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            T KT WLDGKHVVFGQV+EGLDVVK +E++GS SG+
Sbjct  124  TVKTGWLDGKHVVFGQVIEGLDVVKAIEKIGSLSGK  159



>ref|NP_001267698.1| peptidyl-prolyl cis-trans isomerase 1-like [Cucumis sativus]
 ref|XP_004170608.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like [Cucumis 
sativus]
 gb|AAX94775.1| cyclophilin [Cucumis sativus]
 gb|KGN43230.1| hypothetical protein Csa_7G009740 [Cucumis sativus]
Length=172

 Score =   244 bits (624),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+T+GG P GRI+MEL+AD TP+TAENFRALCTGEKGVGK GKPLHYKGS+F
Sbjct  1    MPNPKVFFDMTIGGTPAGRIIMELYADVTPRTAENFRALCTGEKGVGKGGKPLHYKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKT+WLDGKHVVFGQVVEG++VVK VE+VGS SGR S
Sbjct  121  ICTAKTDWLDGKHVVFGQVVEGMNVVKDVEKVGSSSGRTS  160



>ref|XP_002521961.1| cyclophilin, putative [Ricinus communis]
 gb|EEF40365.1| cyclophilin, putative [Ricinus communis]
Length=174

 Score =   244 bits (624),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    GRIVMELFAD TP+TAENFRALCTGEKG+G  GKPLHYKGSTF
Sbjct  1    MSNPKVFFDILIGKMKAGRIVMELFADFTPKTAENFRALCTGEKGIGSVGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESIYG KF DENF  KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRGNGTGGESIYGMKFADENFKMKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFG+VV+G  VVK++E+VGS SGR S
Sbjct  121  ICTEKTPWLDGKHVVFGKVVDGYSVVKEMEKVGSESGRTS  160



>ref|XP_008915854.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
INRA-310]
 gb|ACR82293.1| cyclophilin A [Phytophthora nicotianae]
 gb|ETI55135.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
P1569]
 gb|ETK94967.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETL48352.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETM01450.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETM54648.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica]
 gb|ETM98851.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
INRA-310]
 gb|ETO83875.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
P1976]
 gb|ETP24947.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
CJ01A1]
 gb|ETP52938.1| peptidyl-prolyl cis-trans isomerase [Phytophthora parasitica 
P10297]
Length=171

 Score =   244 bits (624),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGG P GRI  ELFAD  P+TAENFRALCTGEKGVG+SGKPLHYKGS F
Sbjct  1    MPNPQVFFDMTVGGAPAGRITFELFADKVPKTAENFRALCTGEKGVGRSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFT GNGTGGESIYG KF DENF+ KH G GILSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTRGNGTGGESIYGEKFPDENFLLKHKGEGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            ICT +T WLDGKHVVFG+VVEG+DVVK +E VGS SG+
Sbjct  121  ICTVETSWLDGKHVVFGRVVEGMDVVKAIESVGSQSGQ  158



>gb|ABS85544.1| cyclophilin [Triticum aestivum]
Length=171

 Score =   244 bits (624),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGG P GRIVMEL+ D  P+T ENFRALCTGEKGVGKSGKPLHYKGS F
Sbjct  1    MANPKVFFDMTVGGAPAGRIVMELYKDAVPRTVENFRALCTGEKGVGKSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFT GNGTGGESIYG KF DE FV KHT PGILSMANAGPNTNGSQFF
Sbjct  61   HRVIPDFMCQGGDFTRGNGTGGESIYGEKFADEKFVHKHTKPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT    WLDGKHVVFG+VVEG+DVVK +E+VGS SG
Sbjct  121  ICTVPCNWLDGKHVVFGEVVEGMDVVKNIEKVGSRSG  157



>ref|WP_014393514.1| peptidylprolyl isomerase [Corallococcus coralloides]
 gb|AFE09954.1| peptidyl-prolyl cis-trans isomerase [Corallococcus coralloides 
DSM 2259]
Length=171

 Score =   244 bits (623),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M N +VFFD+++GGQP GRIVMELF+D  P+TAENFRALCTGEKGVGKSGK LH+KG+ F
Sbjct  1    MANAKVFFDMSIGGQPAGRIVMELFSDDVPKTAENFRALCTGEKGVGKSGKALHFKGTPF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGD T GNG GGESIYG KF DENF  KHTGPGILSMANAGPN+NGSQFF
Sbjct  61   HRVIPNFMCQGGDITLGNGYGGESIYGEKFADENFKHKHTGPGILSMANAGPNSNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            + T KT+WLDGKHVVFG+VVEG+DVVKK+E VGS SG
Sbjct  121  LTTVKTDWLDGKHVVFGKVVEGMDVVKKIEGVGSQSG  157



>gb|AHV84998.1| peptidylprolyl isomerase [Brassica rapa]
Length=172

 Score =   244 bits (623),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFDI + GQ  GRIVMEL+ D TP+TAENFRALCTGEKGVG+ GKPLH+KGS+F
Sbjct  1    MAFPKVFFDININGQAAGRIVMELYTDKTPKTAENFRALCTGEKGVGRKGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP+FMCQGGDFTAGNGTGGESIYG KF+DENF +KHTGPG LSMANAG NTNGSQFF
Sbjct  61   HRVIPSFMCQGGDFTAGNGTGGESIYGDKFEDENFERKHTGPGNLSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT+WLDGKHVVFGQVVEGLDVVK +E++GS SG+ S
Sbjct  121  ICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKLGSSSGKPS  160



>ref|XP_010940596.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Elaeis 
guineensis]
 ref|XP_010940597.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Elaeis 
guineensis]
 ref|XP_010940598.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Elaeis 
guineensis]
 ref|XP_010940599.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Elaeis 
guineensis]
Length=174

 Score =   244 bits (623),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    GRI+MELFAD TP+TAENFR LCTGEKG+G+SGKPLHYKGSTF
Sbjct  1    MANPKVFFDILIGRAKAGRILMELFADVTPKTAENFRCLCTGEKGIGRSGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESIYG KF+DENF KKHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRGNGTGGESIYGLKFEDENFKKKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KT WLDGKHVVFG+V++G  VV+ +E+VGS  GR S
Sbjct  121  ICTEKTAWLDGKHVVFGKVIDGYSVVQAMEKVGSEGGRTS  160



>ref|XP_010920189.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Elaeis guineensis]
Length=173

 Score =   244 bits (623),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NPRV+ DIT+GG   GRIV+ELFAD TP+TAENFRALCTGE G G+SGK LHYKGSTFHR
Sbjct  4    NPRVYLDITIGGALAGRIVVELFADVTPKTAENFRALCTGENGFGRSGKRLHYKGSTFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP FMCQGGDFTAGNGTGGESIYG+KF DE+FV+KHTGPG++SMAN+GPNTNGSQFFIC
Sbjct  64   VIPGFMCQGGDFTAGNGTGGESIYGAKFADEDFVRKHTGPGVVSMANSGPNTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
             AKT WLDG+HVVFGQVVEG+DVV  +E+VGS  GR S
Sbjct  124  MAKTPWLDGRHVVFGQVVEGMDVVTAIEKVGSAGGRTS  161



>ref|XP_007159996.1| hypothetical protein PHAVU_002G284200g [Phaseolus vulgaris]
 gb|ESW31990.1| hypothetical protein PHAVU_002G284200g [Phaseolus vulgaris]
Length=175

 Score =   244 bits (623),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFDI +G    GR+VMELFADTTP+TAENFRALCTGEKG+G+SGKPLHYKGS+FHR
Sbjct  4    NPKVFFDILIGKMKAGRVVMELFADTTPKTAENFRALCTGEKGIGQSGKPLHYKGSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            +IP FMCQGGDFT GNGTGGESIYGSKF+DENF  KHT PGILSMAN+GP+TNGSQFFIC
Sbjct  64   IIPEFMCQGGDFTRGNGTGGESIYGSKFQDENFKLKHTAPGILSMANSGPHTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            T KT WLDGKHVVFG+VV+G  VVK++E+VGSGSG+ S
Sbjct  124  TTKTPWLDGKHVVFGKVVDGYSVVKEMEKVGSGSGKTS  161



>ref|XP_009520427.1| hypothetical protein PHYSODRAFT_285045 [Phytophthora sojae]
 gb|EGZ25139.1| hypothetical protein PHYSODRAFT_285045 [Phytophthora sojae]
Length=171

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGG P GRI  ELFAD  P+TAENFRALCTGEKGVG+SGKPLHYKGS F
Sbjct  1    MPNPQVFFDMTVGGAPAGRITFELFADKVPKTAENFRALCTGEKGVGRSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFT GNGTGGESIYG KF DENF+ KH G GILSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTRGNGTGGESIYGEKFPDENFLLKHKGEGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            ICT +T WLDGKHVVFG+VV+G+DVVK +E VGS SG+
Sbjct  121  ICTVETSWLDGKHVVFGRVVDGMDVVKNIEAVGSQSGQ  158



>ref|XP_001902628.1| cyclophilin-type peptidyl-prolyl cis-trans isomerase-2, Bmcyp-2 
[Brugia malayi]
 emb|CDP95662.1| Protein Bm7143 [Brugia malayi]
Length=171

 Score =   243 bits (621),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFDIT+GG   GRIVMELFAD  P+TAENFR LCTGE+G+G+SGK LHYKGS F
Sbjct  1    MSRPKVFFDITIGGSNAGRIVMELFADIVPKTAENFRCLCTGERGMGRSGKKLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFM QGGDFT GNGTGGESIYG KF DENF +KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMLQGGDFTRGNGTGGESIYGEKFPDENFQEKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFG+VVEG++VVK VE  GS SGR S
Sbjct  121  ICTAKTEWLDGKHVVFGRVVEGMNVVKAVESKGSQSGRTS  160



>gb|AAF65770.1|AF242312_1 cyclophilin [Euphorbia esula]
Length=160

 Score =   243 bits (620),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  99   GGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHRVIPNFMCQgg  278
            GG P GRIVMEL+ADTTP+TAENFRALCTGEKGVG+S KPLH+KGS+FHRVIP FMCQGG
Sbjct  1    GGAPVGRIVMELYADTTPRTAENFRALCTGEKGVGRSRKPLHFKGSSFHRVIPGFMCQGG  60

Query  279  dftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGK  458
            DFTAGNGTGGESIYG+KF DENF+KKHTGPGILSMANAGP TNGSQFFICTAKTEWLDGK
Sbjct  61   DFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLDGK  120

Query  459  HVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            HVVFG+VVEG+DVVK +E+VGS SGR S
Sbjct  121  HVVFGKVVEGMDVVKAIEKVGSSSGRTS  148



>gb|AEF01109.1| cyclophilin 1 [Tagetes patula]
Length=156

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  108  PTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHRVIPNFMCQggdft  287
            P GRIVMELFADTTP+TAENFRALCTGEKG G SGKPLH+KGS+FHRVIPNFMCQGGDFT
Sbjct  1    PAGRIVMELFADTTPRTAENFRALCTGEKGKGSSGKPLHFKGSSFHRVIPNFMCQGGDFT  60

Query  288  agngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVV  467
             GNGTGGESIYG+KF DENFVKKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVV
Sbjct  61   RGNGTGGESIYGNKFADENFVKKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVV  120

Query  468  FGQVVEGLDVVKKVEQVGSGSGRCS  542
            FG+V+EG++VVK +E+VGSGSG  S
Sbjct  121  FGKVIEGMEVVKAIEKVGSGSGTTS  145



>pdb|4JCP|A Chain A, Structure Of Cyclophilin B From Brugia Malayi
Length=175

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFDIT+GG   GRIVMELFAD  P+TAENFR LCTGE+G+G+SGK LHYKGS F
Sbjct  5    MSRPKVFFDITIGGSNAGRIVMELFADIVPKTAENFRCLCTGERGMGRSGKKLHYKGSKF  64

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFM QGGDFT GNGTGGESIYG KF DENF +KHTGPG+LSMANAGPNTNGSQFF
Sbjct  65   HRVIPNFMLQGGDFTRGNGTGGESIYGEKFPDENFQEKHTGPGVLSMANAGPNTNGSQFF  124

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFG+VVEG++VVK VE  GS SGR S
Sbjct  125  ICTAKTEWLDGKHVVFGRVVEGMNVVKAVESKGSQSGRTS  164



>gb|ACX47902.1| cyclophilin [Gnathostoma spinigerum]
Length=172

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFDI++GGQ  GRIVMELFAD  P+TAENFRA CTGE+G G+SGKPL YKGS F
Sbjct  1    MSRPKVFFDISIGGQDAGRIVMELFADIVPKTAENFRAPCTGERGEGRSGKPLTYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFM QGGDFT GNGTGGESIYG KF DENF +KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMLQGGDFTRGNGTGGESIYGEKFADENFQEKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT KTEWLDG+HVVFG+V+EG+DVVKK+E  GS SG+ S
Sbjct  121  ICTVKTEWLDGRHVVFGRVIEGMDVVKKIESKGSASGKTS  160



>ref|XP_004302078.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like [Fragaria 
vesca subsp. vesca]
Length=176

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFDI +GG   GRIVM+LFAD TP+TAENFRALCTGEKG+G SGK LHYKGS F
Sbjct  1    MSNPRVFFDILIGGMKAGRIVMKLFADATPKTAENFRALCTGEKGIGSSGKRLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESIYG+KF+DENF  KHTGPGILSMAN+GPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRGNGTGGESIYGAKFEDENFKLKHTGPGILSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT KT WLDGKHVVFG+VV+G  +V+K+E+VGS SG
Sbjct  121  ICTDKTSWLDGKHVVFGKVVDGYSIVQKMEKVGSDSG  157



>gb|AES82695.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=172

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    G+IVMELFAD TP+TAENFRALCTGE+G+G+ GKPLHYKGS F
Sbjct  1    MSNPKVFFDILIGRMKAGKIVMELFADATPKTAENFRALCTGERGIGQCGKPLHYKGSGF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IP FMCQGGDFT GNGTGGESIYGSKF DENF  KHTGPGILSMAN+GPNTNGSQFF
Sbjct  61   HRIIPEFMCQGGDFTKGNGTGGESIYGSKFADENFKLKHTGPGILSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT+KT+WLDGKHVVFG+VVEG DVV+ +E+VGS +GR S
Sbjct  121  ICTSKTQWLDGKHVVFGKVVEGYDVVQAMEKVGSQNGRTS  160



>ref|XP_003626477.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
 gb|ACJ86207.1| unknown [Medicago truncatula]
 gb|AFK34690.1| unknown [Medicago truncatula]
 gb|AFK35696.1| unknown [Medicago truncatula]
Length=172

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    G+IVMELFAD TP+TAENFRALCTGE+G+G+ GKPLHYKGS F
Sbjct  1    MSNPKVFFDILIGRMKAGKIVMELFADATPKTAENFRALCTGERGIGQCGKPLHYKGSGF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IP FMCQGGDFT GNGTGGESIYGSKF DENF  KHTGPGILSMAN+GPNTNGSQFF
Sbjct  61   HRIIPEFMCQGGDFTKGNGTGGESIYGSKFADENFKLKHTGPGILSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICT+KT+WLDGKHVVFG+VVEG DVV+ +E+VGS +GR S
Sbjct  121  ICTSKTQWLDGKHVVFGKVVEGYDVVQAMEKVGSQNGRTS  160



>gb|AGH55662.1| cyclophilin, partial [Atropa belladonna]
Length=146

 Score =   242 bits (617),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  114  GRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHRVIPNFMCQggdftag  293
            GR+VMEL+ADT P+TAENFRALCTGEKGVGK GKPLHYKGSTFHRVIP FMCQGGDFTAG
Sbjct  1    GRVVMELYADTVPKTAENFRALCTGEKGVGKMGKPLHYKGSTFHRVIPGFMCQGGDFTAG  60

Query  294  ngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFG  473
            NGTGGESIYG+KF DENFV+KHTGPGILSMANAGP TNGSQFFICTAKTEWLDGKHVVFG
Sbjct  61   NGTGGESIYGAKFADENFVRKHTGPGILSMANAGPGTNGSQFFICTAKTEWLDGKHVVFG  120

Query  474  QVVEGLDVVKKVEQVGSGSGRCS  542
            QV EG DV+KK E VGS SGRCS
Sbjct  121  QVTEGFDVIKKAEAVGSSSGRCS  143



>gb|AAV48823.1| cyclophilin 1 [Codonopsis lanceolata]
Length=174

 Score =   243 bits (619),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    GRIVMELFAD+TP+TAENFRALCTGEKG+G SGKPLHYKGS F
Sbjct  1    MSNPKVFFDIVIGKMKAGRIVMELFADSTPKTAENFRALCTGEKGIGLSGKPLHYKGSIF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT  NGTGGESIYG+KF DENF  KHTGPGILSMAN+GPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRFNGTGGESIYGAKFADENFKNKHTGPGILSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT KT WLDGKHVVFG+VV+G  VVK++E+VGS  G
Sbjct  121  ICTEKTSWLDGKHVVFGKVVDGYSVVKEMEKVGSDGG  157



>gb|AEP37836.1| cyclophilin a [Plasmopara viticola]
Length=171

 Score =   242 bits (618),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGG P GRI  ELFAD  P+TAENFRALCTGEKGVG+SGKPLHYKGS F
Sbjct  1    MSNPQVFFDMTVGGAPAGRITFELFADKVPKTAENFRALCTGEKGVGRSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFT GNGTGGESIYG KF DENFV KH G GILSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTRGNGTGGESIYGEKFPDENFVLKHKGEGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            ICT +T WLDGKHVVFG+VV+G+ VVK +E VGS SG+
Sbjct  121  ICTVETSWLDGKHVVFGRVVDGMKVVKDIEAVGSQSGQ  158



>gb|ERG84468.1| peptidyl-prolyl cis-trans isomerase 3 [Ascaris suum]
Length=172

 Score =   242 bits (618),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P VFFDIT+GG+  GRIVMEL+ D  P+TAENFRALCTGEKG+GKSG PLHYKGS F
Sbjct  1    MPRPTVFFDITIGGKAVGRIVMELYNDIVPKTAENFRALCTGEKGIGKSGVPLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFT GNGTGGESIYG KF DENF +KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTRGNGTGGESIYGEKFADENFQEKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            +CT KT+WLDGKHVVFG+V EG++VVK++E VGS SG+ +
Sbjct  121  LCTVKTDWLDGKHVVFGRVTEGMNVVKEIESVGSQSGKTA  160



>gb|AFK44397.1| unknown [Lotus japonicus]
Length=174

 Score =   242 bits (618),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    GRI+MELFAD TP+TAENFRALCTGEKG+GKSGK LH+KGS F
Sbjct  1    MTNPKVFFDIAIGKTKAGRILMELFADVTPKTAENFRALCTGEKGIGKSGKGLHFKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IP+FMCQGGDFT GNGTGGESIYG+KF DENF  KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRIIPDFMCQGGDFTRGNGTGGESIYGAKFADENFKLKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKT WLDGKHVVFG+VV+G +VVK++E+VGSG G  S
Sbjct  121  ICTAKTPWLDGKHVVFGKVVDGYNVVKEMEKVGSGGGSTS  160



>ref|XP_002905297.1| peptidyl-prolyl cis-trans isomerase [Phytophthora infestans T30-4]
 gb|AAN31483.1| peptidylprolyl isomerase [Phytophthora infestans]
 gb|EEY68138.1| peptidyl-prolyl cis-trans isomerase [Phytophthora infestans T30-4]
Length=171

 Score =   242 bits (617),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFD+TVGG P GRI  ELFAD  P+TAENFRALCTGEKGVG+SGKPLH+KGS+F
Sbjct  1    MPNPQVFFDMTVGGAPAGRITFELFADKVPKTAENFRALCTGEKGVGRSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFMCQGGDFT GNGTGGESIYG KF DENF+ KH G GILSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMCQGGDFTRGNGTGGESIYGEKFPDENFLLKHKGEGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            ICT +T WLDGKHVVFG+VV+G+DVVK +E VGS SG+
Sbjct  121  ICTVETSWLDGKHVVFGRVVDGMDVVKNIESVGSQSGQ  158



>ref|XP_011036276.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Populus 
euphratica]
 ref|XP_011004768.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Populus 
euphratica]
Length=174

 Score =   242 bits (617),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    GRIVMELFAD TP+TAENFRALCTGEKG+G +GKPLHYKGSTF
Sbjct  1    MSNPKVFFDILIGKMKAGRIVMELFADATPKTAENFRALCTGEKGIGNAGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESIYG+KF DENF  KHTGPG+LSMAN+GPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRGNGTGGESIYGAKFADENFKLKHTGPGVLSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT KT WLDGKHVVFG+VV+G  VV+++E+VGS SG
Sbjct  121  ICTEKTSWLDGKHVVFGKVVDGYGVVQEMEKVGSNSG  157



>ref|XP_006577322.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 isoform 
X1 [Glycine max]
 ref|XP_006577323.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 isoform 
X2 [Glycine max]
 ref|XP_006577324.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 isoform 
X3 [Glycine max]
 gb|KHN35325.1| Peptidyl-prolyl cis-trans isomerase CYP19-3 [Glycine soja]
Length=175

 Score =   242 bits (617),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFDI +G    GR+VMELF D TP+TAENFRALCTGE G+GKSGKPLHYKGS FHR
Sbjct  4    NPKVFFDILIGKMKAGRVVMELFVDATPKTAENFRALCTGEMGIGKSGKPLHYKGSAFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            +IP FMCQGGDFT GNGTGGESIYGSKF DENF  +HTGPGILSMANAGP+TNGSQFFIC
Sbjct  64   IIPEFMCQGGDFTKGNGTGGESIYGSKFNDENFNLRHTGPGILSMANAGPHTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            TAKT WLDGKHVVFG+VV+G  VV+++E+VGSGSGR S
Sbjct  124  TAKTPWLDGKHVVFGKVVDGYSVVEEMEKVGSGSGRTS  161



>ref|XP_009372142.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like [Pyrus 
x bretschneideri]
 ref|XP_009373989.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like [Pyrus 
x bretschneideri]
Length=175

 Score =   242 bits (617),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    GR+VMELFAD TP+TAENFRALCTG+KG+G SGKPLH+KGSTF
Sbjct  1    MSNPKVFFDILIGRMKAGRVVMELFADKTPKTAENFRALCTGDKGIGLSGKPLHFKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNG GGESIYG+KF+DENF  KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRGNGIGGESIYGAKFEDENFNLKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTA+T WLDGKHVVFG+VV+G  VV+K+E+VGS SG  S
Sbjct  121  ICTARTPWLDGKHVVFGKVVDGYSVVEKMEKVGSESGTTS  160



>ref|XP_010934181.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Elaeis guineensis]
Length=172

 Score =   242 bits (617),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP V+FDIT+GG P GRIVM LFAD TP+TAENFRALCTGEKG G+SGKPLHYKGS+FHR
Sbjct  4    NPTVYFDITIGGAPEGRIVMVLFADVTPKTAENFRALCTGEKGFGRSGKPLHYKGSSFHR  63

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            VIP F+CQGGDFTAGNGTGGESIYG +F DENFVKKH GPG++SMANAGPNTNGSQFFIC
Sbjct  64   VIPGFVCQGGDFTAGNGTGGESIYGGRFPDENFVKKHIGPGVVSMANAGPNTNGSQFFIC  123

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            T  T WLDGKHVVFG VVEG+DVV+ +E+VGS  GR S
Sbjct  124  TIPTPWLDGKHVVFGHVVEGMDVVRAIEEVGSQWGRTS  161



>ref|XP_008370733.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like [Malus 
domestica]
Length=175

 Score =   242 bits (617),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    GR+VMELFAD TP+TAENFRALCTG+KG+G SGKPLH+KGSTF
Sbjct  1    MSNPKVFFDILIGRMKAGRVVMELFADKTPKTAENFRALCTGDKGIGLSGKPLHFKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESIYG+KF DENF  KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTKGNGTGGESIYGAKFADENFNLKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTA+T WLDGKHVVFG+VV+G  VV+K+E+VGS SG  S
Sbjct  121  ICTARTPWLDGKHVVFGKVVDGYSVVEKMEKVGSESGTTS  160



>ref|XP_002638373.1| C. briggsae CBR-CYN-3 protein [Caenorhabditis briggsae]
 emb|CAP35999.1| Protein CBR-CYN-3 [Caenorhabditis briggsae]
Length=171

 Score =   241 bits (616),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  PRVFFDIT+GG+ +GRIVMEL+ D  P TAENFRALCTGEKG GKSGKPLH+KGS F
Sbjct  1    MTRPRVFFDITIGGKASGRIVMELYNDIVPNTAENFRALCTGEKGTGKSGKPLHFKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFM QGGDFT GNGTGGESIYG KF DENF +KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGR  536
            +CT KTEWLDGKHVVFG+VVEG+DVVK VE  GS SG+
Sbjct  121  LCTVKTEWLDGKHVVFGRVVEGMDVVKAVESNGSQSGK  158



>ref|NP_506749.1| Protein CYN-7 [Caenorhabditis elegans]
 sp|P52015.2|CYP7_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 7; Short=PPIase 
7; AltName: Full=Cyclophilin-7; AltName: Full=Rotamase 
7 [Caenorhabditis elegans]
 emb|CAA21760.1| CYN-7 [Caenorhabditis elegans]
Length=171

 Score =   241 bits (616),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  PRVFFDIT+ G+PTGRIVMEL+ D  P+TAENFRALCTGEKGVGKSGKPLH+KGS F
Sbjct  1    MSRPRVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IP FM QGGDFT GNGTGGESIYG KF DENF +KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            +CT KT WLDGKHVVFG+VVEGLD+V KVE  GS SG
Sbjct  121  LCTVKTAWLDGKHVVFGRVVEGLDIVSKVEGNGSSSG  157



>ref|XP_003834284.1| similar to peptidyl-prolyl cis-trans isomerase [Leptosphaeria 
maculans JN3]
 emb|CBX90919.1| similar to peptidyl-prolyl cis-trans isomerase [Leptosphaeria 
maculans JN3]
Length=171

 Score =   241 bits (616),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFDIT+GG P GRIVMELFAD  P+TAENFRALCTGEKG G+SGKPLHYKGS F
Sbjct  1    MSNPRVFFDITIGGAPAGRIVMELFADQVPKTAENFRALCTGEKGTGRSGKPLHYKGSNF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIP FM QGGDFT GNGTGGESIYG KF+DENF  +HTGPGILSMANAGP TNGSQFF
Sbjct  61   HRVIPQFMLQGGDFTRGNGTGGESIYGEKFEDENFNLRHTGPGILSMANAGPGTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVE  512
            ICT KT WLDGKHVVFGQVVEGLDVV+ VE
Sbjct  121  ICTVKTSWLDGKHVVFGQVVEGLDVVQAVE  150



>ref|XP_004296656.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like [Fragaria 
vesca subsp. vesca]
Length=176

 Score =   241 bits (616),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NPRVFFDI +G    GRIVM+LFAD TP+TAENFRALCTGEKG+G SGK LHYKGS F
Sbjct  1    MSNPRVFFDILIGRMKAGRIVMQLFADATPKTAENFRALCTGEKGIGSSGKRLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESIYG+KF+DENF  KHTGPGILSMANAGPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRGNGTGGESIYGAKFEDENFKLKHTGPGILSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT KT WLDGKHVVFG+VV+G  VV+K+E+VGS SG
Sbjct  121  ICTDKTSWLDGKHVVFGKVVDGYGVVQKMEKVGSDSG  157



>ref|XP_002788075.1| cyclophilin 1, putative [Perkinsus marinus ATCC 50983]
 gb|EER19871.1| cyclophilin 1, putative [Perkinsus marinus ATCC 50983]
Length=172

 Score =   241 bits (615),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP VFFDIT+GG P GR+  EL AD  P TAENFR LCTGEKGVGKSGKPLH+KGS+F
Sbjct  1    MPNPTVFFDITIGGSPVGRVTFELAADVVPITAENFRCLCTGEKGVGKSGKPLHFKGSSF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IP FMCQGGDFT GNGTGGESIYG+KFKDENF  KHTGPGILSMAN+GPNTNGSQFF
Sbjct  61   HRIIPKFMCQGGDFTNGNGTGGESIYGAKFKDENFQLKHTGPGILSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT KT WLDGKHVVFG+V++G+DVV+K+E VGS SG
Sbjct  121  ICTEKTSWLDGKHVVFGKVIDGMDVVRKMESVGSSSG  157



>gb|AGI78541.1| cyclophilin [Suaeda salsa]
Length=176

 Score =   241 bits (615),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   NPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTFHR  248
            NP+VFFDI +G    GR+VMELFAD TP+TA+NFRALCTGEKG+GK GKPLHYKGS FHR
Sbjct  5    NPKVFFDILIGKSKAGRVVMELFADVTPKTADNFRALCTGEKGIGKLGKPLHYKGSAFHR  64

Query  249  VIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFFIC  428
            +IP FMCQGGDFT GNGTGGESIYGSKF DENF  KHTGPGILSMANAGPNTNGSQFFIC
Sbjct  65   IIPEFMCQGGDFTRGNGTGGESIYGSKFDDENFKLKHTGPGILSMANAGPNTNGSQFFIC  124

Query  429  TAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            TA+T WLDGKHVVFG+VV+G  VV+K+E+VGS SG  S
Sbjct  125  TARTPWLDGKHVVFGKVVDGYSVVEKMEKVGSDSGMTS  162



>ref|XP_010043280.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like isoform 
X2 [Eucalyptus grandis]
Length=190

 Score =   241 bits (616),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    GR+VMELFAD TP+TAENFRALCTGEKG+G+SGKPLHYKGSTF
Sbjct  17   MSNPKVFFDILIGKMKAGRVVMELFADVTPKTAENFRALCTGEKGIGRSGKPLHYKGSTF  76

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESIYG KF DENF  KHTG G+LSMANAGP+TNGSQFF
Sbjct  77   HRIIPNFMCQGGDFTRGNGTGGESIYGMKFADENFKMKHTGLGVLSMANAGPDTNGSQFF  136

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT KT WLDGKHVVFG+VV+G +VVK++E VGS SG
Sbjct  137  ICTEKTPWLDGKHVVFGKVVDGYNVVKEMESVGSDSG  173



>gb|EJW85904.1| cyclophilin-type peptidyl-prolyl cis-trans isomerase-2 [Wuchereria 
bancrofti]
Length=171

 Score =   241 bits (615),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFDIT+GG   GRIVMELFAD  P+TAENFR LCTGE+G+G+SGK LHYKGS F
Sbjct  1    MSRPKVFFDITIGGNNAGRIVMELFADIVPKTAENFRCLCTGERGMGRSGKKLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFM QGGDFT GNGTGGESIYG KF DENF +KHTGPG+LSMANAG NTNGSQFF
Sbjct  61   HRVIPNFMLQGGDFTRGNGTGGESIYGEKFPDENFQEKHTGPGVLSMANAGANTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFG+VVEG++VVK VE  GS SGR S
Sbjct  121  ICTAKTEWLDGKHVVFGRVVEGMNVVKAVESKGSQSGRTS  160



>gb|AAC47232.1| cyclophilin Dicyp-2 [Dirofilaria immitis]
Length=171

 Score =   241 bits (614),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+V+FDIT+ G   GRIVMELFAD  P+TAENFR LCTGE+GVG+SGK LHYKGS F
Sbjct  1    MSRPKVYFDITIDGSNAGRIVMELFADIVPKTAENFRCLCTGERGVGRSGKKLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFM QGGDFT GNGTGGESIYG KF DENF +KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMLQGGDFTRGNGTGGESIYGEKFPDENFQEKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFG+VVEG++VVK +E  GS SGR S
Sbjct  121  ICTAKTEWLDGKHVVFGRVVEGMNVVKAIESKGSQSGRTS  160



>ref|XP_010660113.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Vitis 
vinifera]
 emb|CAN61038.1| hypothetical protein VITISV_041753 [Vitis vinifera]
Length=174

 Score =   241 bits (614),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI VG    GRIVMELFAD TP+TAENFRALCTGEKG+G SGKPLHYKGS F
Sbjct  1    MSNPKVFFDILVGKMKAGRIVMELFADVTPKTAENFRALCTGEKGIGMSGKPLHYKGSAF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESI+G KF DENF  KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRGNGTGGESIHGMKFADENFTMKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT KT WLDGKHVVFG+VV+G  VVK++E+VG+ SG
Sbjct  121  ICTTKTPWLDGKHVVFGKVVDGYSVVKEMEKVGTDSG  157



>ref|XP_003142324.1| cyclophilin-type peptidyl-prolyl cis-trans isomerase-2 [Loa loa]
 gb|EFO21744.1| peptidyl-prolyl cis-trans isomerase 3 [Loa loa]
Length=171

 Score =   241 bits (614),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M  P+VFFDIT+GG   GRIVMELFAD  P+TAENFR LCTGE+G+G+ GK LHYKGS F
Sbjct  1    MARPKVFFDITIGGSNAGRIVMELFADIVPKTAENFRCLCTGERGIGRGGKKLHYKGSKF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HRVIPNFM QGGDFT GNGTGGESIYG KF DENF +KHTGPG+LSMANAGPNTNGSQFF
Sbjct  61   HRVIPNFMLQGGDFTRGNGTGGESIYGEKFPDENFQEKHTGPGVLSMANAGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSGRCS  542
            ICTAKTEWLDGKHVVFG+VVEG+++VK +E  GS SGR S
Sbjct  121  ICTAKTEWLDGKHVVFGRVVEGMNIVKAIEGKGSQSGRTS  160



>ref|XP_006388902.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
 gb|ABK93248.1| unknown [Populus trichocarpa]
 gb|ERP47816.1| peptidyl-prolyl cis-trans isomerase family protein [Populus trichocarpa]
Length=174

 Score =   241 bits (614),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MGNPRVFFDITVGGQPTGRIVMELFADTTPQTAENFRALCTGEKGVGKSGKPLHYKGSTF  242
            M NP+VFFDI +G    GRIVMELFAD TP+TAENFRALCTGEKG+G +GKPLHYKGSTF
Sbjct  1    MSNPKVFFDILIGKMKAGRIVMELFADATPKTAENFRALCTGEKGIGNAGKPLHYKGSTF  60

Query  243  HRVIPNFMCQggdftagngtggESIYGSKFKDENFVKKHTGPGILSMANAGPNTNGSQFF  422
            HR+IPNFMCQGGDFT GNGTGGESIYG+KF DENF  KHTGPG+LSMAN+GPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTRGNGTGGESIYGAKFADENFKLKHTGPGVLSMANSGPNTNGSQFF  120

Query  423  ICTAKTEWLDGKHVVFGQVVEGLDVVKKVEQVGSGSG  533
            ICT  T WLDGKHVVFG+VV+G  VV+++E+VGS SG
Sbjct  121  ICTENTSWLDGKHVVFGKVVDGYGVVQEMEKVGSNSG  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645