BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G14

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAL49749.1|AF452011_1  aquaporin-like protein                        304   9e-101   Petunia x hybrida [garden petunia]
ref|XP_009762763.1|  PREDICTED: probable aquaporin PIP1-2               301   2e-99    Nicotiana sylvestris
dbj|BAA20074.1|  water channel protein                                  301   2e-99    Nicotiana excelsior
ref|XP_009631880.1|  PREDICTED: probable aquaporin PIP1-2               300   5e-99    Nicotiana tomentosiformis
ref|XP_006362987.1|  PREDICTED: probable aquaporin PIP1-2-like          298   4e-98    Solanum tuberosum [potatoes]
ref|XP_009759265.1|  PREDICTED: probable aquaporin PIP1-2               297   4e-98    Nicotiana sylvestris
ref|XP_011084932.1|  PREDICTED: probable aquaporin PIP1-2               293   3e-96    Sesamum indicum [beniseed]
ref|NP_001289851.1|  probable aquaporin PIP1-2                          293   3e-96    
ref|XP_009386206.1|  PREDICTED: probable aquaporin PIP1-2 isoform X1    291   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU41267.1|  hypothetical protein MIMGU_mgv1a011292mg                290   2e-95    Erythranthe guttata [common monkey flower]
gb|KDO76246.1|  hypothetical protein CISIN_1g023107mg                   288   3e-95    Citrus sinensis [apfelsine]
gb|EYU19988.1|  hypothetical protein MIMGU_mgv1a011277mg                290   6e-95    Erythranthe guttata [common monkey flower]
gb|KDO76245.1|  hypothetical protein CISIN_1g023107mg                   288   6e-95    Citrus sinensis [apfelsine]
gb|EYU41266.1|  hypothetical protein MIMGU_mgv1a011292mg                289   8e-95    Erythranthe guttata [common monkey flower]
ref|XP_008787474.1|  PREDICTED: probable aquaporin PIP1-2               289   1e-94    Phoenix dactylifera
ref|XP_009386207.1|  PREDICTED: probable aquaporin PIP1-2 isoform X2    290   1e-94    
ref|XP_006439529.1|  hypothetical protein CICLE_v10021502mg             289   1e-94    Citrus clementina [clementine]
ref|XP_009400253.1|  PREDICTED: probable aquaporin PIP1-2               288   2e-94    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFJ44204.1|  plasma membrane intrinsic protein 1                     288   2e-94    Hedychium coronarium
ref|XP_006476548.1|  PREDICTED: probable aquaporin PIP1-2-like is...    288   3e-94    Citrus sinensis [apfelsine]
gb|AGT36590.1|  aquaporin                                               288   3e-94    Musa acuminata AAA Group [Cavendish banana]
ref|XP_009380931.1|  PREDICTED: aquaporin PIP1-1                        287   5e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011076722.1|  PREDICTED: probable aquaporin PIP1-5               287   6e-94    Sesamum indicum [beniseed]
gb|KJB25853.1|  hypothetical protein B456_004G212800                    283   1e-93    Gossypium raimondii
gb|AGG39697.1|  aquaporin protein AQU19                                 286   2e-93    Camellia sinensis [black tea]
gb|AHI54572.1|  aquaporin protein AQU19                                 286   2e-93    Camellia japonica [common camellia]
gb|KJB20657.1|  hypothetical protein B456_003G158100                    283   2e-93    Gossypium raimondii
gb|ABB13429.1|  plasma membrane intrinsic protein                       285   2e-93    Olea europaea
ref|XP_008437293.1|  PREDICTED: aquaporin PIP1-2                        285   2e-93    Cucumis melo [Oriental melon]
ref|XP_009420459.1|  PREDICTED: probable aquaporin PIP1-2               285   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382780.1|  PREDICTED: probable aquaporin PIP1-2               285   3e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010940492.1|  PREDICTED: probable aquaporin PIP1-2               285   3e-93    Elaeis guineensis
gb|AAT74898.1|  plasma membrane intrinsic protein PIP1-1                285   3e-93    Fraxinus excelsior
gb|KHG19073.1|  Aquaporin PIP1-3 -like protein                          285   4e-93    Gossypium arboreum [tree cotton]
ref|XP_004143901.1|  PREDICTED: probable aquaporin PIP1-2-like          285   4e-93    
gb|KJB25855.1|  hypothetical protein B456_004G212800                    283   4e-93    Gossypium raimondii
ref|XP_011076723.1|  PREDICTED: probable aquaporin PIP1-5               285   4e-93    Sesamum indicum [beniseed]
ref|XP_006476549.1|  PREDICTED: probable aquaporin PIP1-2-like is...    286   5e-93    
ref|XP_011076721.1|  PREDICTED: probable aquaporin PIP1-5               285   5e-93    Sesamum indicum [beniseed]
tpg|DAA33863.1|  TPA: aquaporin PIP1;9                                  283   7e-93    Gossypium hirsutum [American cotton]
gb|ABH09325.1|  putative aquaporin                                      284   8e-93    Vitis vinifera
gb|ABN14348.1|  aquaporin PIP1;2                                        284   1e-92    Vitis vinifera
ref|XP_011042268.1|  PREDICTED: probable aquaporin PIP1-2               284   1e-92    Populus euphratica
gb|ABR68794.1|  aquaporin PIP1-2                                        284   1e-92    Gossypium hirsutum [American cotton]
gb|AGG39696.1|  aquaporin protein AQU18                                 284   1e-92    Camellia sinensis [black tea]
gb|KCW77503.1|  hypothetical protein EUGRSUZ_D01836                     281   1e-92    Eucalyptus grandis [rose gum]
ref|NP_001267949.1|  aquaporin PIP1;2                                   283   1e-92    Vitis vinifera
ref|XP_002312147.1|  plasma membrane intrinsic protein 1-1              283   1e-92    Populus trichocarpa [western balsam poplar]
gb|AGD98710.1|  aquaporin protein 7                                     283   1e-92    Camellia sinensis [black tea]
gb|ADE34281.1|  aquaporin PIP1;12                                       283   2e-92    Gossypium hirsutum [American cotton]
gb|ACL14797.1|  plasma membrane intrinsic protein 1                     283   2e-92    Populus alba x Populus glandulosa
gb|KHG25052.1|  putative aquaporin PIP1-2                               283   2e-92    Gossypium arboreum [tree cotton]
gb|ABD63904.1|  aquaporin 1                                             283   2e-92    Gossypium hirsutum [American cotton]
ref|XP_011072833.1|  PREDICTED: probable aquaporin PIP-type pTOM75      283   2e-92    Sesamum indicum [beniseed]
ref|XP_009386050.1|  PREDICTED: probable aquaporin PIP1-2               283   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB25854.1|  hypothetical protein B456_004G212800                    283   2e-92    Gossypium raimondii
gb|ADE34282.1|  aquaporin PIP1;13                                       282   2e-92    Gossypium hirsutum [American cotton]
ref|XP_007040270.1|  Plasma membrane intrinsic protein 1,4 isoform 3    283   2e-92    
gb|AAF71818.1|AF141898_1  putative aquaporin PIP1-2                     283   3e-92    Vitis cinerea var. helleri x Vitis rupestris
ref|XP_002509815.1|  Aquaporin PIP1.3, putative                         283   3e-92    Ricinus communis
tpg|DAA33858.1|  TPA: aquaporin PIP1;4                                  283   3e-92    Gossypium hirsutum [American cotton]
gb|AHI54567.1|  aquaporin protein 7                                     283   3e-92    Camellia japonica [common camellia]
tpg|DAA33859.1|  TPA: aquaporin PIP1;5                                  282   3e-92    Gossypium hirsutum [American cotton]
gb|KHG13859.1|  putative aquaporin PIP-type 7a                          282   4e-92    Gossypium arboreum [tree cotton]
gb|KCW77504.1|  hypothetical protein EUGRSUZ_D01836                     281   4e-92    Eucalyptus grandis [rose gum]
ref|XP_006352272.1|  PREDICTED: probable aquaporin PIP-type pTOM7...    282   4e-92    Solanum tuberosum [potatoes]
dbj|BAF44223.1|  aquaporin                                              283   5e-92    Iris x hollandica [Dutch iris]
ref|XP_009386408.1|  PREDICTED: probable aquaporin PIP1-2               282   5e-92    Musa acuminata subsp. malaccensis [pisang utan]
gb|AHX99531.1|  aquaporin PIP1                                          282   6e-92    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAF80556.1|AF188843_1  plasma membrane aquaporin                     282   7e-92    Vitis vinifera
emb|CAH59432.1|  aquaporin 2                                            281   7e-92    Plantago major [cart-track plant]
ref|XP_010661719.1|  PREDICTED: aquaporin PIP1;2 isoform X1             283   7e-92    
emb|CAH60719.1|  putative plasma membrane intrinsic protein             281   8e-92    Populus tremula x Populus tremuloides
ref|NP_001289835.1|  probable aquaporin PIP-type pTOM75                 281   9e-92    
gb|ACB38232.1|  aquaporin                                               281   1e-91    Gerbera hybrid cultivar
ref|XP_010053244.1|  PREDICTED: aquaporin PIP1-3                        281   1e-91    Eucalyptus grandis [rose gum]
gb|AAZ91447.1|  PIP1 aquaporin                                          281   2e-91    Xerophyta humilis
gb|ABH09323.1|  putative aquaporin                                      281   2e-91    Vitis vinifera
ref|XP_007160075.1|  hypothetical protein PHAVU_002G290400g             281   2e-91    Phaseolus vulgaris [French bean]
gb|AAY22204.1|  putative aquaporin                                      281   2e-91    Phaseolus vulgaris [French bean]
gb|AHB33476.1|  plasma intrinsic protein 1-3                            281   2e-91    Cucumis sativus [cucumbers]
ref|XP_007040268.1|  Plasma membrane intrinsic protein 1,4 isoform 1    281   2e-91    
gb|AAF71817.1|  putative aquaporin PIP1-1                               280   2e-91    Vitis cinerea var. helleri x Vitis rupestris
gb|AIP86906.1|  aquaporin                                               280   2e-91    Vitis heyneana
ref|NP_001267918.1|  aquaporin-like                                     280   2e-91    Vitis vinifera
gb|ABH09322.1|  putative aquaporin                                      280   2e-91    Vitis vinifera
ref|XP_010089092.1|  putative aquaporin PIP1-4                          280   3e-91    Morus notabilis
ref|XP_010935853.1|  PREDICTED: probable aquaporin PIP1-2               280   3e-91    Elaeis guineensis
sp|Q7XSQ9.3|PIP12_ORYSJ  RecName: Full=Probable aquaporin PIP1-2;...    280   3e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010523742.1|  PREDICTED: aquaporin PIP1-1                        280   3e-91    Tarenaya hassleriana [spider flower]
gb|AFV92901.1|  putative PIP-type aquaporin                             280   4e-91    Lolium perenne [perennial ryegrass]
ref|XP_010095072.1|  Aquaporin PIP1-1                                   280   4e-91    Morus notabilis
ref|NP_001234139.1|  probable aquaporin PIP-type pTOM75                 280   4e-91    Solanum lycopersicum
ref|XP_010240237.1|  PREDICTED: probable aquaporin PIP1-2               280   4e-91    Brachypodium distachyon [annual false brome]
gb|KDP25424.1|  hypothetical protein JCGZ_20580                         280   5e-91    Jatropha curcas
ref|XP_003570076.1|  PREDICTED: aquaporin PIP1-1-like                   280   5e-91    
ref|XP_007009059.1|  Plasma membrane intrinsic protein 1,4              280   5e-91    Theobroma cacao [chocolate]
ref|XP_004976483.1|  PREDICTED: aquaporin PIP1-1-like                   280   5e-91    Setaria italica
ref|XP_010544738.1|  PREDICTED: aquaporin PIP1-1-like                   279   6e-91    Tarenaya hassleriana [spider flower]
ref|XP_009600058.1|  PREDICTED: probable aquaporin PIP-type pTOM75      279   6e-91    Nicotiana tomentosiformis
dbj|BAA20075.1|  water channel protein                                  279   6e-91    Nicotiana excelsior
emb|CAA04652.1|  major intrinsic protein PIPa2                          279   7e-91    Craterostigma plantagineum
ref|XP_009383904.1|  PREDICTED: probable aquaporin PIP1-2               279   7e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011035995.1|  PREDICTED: probable aquaporin PIP1-2               279   8e-91    Populus euphratica
gb|KFK30621.1|  hypothetical protein AALP_AA6G005800                    279   8e-91    Arabis alpina [alpine rockcress]
gb|EYU32132.1|  hypothetical protein MIMGU_mgv1a011344mg                276   9e-91    Erythranthe guttata [common monkey flower]
gb|AFU61115.1|  water channel protein PIP                               279   9e-91    Capsicum annuum
gb|KJB41349.1|  hypothetical protein B456_007G100000                    279   1e-90    Gossypium raimondii
gb|KJB74255.1|  hypothetical protein B456_011G283200                    276   1e-90    Gossypium raimondii
ref|XP_004953388.1|  PREDICTED: aquaporin PIP1-2-like                   279   1e-90    Setaria italica
gb|KHG18900.1|  putative aquaporin PIP1-4 -like protein                 278   1e-90    Gossypium arboreum [tree cotton]
ref|XP_010556545.1|  PREDICTED: aquaporin PIP1-3-like                   278   1e-90    Tarenaya hassleriana [spider flower]
gb|KDO69068.1|  hypothetical protein CISIN_1g018895mg                   276   1e-90    Citrus sinensis [apfelsine]
gb|AFH36339.1|  aquaporin PIP1;1                                        278   1e-90    Quercus petraea [durmast oak]
ref|XP_002454508.1|  hypothetical protein SORBIDRAFT_04g032430          278   1e-90    Sorghum bicolor [broomcorn]
ref|XP_006652632.1|  PREDICTED: probable aquaporin PIP1-2-like          278   2e-90    Oryza brachyantha
ref|XP_006647653.1|  PREDICTED: aquaporin PIP1-1-like isoform X1        278   2e-90    
ref|XP_006435692.1|  hypothetical protein CICLE_v10032298mg             278   2e-90    Citrus clementina [clementine]
ref|XP_006647654.1|  PREDICTED: aquaporin PIP1-1-like isoform X2        278   2e-90    Oryza brachyantha
emb|CAA04653.1|  major intrinsic protein PIPB                           278   2e-90    Craterostigma plantagineum
gb|AIA83105.1|  putative aquaporin PIP1                                 278   2e-90    Citrus x paradisi x Citrus trifoliata [citrumelo]
gb|ABJ97677.1|  major intrinsic protein                                 278   2e-90    Solanum tuberosum [potatoes]
gb|ACC59097.1|  aquaporin                                               278   2e-90    Saccharum officinarum [noble cane]
gb|AIA83103.1|  putative aquaporin PIP1                                 278   2e-90    Citrus sinensis x Citrus trifoliata [Carrizo citrange]
emb|CAA04750.1|  aquaporin 1                                            278   2e-90    Nicotiana tabacum [American tobacco]
ref|XP_009780083.1|  PREDICTED: probable aquaporin PIP-type pTOM75      278   2e-90    Nicotiana sylvestris
ref|XP_009793682.1|  PREDICTED: probable aquaporin PIP-type pTOM75      278   2e-90    Nicotiana sylvestris
ref|XP_006360691.1|  PREDICTED: probable aquaporin PIP-type pTOM7...    278   2e-90    
gb|ABC01892.1|  major intrinsic protein 1-like protein                  278   2e-90    Solanum tuberosum [potatoes]
gb|AAO86706.1|  plasma membrane intrinsic protein                       278   2e-90    Zea mays [maize]
ref|XP_002531349.1|  Aquaporin PIP1.1, putative                         278   2e-90    Ricinus communis
ref|NP_001274291.1|  probable aquaporin PIP-type pTOM75-like            278   2e-90    Solanum lycopersicum
ref|XP_009630280.1|  PREDICTED: probable aquaporin PIP-type pTOM75      278   2e-90    Nicotiana tomentosiformis
ref|XP_011022675.1|  PREDICTED: aquaporin PIP1-2                        278   3e-90    Populus euphratica
emb|CAH60718.1|  putative plasma membrane intrinsic protein             278   3e-90    Populus tremula x Populus tremuloides
gb|ACU00100.1|  plasma membrane intrinsic protein PIP1.3                278   3e-90    Populus trichocarpa x Populus deltoides
emb|CDY15165.1|  BnaC05g00440D                                          279   3e-90    Brassica napus [oilseed rape]
gb|AAF71819.1|AF141899_1  putative aquaporin PIP1-3                     278   3e-90    Vitis cinerea var. helleri x Vitis rupestris
dbj|BAA20076.1|  water channel protein                                  278   3e-90    Nicotiana excelsior
gb|KJB74256.1|  hypothetical protein B456_011G283300                    278   3e-90    Gossypium raimondii
gb|AAL49748.1|AF452010_1  channel-like protein                          278   3e-90    Petunia x hybrida [garden petunia]
gb|KHG01288.1|  putative aquaporin PIP-type 7a                          278   3e-90    Gossypium arboreum [tree cotton]
gb|ACF84511.1|  unknown                                                 278   3e-90    Zea mays [maize]
gb|ACV66985.1|  plasma membrane aquaporin 1                             277   3e-90    Hevea brasiliensis [jebe]
gb|AFH36340.1|  aquaporin PIP1;2                                        277   4e-90    Quercus petraea [durmast oak]
ref|XP_002889360.1|  hypothetical protein ARALYDRAFT_470115             277   4e-90    
ref|XP_002315171.1|  hypothetical protein POPTR_0010s19930g             277   4e-90    Populus trichocarpa [western balsam poplar]
tpg|DAA33861.1|  TPA: aquaporin PIP1;7                                  277   4e-90    Gossypium hirsutum [American cotton]
gb|KHM99966.1|  Putative aquaporin PIP1-2                               277   4e-90    Glycine soja [wild soybean]
gb|ACB56912.1|  aquaporin                                               277   4e-90    Ananas comosus
ref|NP_001275388.1|  major intrinsic protein 1-like protein             277   4e-90    Solanum tuberosum [potatoes]
ref|XP_007026768.1|  Plasma membrane intrinsic protein 1,4              277   4e-90    Theobroma cacao [chocolate]
ref|NP_001242504.1|  uncharacterized protein LOC100793242               277   5e-90    
ref|NP_001290534.1|  uncharacterized protein LOC105042909               277   5e-90    Elaeis guineensis
gb|ABB16979.1|  major intrinsic protein 1-like protein                  277   5e-90    Solanum tuberosum [potatoes]
ref|XP_009779003.1|  PREDICTED: probable aquaporin PIP-type pTOM75      277   5e-90    Nicotiana sylvestris
gb|AFM37319.1|  aquaporin                                               277   5e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002446929.1|  hypothetical protein SORBIDRAFT_06g025150          277   5e-90    Sorghum bicolor [broomcorn]
ref|NP_001047672.1|  Os02g0666200                                       277   6e-90    
ref|NP_001104934.1|  aquaporin PIP1-2                                   277   6e-90    Zea mays [maize]
ref|XP_002526866.1|  Aquaporin PIP1.3, putative                         277   6e-90    Ricinus communis
ref|XP_011080941.1|  PREDICTED: probable aquaporin PIP-type pTOM75      277   6e-90    Sesamum indicum [beniseed]
gb|EYU32131.1|  hypothetical protein MIMGU_mgv1a011344mg                276   6e-90    Erythranthe guttata [common monkey flower]
emb|CAA70156.1|  transmembrane protein                                  277   6e-90    Oryza sativa [red rice]
ref|XP_010533655.1|  PREDICTED: aquaporin PIP1-3-like                   276   6e-90    Tarenaya hassleriana [spider flower]
ref|XP_010480063.1|  PREDICTED: aquaporin PIP1-3                        276   6e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006848145.1|  hypothetical protein AMTR_s00029p00227660          276   7e-90    Amborella trichopoda
ref|XP_009609568.1|  PREDICTED: probable aquaporin PIP-type pTOM75      276   8e-90    Nicotiana tomentosiformis
ref|XP_006573347.1|  PREDICTED: aquaporin PIP1-2-like                   275   8e-90    Glycine max [soybeans]
dbj|BAG68659.1|  plasma membrane intrinsic protein                      276   8e-90    Tulipa gesneriana
emb|CDY51161.1|  BnaA09g51960D                                          276   8e-90    Brassica napus [oilseed rape]
ref|XP_009134562.1|  PREDICTED: probable aquaporin PIP1-4               276   9e-90    Brassica rapa
ref|XP_002526867.1|  Aquaporin PIP1.3, putative                         276   9e-90    
gb|ACU87553.1|  PIP protein                                             276   9e-90    Gossypium hirsutum [American cotton]
gb|KDO69067.1|  hypothetical protein CISIN_1g018895mg                   276   9e-90    Citrus sinensis [apfelsine]
gb|AAL33585.1|AF440271_1  aquaporin                                     276   1e-89    Nicotiana tabacum [American tobacco]
gb|AAV80228.1|  aquaporin 1                                             276   1e-89    Aegiceras corniculatum
ref|XP_008778916.1|  PREDICTED: probable aquaporin PIP1-2 isoform X1    276   1e-89    Phoenix dactylifera
gb|ACV60508.1|  aquaporin                                               276   1e-89    Triticum aestivum [Canadian hard winter wheat]
gb|ACL52629.1|  unknown                                                 276   1e-89    Zea mays [maize]
gb|ACA50530.1|  putative aquaporin                                      276   1e-89    Brassica napus [oilseed rape]
gb|AFD32162.1|  plasma membrane intrinsic protein                       276   1e-89    Chrysopogon zizanioides [cuscus grass]
ref|XP_010508083.1|  PREDICTED: aquaporin PIP1-2-like isoform X1        276   1e-89    Camelina sativa [gold-of-pleasure]
gb|ABO71659.2|  trans-membrane water channel protein                    276   1e-89    Brassica juncea [brown mustard]
ref|XP_010506589.1|  PREDICTED: aquaporin PIP1-2                        276   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010241866.1|  PREDICTED: aquaporin PIP1-2                        276   1e-89    Nelumbo nucifera [Indian lotus]
gb|AAB61378.1|  aquaporin                                               276   1e-89    Brassica rapa subsp. oleifera [biennial turnip rape]
gb|AEN95117.1|  aquaporin PIP1                                          276   1e-89    Dimocarpus longan [longan]
gb|KJB74254.1|  hypothetical protein B456_011G283200                    276   1e-89    Gossypium raimondii
gb|ACR56610.1|  plasma intrinsic protein 1;1                            276   1e-89    Juglans regia
emb|CDY48920.1|  BnaA09g39170D                                          276   1e-89    Brassica napus [oilseed rape]
emb|CDX91911.1|  BnaC03g32130D                                          276   2e-89    
ref|NP_001078066.1|  aquaporin PIP1-2                                   275   2e-89    Arabidopsis thaliana [mouse-ear cress]
gb|AEO79975.1|  plasma intrinsic protein 1                              276   2e-89    Gladiolus communis
ref|XP_002303596.1|  plasma membrane aquaporin family protein           276   2e-89    Populus trichocarpa [western balsam poplar]
gb|AFM37320.1|  aquaporin                                               276   2e-89    Oryza sativa Japonica Group [Japonica rice]
gb|ABJ98540.1|  PIP1 protein                                            275   2e-89    Stipa breviflora
ref|XP_006396241.1|  hypothetical protein EUTSA_v10028860mg             275   2e-89    Eutrema salsugineum [saltwater cress]
emb|CDY07221.1|  BnaCnng02360D                                          275   2e-89    
gb|AAS55867.2|  aquaporin-like protein                                  275   2e-89    Ipomoea nil [qian niu]
gb|ABB87103.1|  water channel protein-like                              274   2e-89    Solanum tuberosum [potatoes]
emb|CDX95670.1|  BnaC03g25510D                                          275   3e-89    
ref|XP_006435690.1|  hypothetical protein CICLE_v10032308mg             275   3e-89    Citrus clementina [clementine]
gb|KDP44816.1|  hypothetical protein JCGZ_01316                         275   3e-89    Jatropha curcas
gb|AEH76327.1|  plasma membrane intrinsic protein 1                     275   3e-89    Jatropha curcas
gb|AFQ98315.1|  MIP2                                                    275   3e-89    Eutrema halophilum
ref|XP_006343971.1|  PREDICTED: probable aquaporin PIP-type pTOM7...    275   3e-89    Solanum tuberosum [potatoes]
gb|AGQ21874.1|  putative PIP-type aquaporin                             275   3e-89    Miscanthus sinensis
ref|XP_006294736.1|  hypothetical protein CARUB_v10023782mg             275   3e-89    Capsella rubella
ref|XP_010518253.1|  PREDICTED: aquaporin PIP1-2 isoform X2             275   3e-89    
gb|AGQ21873.1|  putative PIP-type aquaporin                             275   3e-89    Panicum virgatum
gb|KHG11128.1|  putative aquaporin PIP1-2                               275   3e-89    Gossypium arboreum [tree cotton]
ref|XP_010508084.1|  PREDICTED: aquaporin PIP1-2-like isoform X2        275   3e-89    
ref|XP_011092531.1|  PREDICTED: probable aquaporin PIP1-5 isoform X1    275   3e-89    Sesamum indicum [beniseed]
dbj|BAA92258.1|  plasma membrane aquaporin 1b                           275   4e-89    Raphanus sativus
ref|XP_006284249.1|  hypothetical protein CARUB_v10005414mg             275   4e-89    Capsella rubella
ref|XP_008778924.1|  PREDICTED: probable aquaporin PIP1-2 isoform X2    276   4e-89    
emb|CDX71738.1|  BnaC08g31360D                                          275   4e-89    
ref|XP_010262799.1|  PREDICTED: probable aquaporin PIP1-2               275   4e-89    Nelumbo nucifera [Indian lotus]
gb|AAG23179.1|AF299050_1  aquaporin PIP1b1                              275   4e-89    Brassica oleracea
ref|NP_974489.1|  plasma membrane intrinsic protein 1;4                 272   4e-89    Arabidopsis thaliana [mouse-ear cress]
dbj|BAA32777.1|  plasma membrane aquaporin (PAQ1)                       275   4e-89    Raphanus sativus
ref|XP_009118823.1|  PREDICTED: aquaporin PIP1-3                        275   4e-89    Brassica rapa
ref|NP_182120.1|  aquaporin PIP1-2                                      275   4e-89    Arabidopsis thaliana [mouse-ear cress]
gb|AAV41024.1|  plasma membrane intrinsic protein                       275   5e-89    Glycyrrhiza uralensis [Chinese licorice]
gb|KDO69063.1|  hypothetical protein CISIN_1g018895mg                   275   5e-89    Citrus sinensis [apfelsine]
ref|XP_010067506.1|  PREDICTED: probable aquaporin PIP1-2               274   6e-89    Eucalyptus grandis [rose gum]
gb|ACF39901.1|  aquaporin                                               274   6e-89    Camellia oleifera [abura-tsubaki]
ref|XP_010255327.1|  PREDICTED: aquaporin PIP1-2-like                   274   6e-89    Nelumbo nucifera [Indian lotus]
gb|AFB83065.1|  plasma intrinsic protein PIP1.1                         274   6e-89    Helianthemum almeriense
dbj|BAA23746.2|  HvPIP1;5                                               274   6e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004503705.1|  PREDICTED: probable aquaporin PIP1-2-like          274   6e-89    Cicer arietinum [garbanzo]
ref|XP_006413559.1|  hypothetical protein EUTSA_v10025910mg             274   7e-89    Eutrema salsugineum [saltwater cress]
dbj|BAD90696.1|  plasma membrane intrinsic protein 1;1                  274   7e-89    Mimosa pudica [sensitive-plant]
ref|XP_009783438.1|  PREDICTED: aquaporin PIP1-1-like                   270   7e-89    Nicotiana sylvestris
gb|AFH36341.1|  aquaporin PIP1;3                                        274   7e-89    Quercus petraea [durmast oak]
ref|XP_004954451.1|  PREDICTED: aquaporin PIP1-5-like                   274   7e-89    Setaria italica
ref|XP_009629839.1|  PREDICTED: probable aquaporin PIP1-5 isoform X1    274   7e-89    Nicotiana tomentosiformis
gb|ACR56612.1|  plasma intrinsic protein 1;3                            274   8e-89    Juglans regia
gb|ACZ51371.1|  plasma membrane intrinsic protein                       274   8e-89    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003532817.1|  PREDICTED: probable aquaporin PIP1-2               274   8e-89    
dbj|BAF41978.1|  aquaporin                                              274   9e-89    Hordeum vulgare [barley]
dbj|BAG68660.1|  plasma membrane intrinsic protein                      274   9e-89    Tulipa gesneriana
ref|NP_001105131.1|  aquaporin PIP1-5                                   274   9e-89    Zea mays [maize]
gb|ACU24274.1|  unknown                                                 274   1e-88    Glycine max [soybeans]
emb|CAA64895.1|  transmembrane channel protein                          273   1e-88    Brassica oleracea
ref|XP_002880210.1|  hypothetical protein ARALYDRAFT_483737             273   1e-88    
emb|CAA54233.1|  transmembrane protein                                  274   1e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011047429.1|  PREDICTED: probable aquaporin PIP1-4               273   1e-88    Populus euphratica
gb|KEH21073.1|  major intrinsic protein (MIP) family transporter        272   1e-88    Medicago truncatula
emb|CAC85292.1|  putative plasma membrane intrinsic protein             274   1e-88    Posidonia oceanica
emb|CAA64896.1|  transmembrane channel protein                          273   1e-88    Brassica oleracea
ref|XP_002511872.1|  Aquaporin PIP1.3, putative                         273   1e-88    Ricinus communis
gb|ABW34453.1|  aquaporin 1.1                                           273   1e-88    Triticum turgidum [cone wheat]
gb|ACR56611.1|  plasma intrinsic protein 1;2                            273   1e-88    Juglans regia
ref|XP_006429323.1|  hypothetical protein CICLE_v10012384mg             273   1e-88    Citrus clementina [clementine]
gb|ABG57184.1|  aquaporin                                               273   1e-88    Tamarix sp. ZDY-001908
gb|KFK37381.1|  hypothetical protein AALP_AA4G249600                    273   1e-88    Arabis alpina [alpine rockcress]
ref|XP_009138772.1|  PREDICTED: aquaporin PIP1-1                        273   1e-88    Brassica rapa
gb|AAG23180.1|AF299051_1  aquaporin PIP1b2                              273   1e-88    Brassica oleracea
gb|AAF02782.1|AF195115_2  Similar to transmembrane protein; coded...    273   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109640.1|  hypothetical protein L484_015595                   278   1e-88    
ref|XP_007051783.1|  Plasma membrane intrinsic protein 1B               273   1e-88    Theobroma cacao [chocolate]
ref|NP_567178.1|  plasma membrane intrinsic protein 1;4                 273   1e-88    Arabidopsis thaliana [mouse-ear cress]
gb|ABK96216.1|  unknown                                                 273   1e-88    Populus trichocarpa x Populus deltoides
ref|XP_009116806.1|  PREDICTED: aquaporin PIP1-1 isoform X1             273   2e-88    Brassica rapa
gb|KDO69062.1|  hypothetical protein CISIN_1g018895mg                   275   2e-88    Citrus sinensis [apfelsine]
gb|EYU23442.1|  hypothetical protein MIMGU_mgv1a011177mg                273   2e-88    Erythranthe guttata [common monkey flower]
ref|XP_002872953.1|  hypothetical protein ARALYDRAFT_912203             273   2e-88    Arabidopsis lyrata subsp. lyrata
gb|AFC92657.1|  aquaporin PIP1;3                                        273   2e-88    Eustoma exaltatum subsp. russellianum [bluebells]
gb|AFD61600.1|  aquaporin PIP1                                          273   2e-88    Hevea brasiliensis [jebe]
gb|AFM37318.1|  aquaporin                                               273   2e-88    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001276263.1|  probable aquaporin PIP1-4-like                     273   2e-88    
ref|XP_011092540.1|  PREDICTED: aquaporin PIP1-1-like isoform X2        274   2e-88    
gb|AGD98706.1|  aquaporin protein 3                                     273   2e-88    Camellia sinensis [black tea]
gb|ADN94473.1|  aquaporin                                               273   2e-88    Hevea brasiliensis [jebe]
gb|KCW72173.1|  hypothetical protein EUGRSUZ_E00628                     272   2e-88    Eucalyptus grandis [rose gum]
ref|XP_010055664.1|  PREDICTED: aquaporin PIP1-2-like                   273   2e-88    Eucalyptus grandis [rose gum]
gb|AGG39695.1|  aquaporin protein AQU17                                 273   2e-88    Camellia sinensis [black tea]
ref|NP_001078067.1|  aquaporin PIP1-2                                   273   2e-88    
ref|XP_009763188.1|  PREDICTED: aquaporin PIP1-2                        273   2e-88    
gb|KHN31579.1|  Putative aquaporin PIP1-4                               273   2e-88    
ref|XP_006418439.1|  hypothetical protein EUTSA_v10008397mg             273   2e-88    
gb|AEO13899.1|  aquaporin 8                                             273   2e-88    
ref|XP_010439184.1|  PREDICTED: probable aquaporin PIP1-5               273   3e-88    
gb|AEA40492.1|  aquaporin PIP1-4                                        272   3e-88    
ref|XP_008232887.1|  PREDICTED: aquaporin PIP1-2-like                   273   3e-88    
ref|XP_009142386.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    273   3e-88    
ref|XP_003616586.1|  Aquaporin PIP11                                    273   3e-88    
ref|XP_006648149.1|  PREDICTED: aquaporin PIP 1-3-like                  272   3e-88    
gb|KEH21072.1|  major intrinsic protein (MIP) family transporter        272   4e-88    
ref|XP_009116807.1|  PREDICTED: aquaporin PIP1-1 isoform X2             272   4e-88    
gb|ABH09324.1|  putative aquaporin                                      272   4e-88    
emb|CDX90046.1|  BnaA10g00360D                                          272   4e-88    
ref|XP_009629840.1|  PREDICTED: aquaporin PIP1-2-like isoform X2        273   4e-88    
gb|ACU00101.1|  plasma membrane intrinsic protein PIP1.5                272   5e-88    
ref|XP_007133932.1|  hypothetical protein PHAVU_010G004500g             272   5e-88    
ref|NP_001267921.1|  aquaporin-like                                     272   5e-88    
gb|KCW50514.1|  hypothetical protein EUGRSUZ_J00237                     274   5e-88    
ref|XP_009789917.1|  PREDICTED: aquaporin PIP1-1-like                   268   5e-88    
gb|AEA40489.1|  aquaporin PIP1-1                                        271   6e-88    
gb|AEA40491.1|  aquaporin PIP1-3                                        271   7e-88    
gb|KCW50515.1|  hypothetical protein EUGRSUZ_J00237                     273   8e-88    
dbj|BAA24016.1|  water channel protein                                  271   8e-88    
tpg|DAA33860.1|  TPA: aquaporin PIP1;6                                  271   8e-88    
gb|KHN15211.1|  Aquaporin PIP1-2                                        274   8e-88    
ref|XP_003600864.1|  Aquaporin protein PIP11                            269   8e-88    
gb|EYU38340.1|  hypothetical protein MIMGU_mgv1a018376mg                271   9e-88    
ref|XP_006288376.1|  hypothetical protein CARUB_v10001627mg             271   1e-87    
gb|AAC17528.1|  aquaporin 1                                             271   1e-87    
tpg|DAA33862.1|  TPA: aquaporin PIP1;8                                  270   1e-87    
ref|XP_009119712.1|  PREDICTED: aquaporin PIP1-3                        271   1e-87    
ref|XP_007218332.1|  hypothetical protein PRUPE_ppa008510mg             272   1e-87    
ref|XP_010031252.1|  PREDICTED: probable aquaporin PIP1-4               271   1e-87    
sp|P25794.2|PIP2_PEA  RecName: Full=Probable aquaporin PIP-type 7...    271   1e-87    
ref|XP_010456290.1|  PREDICTED: probable aquaporin PIP1-4               271   1e-87    
ref|XP_004173962.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    267   2e-87    
gb|KJB46619.1|  hypothetical protein B456_007G378400                    271   2e-87    
gb|AFK41734.1|  unknown                                                 270   2e-87    
ref|NP_001241050.1|  uncharacterized protein LOC100791447               270   2e-87    
ref|XP_010448716.1|  PREDICTED: probable aquaporin PIP1-5               270   2e-87    
gb|ABJ98535.1|  PIP1 protein                                            270   3e-87    
ref|XP_003517470.1|  PREDICTED: aquaporin PIP1-3-like                   270   3e-87    
gb|AFK45475.1|  unknown                                                 270   3e-87    
gb|AAF80557.1|AF188844_1  plasma membrane aquaporin                     270   3e-87    
ref|XP_006827580.1|  hypothetical protein AMTR_s00009p00231200          270   3e-87    
dbj|BAB40142.1|  plasma membrane intrinsic protein 1-1                  270   3e-87    
gb|KJB78792.1|  hypothetical protein B456_013G019300                    270   3e-87    
ref|NP_001048566.1|  Os02g0823100                                       270   4e-87    
gb|AAA93521.1|  aquaporin                                               270   4e-87    
gb|KEH28860.1|  major intrinsic protein (MIP) family transporter        267   4e-87    
gb|KJB20656.1|  hypothetical protein B456_003G158100                    268   5e-87    
ref|XP_010543744.1|  PREDICTED: probable aquaporin PIP1-4               269   5e-87    
ref|XP_010433914.1|  PREDICTED: probable aquaporin PIP1-5               269   5e-87    
ref|NP_001289902.1|  probable aquaporin PIP1-4                          269   5e-87    
ref|XP_009411509.1|  PREDICTED: aquaporin PIP1-1-like                   269   5e-87    
gb|KEH27431.1|  major intrinsic protein (MIP) family transporter        267   5e-87    
emb|CAN74419.1|  hypothetical protein VITISV_016461                     269   5e-87    
gb|ABJ98538.1|  PIP1 protein                                            269   5e-87    
gb|EAY88074.1|  hypothetical protein OsI_09504                          269   5e-87    
gb|KJB36888.1|  hypothetical protein B456_006G181300                    269   6e-87    
ref|XP_003600863.1|  Aquaporin protein PIP11                            269   6e-87    
gb|KHN35027.1|  Putative aquaporin PIP1-2                               269   7e-87    
gb|ACJ84222.1|  unknown                                                 269   7e-87    
gb|KFK28910.1|  hypothetical protein AALP_AA7G063900                    269   7e-87    
gb|AAB67870.1|  plasma membrane major intrinsic protein 3               269   7e-87    
emb|CAA38241.1|  unnamed protein product                                269   7e-87    
gb|KEH34782.1|  major intrinsic protein (MIP) family transporter        268   8e-87    
ref|XP_008233728.1|  PREDICTED: probable aquaporin PIP1-4               269   8e-87    
ref|XP_007218768.1|  hypothetical protein PRUPE_ppa009506mg             269   9e-87    
gb|AFK38136.1|  unknown                                                 269   1e-86    
gb|AEA40490.1|  aquaporin PIP1-2                                        268   1e-86    
gb|EMS49467.1|  Aquaporin PIP1-2                                        275   1e-86    
ref|XP_009802787.1|  PREDICTED: aquaporin PIP1-1-like                   265   1e-86    
ref|XP_009367824.1|  PREDICTED: aquaporin PIP1-1-like isoform X1        268   1e-86    
ref|NP_001290008.1|  probable aquaporin PIP1-4                          268   1e-86    
gb|ACU17565.1|  unknown                                                 266   1e-86    
gb|ADD59911.1|  aquaporin                                               270   1e-86    
gb|ABJ98541.1|  PIP1 protein                                            268   2e-86    
gb|ADT91650.1|  putative major intrinsic protein                        268   2e-86    
ref|XP_004490962.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    268   2e-86    
dbj|BAI94500.1|  plasma membrane intrinsic protein                      268   2e-86    
ref|XP_007209434.1|  hypothetical protein PRUPE_ppa009588mg             268   2e-86    
gb|AAM61041.1|  aquaporin (plasma membrane intrinsic protein 1B)        268   2e-86    
ref|XP_009350886.1|  PREDICTED: probable aquaporin PIP1-4               268   2e-86    
ref|XP_003570439.1|  PREDICTED: aquaporin PIP1-5                        268   2e-86    
gb|KCW65649.1|  hypothetical protein EUGRSUZ_G03037                     268   2e-86    
dbj|BAO18622.1|  plasmamembrane intrinsic protein 1;2                   268   2e-86    
ref|XP_010670234.1|  PREDICTED: probable aquaporin PIP1-5               268   2e-86    
ref|XP_009367826.1|  PREDICTED: aquaporin PIP1-2-like isoform X3        268   2e-86    
ref|XP_003552231.1|  PREDICTED: probable aquaporin PIP1-2               268   2e-86    
emb|CDY38017.1|  BnaCnng08780D                                          268   2e-86    
ref|XP_008463222.1|  PREDICTED: probable aquaporin PIP1-4               268   2e-86    
ref|NP_001267686.1|  uncharacterized protein LOC101215145               268   3e-86    
dbj|BAA22097.1|  transmembrane protein                                  267   3e-86    
gb|AAT76618.1|  aquaporin                                               268   3e-86    
gb|AFB83066.1|  plasma intrinsic protein PIP1.2                         267   3e-86    
ref|NP_001234413.1|  Aqp2 protein                                       267   3e-86    
ref|NP_001274378.1|  probable aquaporin PIP1-4-like                     268   3e-86    
ref|XP_003611079.1|  Aquaporin                                          267   3e-86    
ref|XP_007163523.1|  hypothetical protein PHAVU_001G241200g             267   3e-86    
gb|AAB86380.1|  aquaporin-like transmembrane channel protein            267   3e-86    
gb|EMT22814.1|  Putative aquaporin PIP1-2                               266   4e-86    
ref|XP_009340095.1|  PREDICTED: aquaporin PIP1-3 isoform X1             267   4e-86    
ref|NP_001280922.1|  probable aquaporin PIP1-4                          267   4e-86    
ref|XP_010323861.1|  PREDICTED: aqp2 protein isoform X1                 267   4e-86    
gb|AAR23268.1|  PIP1;2                                                  267   4e-86    
ref|XP_004490961.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    268   4e-86    
dbj|BAJ99301.1|  predicted protein                                      265   4e-86    
ref|NP_001280914.1|  probable aquaporin PIP1-4                          267   4e-86    
emb|CDX10335.1|  aquaporin                                              266   5e-86    
gb|AGV54650.1|  plasma membrane intrinsic protein 1;3                   267   5e-86    
gb|AAB09747.1|  mipA                                                    267   5e-86    
ref|XP_004149243.1|  PREDICTED: probable aquaporin PIP1-4-like is...    267   5e-86    
gb|AHA84147.1|  plasma membrane intrinsic protein 1                     267   5e-86    
ref|XP_009143195.1|  PREDICTED: aquaporin PIP1-2 isoform X1             266   6e-86    
emb|CDX10336.1|  aquaporin                                              266   6e-86    
ref|XP_009367825.1|  PREDICTED: aquaporin PIP1-3-like isoform X2        266   6e-86    
ref|XP_008360708.1|  PREDICTED: aquaporin PIP1-3 isoform X1             266   8e-86    
ref|XP_009340096.1|  PREDICTED: aquaporin PIP1-2 isoform X2             266   8e-86    
gb|AHG32322.1|  PIP1-2                                                  266   8e-86    
ref|NP_001280950.1|  aquaporin PIP1-1                                   266   8e-86    
gb|ABI96812.1|  plasma membrane intrinsic protein                       266   9e-86    
gb|ACJ84965.1|  unknown                                                 266   9e-86    
gb|AFK41358.1|  unknown                                                 266   9e-86    
gb|EMS53768.1|  Aquaporin PIP1-5                                        266   9e-86    
gb|KEH28859.1|  major intrinsic protein (MIP) family transporter        266   9e-86    
gb|AIL92621.1|  plasma membrane intrinsic protein 1                     266   1e-85    
gb|AFO63680.1|  plasma intrinsic protein 1                              266   1e-85    
ref|XP_008341694.1|  PREDICTED: aquaporin PIP1-2 isoform X2             266   1e-85    
gb|AEY75243.1|  plasma membrane intrinsic protein                       266   1e-85    
ref|XP_009344552.1|  PREDICTED: probable aquaporin PIP1-4               266   1e-85    
ref|NP_001241148.1|  uncharacterized protein LOC100812711               265   2e-85    
ref|XP_009143196.1|  PREDICTED: aquaporin PIP1-2 isoform X2             266   2e-85    
ref|XP_008238916.1|  PREDICTED: aquaporin PIP1-2 isoform X1             265   2e-85    
ref|XP_007140374.1|  hypothetical protein PHAVU_008G1064001g            263   2e-85    
ref|NP_001105466.1|  aquaporin PIP1-1                                   265   2e-85    
gb|AFW63312.1|  plasma membrane intrinsic protein1                      264   2e-85    
dbj|BAF33067.1|  aquaporin                                              265   2e-85    
gb|ABE03629.1|  plasma membrane major intrinsic protein                 265   3e-85    
ref|XP_006339582.1|  PREDICTED: probable aquaporin PIP1-5-like is...    265   3e-85    
gb|ACR54285.1|  aquaporin                                               265   4e-85    
ref|XP_004307619.1|  PREDICTED: probable aquaporin PIP-type 7a          265   4e-85    
ref|XP_002453072.1|  hypothetical protein SORBIDRAFT_04g037800          265   4e-85    
gb|AAY44089.1|  plasma membrane intrinsic protein                       261   4e-85    
ref|XP_004503235.1|  PREDICTED: probable aquaporin PIP-type 7a-like     265   4e-85    
gb|EPS61960.1|  hypothetical protein M569_12834                         264   4e-85    
emb|CAB56217.1|  PM28B protein                                          264   5e-85    
gb|KDP28617.1|  hypothetical protein JCGZ_14388                         264   6e-85    
ref|XP_008360709.1|  PREDICTED: aquaporin PIP1-3 isoform X2             265   6e-85    
ref|XP_004511567.1|  PREDICTED: probable aquaporin PIP1-2-like          264   7e-85    
ref|XP_004306776.1|  PREDICTED: aquaporin PIP1-3                        264   8e-85    
ref|XP_004298806.1|  PREDICTED: aquaporin PIP1-3                        263   9e-85    
gb|AGV54711.1|  aquaporin PIP-type 7a-like protein                      263   9e-85    
gb|EMS50328.1|  Aquaporin PIP1-5                                        263   1e-84    
gb|AHA84165.1|  aquaporin                                               263   1e-84    
ref|XP_007141791.1|  hypothetical protein PHAVU_008G226000g             263   1e-84    
ref|XP_002275303.1|  PREDICTED: aquaporin PIP1-2                        263   1e-84    
gb|AAF61465.1|AF139816_1  plasma membrane intrinsic protein 3           262   1e-84    
ref|XP_006339584.1|  PREDICTED: probable aquaporin PIP1-5-like is...    264   1e-84    
gb|AGV54605.1|  aquaporin-1                                             263   1e-84    
ref|NP_001105022.1|  aquaporin PIP1-3/PIP1-4                            263   1e-84    
dbj|BAF33068.1|  aquaporin                                              263   1e-84    
ref|XP_002309126.1|  plasma membrane intrinsic protein 1-1              263   2e-84    
gb|ACC85598.1|  aquaporin                                               263   2e-84    
dbj|BAA23745.2|  HvPIP1;3                                               263   2e-84    
gb|ACU81080.1|  aquaporin                                               262   3e-84    
emb|CAB46350.1|  major intrinsic protein 1                              262   3e-84    
gb|AAM00368.1|AF366564_1  aquaporin PIP1                                262   4e-84    
gb|AHB33474.1|  plasma intrinsic protein 1-1                            262   5e-84    
ref|XP_008238917.1|  PREDICTED: aquaporin PIP1-2 isoform X2             263   6e-84    
gb|AHX84137.1|  aquaporin                                               261   9e-84    
gb|KJB74258.1|  hypothetical protein B456_011G283400                    258   9e-84    
gb|ACB10396.1|  aquaporin                                               260   1e-83    
ref|NP_001105023.1|  aquaporin PIP1-6                                   261   1e-83    
ref|XP_011019143.1|  PREDICTED: probable aquaporin PIP1-4               261   1e-83    
ref|XP_003519383.1|  PREDICTED: probable aquaporin PIP-type 7a-like     261   1e-83    
gb|KHN13075.1|  Putative aquaporin PIP-type 7a                          261   1e-83    
dbj|BAF62342.1|  aquaporin                                              261   1e-83    
ref|XP_003544110.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    260   1e-83    
ref|XP_006595872.1|  PREDICTED: probable aquaporin PIP-type 7a-li...    261   2e-83    
gb|AAF65846.1|AF255796_1  aquaporin 2                                   259   3e-83    
gb|ABH85411.1|  plasma membrane intrinsic protein 1;3                   259   3e-83    
emb|CAG27864.2|  aquaporin PIP1                                         259   3e-83    
gb|AAY17047.1|  p-166-5                                                 256   5e-83    
gb|AFW85290.1|  plasma membrane intrinsic protein1                      259   5e-83    
gb|EPS60284.1|  plasma membrane intrinsic protein                       259   7e-83    
gb|ABK22355.1|  unknown                                                 258   1e-82    
gb|AAB72149.1|  putative aquaporin-1                                    258   1e-82    
gb|AHA90706.1|  aquaporin                                               258   1e-82    
gb|KJB74257.1|  hypothetical protein B456_011G283400                    257   3e-82    
gb|AGR83935.1|  aquaporin PIP1-1                                        256   3e-82    
ref|XP_010256616.1|  PREDICTED: aquaporin PIP1-1-like                   256   5e-82    
gb|ADJ57598.1|  plasma membrane intrinsic protein PIP1;1                256   7e-82    
gb|ADE34280.1|  aquaporin PIP1;11                                       256   8e-82    
gb|KJB67590.1|  hypothetical protein B456_010G198800                    256   8e-82    
ref|XP_008804034.1|  PREDICTED: probable aquaporin PIP1-2               255   2e-81    
gb|ABK60194.1|  PIP1 protein                                            255   2e-81    
gb|AAB09757.1|  similar to mipB gene product in Mesembryanthemum ...    254   2e-81    
gb|AGR83936.1|  aquaporin PIP1-2                                        253   5e-81    
gb|AAB82140.1|  transmembrane protein                                   254   6e-81    
gb|AGR83938.1|  aquaporin PIP1-4                                        253   7e-81    
ref|XP_009780331.1|  PREDICTED: aquaporin PIP1-1-like                   248   7e-81    
ref|XP_002438067.1|  hypothetical protein SORBIDRAFT_10g007610          254   8e-81    
emb|CAB06080.1|  porin                                                  253   1e-80    
ref|XP_006304071.1|  hypothetical protein CARUB_v10009929mg             253   1e-80    
ref|NP_171668.1|  aquaporin PIP1-3                                      253   1e-80    
gb|AAL32688.1|  plasma membrane intrinsic protein 1C (transmembra...    253   1e-80    
gb|ACN40976.1|  unknown                                                 253   2e-80    
gb|ABK24473.1|  unknown                                                 253   2e-80    
dbj|BAA81820.1|  water channel protein RWC3                             252   3e-80    
dbj|BAA32081.1|  RWC-3                                                  252   4e-80    
emb|CAA53476.1|  plasma membrane intrinsic protein 1c                   251   5e-80    
gb|ACG39699.1|  aquaporin PIP1.1                                        251   6e-80    
ref|XP_010512489.1|  PREDICTED: aquaporin PIP1-1                        251   8e-80    
gb|AAX92682.1|  probable aquaporin                                      251   8e-80    
ref|XP_006291433.1|  hypothetical protein CARUB_v10017571mg             253   8e-80    
gb|ACA50529.1|  putative aquaporin                                      251   1e-79    
emb|CAB37860.1|  PIP1b protein                                          251   1e-79    
ref|XP_002876612.1|  hypothetical protein ARALYDRAFT_486618             250   2e-79    



>gb|AAL49749.1|AF452011_1 aquaporin-like protein [Petunia x hybrida]
Length=286

 Score =   304 bits (779),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 154/163 (94%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            MEHREEDVNLGANK+SERQAIGTAAQ QDKDY EPP APLFE GELMSWSFYRAGIAEFM
Sbjct  1    MEHREEDVNLGANKYSERQAIGTAAQSQDKDYIEPPPAPLFESGELMSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYITVLTVMGV KS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITVLTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFG+   Q +G
Sbjct  121  GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKG  163



>ref|XP_009762763.1| PREDICTED: probable aquaporin PIP1-2 [Nicotiana sylvestris]
Length=285

 Score =   301 bits (770),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME++EEDV LGANK+SERQAIGTAAQ DKDY+EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MENKEEDVRLGANKYSERQAIGTAAQSDKDYTEPPPAPLFEAGELTSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV KSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFG+   Q +G
Sbjct  121  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTLYQTKG  162



>dbj|BAA20074.1| water channel protein [Nicotiana excelsior]
Length=285

 Score =   301 bits (770),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME++EEDV LGANK+SERQAIGTAAQ DKDY+EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MENKEEDVRLGANKYSERQAIGTAAQSDKDYTEPPPAPLFEAGELTSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV KSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFG+   Q +G
Sbjct  121  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTLYQTKG  162



>ref|XP_009631880.1| PREDICTED: probable aquaporin PIP1-2 [Nicotiana tomentosiformis]
 tpg|DAA64671.1| TPA_exp: aquaporin PIP1 4 [Nicotiana tabacum]
Length=285

 Score =   300 bits (768),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME++EEDV LGANK+SERQAIGTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MENKEEDVRLGANKYSERQAIGTAAQSDKDYKEPPPAPLFEAGELTSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV KSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFG+   Q +G
Sbjct  121  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTLYQTKG  162



>ref|XP_006362987.1| PREDICTED: probable aquaporin PIP1-2-like [Solanum tuberosum]
Length=286

 Score =   298 bits (762),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            MEHREEDV LGANK+SERQAIG AAQ QDKDY EPP APLFE GELMSWSFYRAGIAEF+
Sbjct  1    MEHREEDVRLGANKYSERQAIGIAAQSQDKDYKEPPPAPLFEPGELMSWSFYRAGIAEFV  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYITVLTVMGV KS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITVLTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRAVFYMVMQCLGAICGAGVVK FG+   Q +G
Sbjct  121  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKAFGKTLYQTKG  163



>ref|XP_009759265.1| PREDICTED: probable aquaporin PIP1-2 [Nicotiana sylvestris]
Length=286

 Score =   297 bits (761),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            MEHREEDV +GANK+SERQAIGTAA  QDKDY EPP APLFE GELMSWSFYRAGIAEFM
Sbjct  1    MEHREEDVRVGANKYSERQAIGTAAHSQDKDYKEPPPAPLFEPGELMSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYITVLTVMGV KSESKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITVLTVMGVSKSESKCPTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLS+TRA+FYMVMQCLGAICGAGVVKGFG+   Q +G
Sbjct  121  GLFLARKLSVTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKG  163



>ref|XP_011084932.1| PREDICTED: probable aquaporin PIP1-2 [Sesamum indicum]
Length=286

 Score =   293 bits (749),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 150/163 (92%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV LGANKFSERQ IGTAAQ QDKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MESKEEDVRLGANKFSERQPIGTAAQSQDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGV KS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFG+   Q +G
Sbjct  121  GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKG  163



>ref|NP_001289851.1| probable aquaporin PIP1-2 [Solanum lycopersicum]
 dbj|BAO18625.1| plasmamembrane intrinsic protein 1;7 [Solanum lycopersicum]
Length=286

 Score =   293 bits (749),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 150/163 (92%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            MEHREEDV LGANK+SERQAIG AAQ +DKDY EPP APLFE GELMSWSFYRAGIAEF+
Sbjct  1    MEHREEDVRLGANKYSERQAIGIAAQSEDKDYKEPPPAPLFEPGELMSWSFYRAGIAEFV  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYITVLTVMGV KS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITVLTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRAVFYMVMQCLGAICGA +VK FG+   Q +G
Sbjct  121  GLFLARKLSLTRAVFYMVMQCLGAICGAALVKAFGKTLYQTKG  163



>ref|XP_009386206.1| PREDICTED: probable aquaporin PIP1-2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=286

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQSDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGVVKS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRA+FYMVMQCLGAICGAGVVKG+ +   +  G
Sbjct  121  LFLARKLSLTRALFYMVMQCLGAICGAGVVKGYQKGLYESNG  162



>gb|EYU41267.1| hypothetical protein MIMGU_mgv1a011292mg [Erythranthe guttata]
Length=258

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANK+SERQ IGTAAQ QDKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MESKEEDVRVGANKYSERQPIGTAAQSQDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGV KS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGFGE     +G
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFGETLYMTKG  163



>gb|KDO76246.1| hypothetical protein CISIN_1g023107mg [Citrus sinensis]
 gb|KDO76247.1| hypothetical protein CISIN_1g023107mg [Citrus sinensis]
Length=228

 Score =   288 bits (737),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV KS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            L LARKLSLTRAVFYMVMQCLGA+CGAGVVKGF G    +R G
Sbjct  121  LLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLG  163



>gb|EYU19988.1| hypothetical protein MIMGU_mgv1a011277mg [Erythranthe guttata]
Length=287

 Score =   290 bits (741),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GAN+F ERQ IGTAAQ QDKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MESKEEDVRVGANRFDERQPIGTAAQTQDKDYKEPPPAPLFEPGELASWSFYRAGIAEFV  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYITVLTVMGV KSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITVLTVMGVSKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRAV+YMVMQCLGAICGAGVVKGFG+   Q  G
Sbjct  121  GLFLARKLSLTRAVYYMVMQCLGAICGAGVVKGFGKALYQSNG  163



>gb|KDO76245.1| hypothetical protein CISIN_1g023107mg [Citrus sinensis]
Length=257

 Score =   288 bits (738),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV KS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            L LARKLSLTRAVFYMVMQCLGA+CGAGVVKGF G    +R G
Sbjct  121  LLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLG  163



>gb|EYU41266.1| hypothetical protein MIMGU_mgv1a011292mg [Erythranthe guttata]
Length=286

 Score =   289 bits (740),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANK+SERQ IGTAAQ QDKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MESKEEDVRVGANKYSERQPIGTAAQSQDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFV  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGV KS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGFGE     +G
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFGETLYMTKG  163



>ref|XP_008787474.1| PREDICTED: probable aquaporin PIP1-2 [Phoenix dactylifera]
Length=287

 Score =   289 bits (739),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV LGANKFSERQ IGTAAQ QDKDY EPP APLFE GEL SWSFYRAGIAEFM
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQSQDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGVVKS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GL LARKLSLTRAVFYMVMQCLGAICGAGVVKGF
Sbjct  121  GLLLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  154



>ref|XP_009386207.1| PREDICTED: probable aquaporin PIP1-2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=335

 Score =   290 bits (743),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQSDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGVVKS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRA+FYMVMQCLGAICGAGVVKG+ +   +  G
Sbjct  121  LFLARKLSLTRALFYMVMQCLGAICGAGVVKGYQKGLYESNG  162



>ref|XP_006439529.1| hypothetical protein CICLE_v10021502mg [Citrus clementina]
 gb|ESR52769.1| hypothetical protein CICLE_v10021502mg [Citrus clementina]
Length=287

 Score =   289 bits (739),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV KS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            L LARKLSLTRAVFYMVMQCLGAICGAGVVKGF G    +R G
Sbjct  121  LLLARKLSLTRAVFYMVMQCLGAICGAGVVKGFEGSKNYERLG  163



>ref|XP_009400253.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=285

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTAAQ-DKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  59

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGVVKS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  60   TFLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  119

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYMVMQCLGA+CGAGVVKGF +   +  G
Sbjct  120  LFLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFQKGVYESNG  161



>gb|AFJ44204.1| plasma membrane intrinsic protein 1 [Hedychium coronarium]
Length=286

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF ERQ IGTAAQ DKDY+EPPAAPLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVRLGANKFPERQPIGTAAQGDKDYTEPPAAPLFEPGELSSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYI++LTVMGVVK++SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYISILTVMGVVKADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF +   + +G
Sbjct  121  LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFKKGLYESKG  162



>ref|XP_006476548.1| PREDICTED: probable aquaporin PIP1-2-like isoform X1 [Citrus 
sinensis]
 gb|KDO76244.1| hypothetical protein CISIN_1g023107mg [Citrus sinensis]
Length=287

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV KS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            L LARKLSLTRAVFYMVMQCLGA+CGAGVVKGF G    +R G
Sbjct  121  LLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLG  163



>gb|AGT36590.1| aquaporin [Musa acuminata AAA Group]
Length=286

 Score =   288 bits (736),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGTAAQ DK Y EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQSDKGYKEPPPAPLFEPGELTSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGVVKS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVVKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRA+FYMVMQCLGAICGAGVVKG+ +   +  G
Sbjct  121  LFLARKLSLTRALFYMVMQCLGAICGAGVVKGYQKGLYESNG  162



>ref|XP_009380931.1| PREDICTED: aquaporin PIP1-1 [Musa acuminata subsp. malaccensis]
Length=285

 Score =   287 bits (734),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKFSERQ IGTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKIGANKFSERQPIGTAAQ-DKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  59

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGVVKS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  60   TFLFLYITILTVMGVVKSSSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  119

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF +   Q  G
Sbjct  120  LFLARKLSLTRAIFYMVMQCLGAICGAGVVKGFQKGVYQSNG  161



>ref|XP_011076722.1| PREDICTED: probable aquaporin PIP1-5 [Sesamum indicum]
Length=286

 Score =   287 bits (734),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDVNLGANKFSERQ IGTAAQ QDKDY+EPP  PLF   EL SWSFYRAGIAEF+
Sbjct  1    MESKEEDVNLGANKFSERQPIGTAAQSQDKDYTEPPPEPLFVPSELTSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLY+++LTVMGV KS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYVSILTVMGVNKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFG+   Q +G
Sbjct  121  GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKG  163



>gb|KJB25853.1| hypothetical protein B456_004G212800 [Gossypium raimondii]
Length=217

 Score =   283 bits (725),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPPAAP FE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            LFLARKLSLTRA+FYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LFLARKLSLTRALFYMIMQCLGAICGAGVVKGFQGD  156



>gb|AGG39697.1| aquaporin protein AQU19 [Camellia sinensis]
Length=286

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ +GTAAQ DKDY EPP APLFE GEL+SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPLGTAAQTDKDYKEPPPAPLFEPGELVSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGVV++ +KC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITLLTVMGVVRAPNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  153



>gb|AHI54572.1| aquaporin protein AQU19 [Camellia japonica]
Length=286

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ +GTAAQ DKDY EPP APLFE GEL+SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPLGTAAQTDKDYKEPPPAPLFEPGELVSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGVV++ +KC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITLLTVMGVVRAPNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  153



>gb|KJB20657.1| hypothetical protein B456_003G158100 [Gossypium raimondii]
Length=222

 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEGD  156



>gb|ABB13429.1| plasma membrane intrinsic protein [Olea europaea]
Length=285

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANKF+ERQ IGTAAQ QDKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MESKEEDVRVGANKFAERQPIGTAAQSQDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYITVLTVMGV KS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITVLTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFL RKLSLTRAVFYMVMQCLGAICGAGVVKGFG+     +G
Sbjct  121  GLFLGRKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTLYMTKG  163



>ref|XP_008437293.1| PREDICTED: aquaporin PIP1-2 [Cucumis melo]
Length=286

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APL+E GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLYEPGELTSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV +S SKC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVSRSPSKCNTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            LFLARKLSLTRA+FY++MQCLGAICGAGVVKGF G   VQ+ G
Sbjct  121  LFLARKLSLTRALFYIIMQCLGAICGAGVVKGFEGSTYVQKLG  163



>ref|XP_009420459.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV LGANKF+ERQ IGTAAQ QDKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MEGKEEDVRLGANKFTERQPIGTAAQSQDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFV  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGVVKS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVVKSSTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF +   +  G
Sbjct  121  GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQKGLYENNG  163



>ref|XP_009382780.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   285 bits (730),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV LGAN+FSERQ IGTAAQ QDKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MEGKEEDVRLGANRFSERQPIGTAAQSQDKDYKEPPLAPLFEPGELSSWSFYRAGIAEFV  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGVVKS++KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVVKSDTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  154



>ref|XP_010940492.1| PREDICTED: probable aquaporin PIP1-2 [Elaeis guineensis]
Length=287

 Score =   285 bits (730),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAA-QQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV LGANKFSERQ IGTAA  QDKDY EPP APLFE GEL SWSFYRAGIAEFM
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAPSQDKDYKEPPPAPLFEPGELRSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGVVKS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVVKSKSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GL LARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  GLLLARKLSLTRALFYMVMQCLGAICGAGVVKGF  154



>gb|AAT74898.1| plasma membrane intrinsic protein PIP1-1 [Fraxinus excelsior]
Length=286

 Score =   285 bits (729),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANKF+ERQ IGTAAQ QDKDY EPP APLF+ GEL SWSFYRAGIAEF+
Sbjct  1    MESKEEDVRVGANKFNERQPIGTAAQSQDKDYKEPPPAPLFDPGELSSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYI +LTVMGV KS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYIAILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFG+     +G
Sbjct  121  GLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGFGKTLYMTKG  163



>gb|KHG19073.1| Aquaporin PIP1-3 -like protein [Gossypium arboreum]
Length=287

 Score =   285 bits (729),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPPAAP FE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQGD  156



>ref|XP_004143901.1| PREDICTED: probable aquaporin PIP1-2-like [Cucumis sativus]
 ref|XP_004159943.1| PREDICTED: probable aquaporin PIP1-2-like [Cucumis sativus]
 gb|KGN50087.1| Aquaporin 1 [Cucumis sativus]
Length=286

 Score =   285 bits (729),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APL+E GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLYEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV +S SKC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVNRSPSKCNSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            LFLARKLSLTRAVFY++MQCLGAICGAGVVKGF G   VQ+ G
Sbjct  121  LFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFEGSSYVQKLG  163



>gb|KJB25855.1| hypothetical protein B456_004G212800 [Gossypium raimondii]
Length=236

 Score =   283 bits (724),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPPAAP FE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            LFLARKLSLTRA+FYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LFLARKLSLTRALFYMIMQCLGAICGAGVVKGFQGD  156



>ref|XP_011076723.1| PREDICTED: probable aquaporin PIP1-5 [Sesamum indicum]
Length=286

 Score =   285 bits (729),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDVN+GANKFSERQ IGTAAQ QDKDY EPP  PLF   EL SWSFYRAGIAEF+
Sbjct  1    MESKEEDVNVGANKFSERQPIGTAAQSQDKDYREPPPEPLFVPSELTSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLY+++LTVMGV KS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYVSILTVMGVSKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFG+   Q +G
Sbjct  121  GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKG  163



>ref|XP_006476549.1| PREDICTED: probable aquaporin PIP1-2-like isoform X2 [Citrus 
sinensis]
Length=316

 Score =   286 bits (731),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV KS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            L LARKLSLTRAVFYMVMQCLGA+CGAGVVKGF G    +R G
Sbjct  121  LLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLG  163



>ref|XP_011076721.1| PREDICTED: probable aquaporin PIP1-5 [Sesamum indicum]
Length=286

 Score =   285 bits (728),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDVN+GANKFSERQ IGTAAQ QDKDY EPP  PLF   EL SWSFYRAGIAEF+
Sbjct  1    MESKEEDVNVGANKFSERQPIGTAAQSQDKDYREPPPEPLFVPSELTSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLY+++LTVMGV KS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYVSILTVMGVNKSDSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFG+   Q +G
Sbjct  121  GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKG  163



>tpg|DAA33863.1| TPA_inf: aquaporin PIP1;9 [Gossypium hirsutum]
Length=257

 Score =   283 bits (724),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 145/156 (93%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD--KDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME REEDV LGAN+FSERQ IGTAAQ QD  KDY+EPPAAP FE GEL SWSFYRAGIAE
Sbjct  1    MEDREEDVRLGANRFSERQPIGTAAQSQDEGKDYTEPPAAPFFEPGELSSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            FMATFLFLYIT+LTVMGVVK ++KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FMATFLFLYITILTVMGVVKEKTKCPTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  156



>gb|ABH09325.1| putative aquaporin [Vitis vinifera]
Length=286

 Score =   284 bits (727),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ +GTAAQ DKDY EPP APLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFTERQPLGTAAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGVV+S SKC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGF  153



>gb|ABN14348.1| aquaporin PIP1;2 [Vitis vinifera]
Length=286

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGVV+S SKC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGF  153



>ref|XP_011042268.1| PREDICTED: probable aquaporin PIP1-2 [Populus euphratica]
Length=288

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGAN+F+ERQ IGTAAQ   DKDY EPP APLFE GEL+SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANRFNERQPIGTAAQSLDDKDYKEPPPAPLFEPGELISWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLYITVLTVMGVVK ++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYITVLTVMGVVKDQTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  155



>gb|ABR68794.1| aquaporin PIP1-2 [Gossypium hirsutum]
 gb|KJB25856.1| hypothetical protein B456_004G212800 [Gossypium raimondii]
Length=287

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPPAAP FE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            LFLARKLSLTRA+FYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LFLARKLSLTRALFYMIMQCLGAICGAGVVKGFQGD  156



>gb|AGG39696.1| aquaporin protein AQU18 [Camellia sinensis]
Length=286

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ IGTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFTERQPIGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGVV++ +KC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITLLTVMGVVRAPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  153



>gb|KCW77503.1| hypothetical protein EUGRSUZ_D01836 [Eucalyptus grandis]
Length=217

 Score =   281 bits (719),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCTTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            LFLARKLSLTRAVFY++MQCLGAICGAGVVKG   D
Sbjct  121  LFLARKLSLTRAVFYIIMQCLGAICGAGVVKGLQGD  156



>ref|NP_001267949.1| aquaporin PIP1;2 [Vitis vinifera]
 gb|ABN14350.1| aquaporin PIP1;4 [Vitis vinifera]
 gb|AIK66514.1| putative aquaporin [Vitis vinifera]
Length=286

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGVV+S SKC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGF  153



>ref|XP_002312147.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK96483.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE89514.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=287

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGAN+F+ERQ IGTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANRFNERQPIGTAAQSLDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLYITVLTVMGVVK ++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYITVLTVMGVVKDQTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  155



>gb|AGD98710.1| aquaporin protein 7 [Camellia sinensis]
Length=286

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ IGTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFTERQPIGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGVV++ +KC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITLLTVMGVVRAPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  153



>gb|ADE34281.1| aquaporin PIP1;12, partial [Gossypium hirsutum]
Length=267

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEGD  156



>gb|ACL14797.1| plasma membrane intrinsic protein 1 [Populus alba x Populus glandulosa]
Length=287

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGAN+F+ERQ IGTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANRFNERQPIGTAAQSLDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLYITVLTVMGVVK ++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYITVLTVMGVVKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  155



>gb|KHG25052.1| putative aquaporin PIP1-2 [Gossypium arboreum]
Length=287

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEGD  156



>gb|ABD63904.1| aquaporin 1 [Gossypium hirsutum]
 gb|KJB20655.1| hypothetical protein B456_003G158100 [Gossypium raimondii]
Length=287

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEGD  156



>ref|XP_011072833.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Sesamum indicum]
Length=288

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV LGANKF+ERQ +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVRLGANKFTERQPLGTAAQTDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMGV +S SKC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGVGRSSSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQR  550
            FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF +   +R
Sbjct  123  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMKGPYER  161



>ref|XP_009386050.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANKF ERQ IGTAAQ ++KDY EPP APLFE GEL SWSFYRAGIAEFM
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTAAQSEEKDYKEPPLAPLFEPGELKSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGVVKS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVVKSSSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF +   +  G
Sbjct  121  GLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGFQKGVYENNG  163



>gb|KJB25854.1| hypothetical protein B456_004G212800 [Gossypium raimondii]
Length=279

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPPAAP FE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            LFLARKLSLTRA+FYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LFLARKLSLTRALFYMIMQCLGAICGAGVVKGFQGD  156



>gb|ADE34282.1| aquaporin PIP1;13 [Gossypium hirsutum]
Length=267

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEGD  156



>ref|XP_007040270.1| Plasma membrane intrinsic protein 1,4 isoform 3, partial [Theobroma 
cacao]
 gb|EOY24771.1| Plasma membrane intrinsic protein 1,4 isoform 3, partial [Theobroma 
cacao]
Length=289

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  65   EKMEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
             KME +EEDV LGANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    RKMEGKEEDVKLGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYIT+LTVMGV +S++KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYITILTVMGVSQSKTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            FGL LARKLSLTRAVFY++MQCLGAICGAGVVKGF  D
Sbjct  121  FGLLLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQGD  158



>gb|AAF71818.1|AF141898_1 putative aquaporin PIP1-2 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=286

 Score =   283 bits (723),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANK++ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVRLGANKYTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGVV+S SKC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGF  153



>ref|XP_002509815.1| Aquaporin PIP1.3, putative [Ricinus communis]
 gb|EEF51202.1| Aquaporin PIP1.3, putative [Ricinus communis]
Length=287

 Score =   283 bits (723),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVRLGANKFTERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV KS +KC+TVG QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSKSGNKCATVGTQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            LFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF  D
Sbjct  121  LFLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGD  156



>tpg|DAA33858.1| TPA_inf: aquaporin PIP1;4 [Gossypium hirsutum]
Length=287

 Score =   283 bits (723),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFEGD  156



>gb|AHI54567.1| aquaporin protein 7 [Camellia japonica]
Length=286

 Score =   283 bits (723),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFTERQPLGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGVV++ +KC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITLLTVMGVVRAPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  153



>tpg|DAA33859.1| TPA_inf: aquaporin PIP1;5 [Gossypium hirsutum]
Length=278

 Score =   282 bits (722),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPPAAP FE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPAAPFFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            LFLARKLSLTRA+FYM+MQCLGAICGAGVVKGF  D
Sbjct  121  LFLARKLSLTRALFYMIMQCLGAICGAGVVKGFQGD  156



>gb|KHG13859.1| putative aquaporin PIP-type 7a [Gossypium arboreum]
Length=289

 Score =   282 bits (722),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 145/156 (93%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD--KDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME REEDV LGAN+FSERQ IGTAAQ QD  KDY+EPPAAP FE GEL SWSFYRAGIAE
Sbjct  1    MEDREEDVRLGANRFSERQPIGTAAQSQDEGKDYTEPPAAPFFEPGELSSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            FMATFLFLYIT+LTVMGVVK ++KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FMATFLFLYITILTVMGVVKEKTKCPTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  156



>gb|KCW77504.1| hypothetical protein EUGRSUZ_D01836 [Eucalyptus grandis]
Length=255

 Score =   281 bits (719),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCTTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            LFLARKLSLTRAVFY++MQCLGAICGAGVVKG   D
Sbjct  121  LFLARKLSLTRAVFYIIMQCLGAICGAGVVKGLQGD  156



>ref|XP_006352272.1| PREDICTED: probable aquaporin PIP-type pTOM75-like [Solanum tuberosum]
Length=287

 Score =   282 bits (722),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDVNLGANKF E Q +GT+AQ DKDY+EPPAAPLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVNLGANKFREPQPLGTSAQTDKDYNEPPAAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF +   QR G
Sbjct  123  FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFMQGPYQRFG  163



>dbj|BAF44223.1| aquaporin [Iris x hollandica]
Length=327

 Score =   283 bits (725),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 149/165 (90%), Gaps = 3/165 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGANKFSERQ IGTAAQ   + KDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTAAQVADESKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGV KS+SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FIATFLFLYITILTVMGVSKSKSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKG+G+   Q QG
Sbjct  121  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGYGKMLYQTQG  165



>ref|XP_009386408.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   282 bits (721),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME REEDV +GANKFSERQAIGTAAQ QD+DY EPP APLFE  EL SWSFYRAGIAEFM
Sbjct  1    MEGREEDVRVGANKFSERQAIGTAAQSQDRDYQEPPPAPLFEPAELSSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYI++LTVMGVVKS +KCSTVGIQGIAWAFGGMIF LVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYISILTVMGVVKSNTKCSTVGIQGIAWAFGGMIFILVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GL LARKLSLTRA+FYMVMQCLGAICGAGVVKGF +   +  G
Sbjct  121  GLLLARKLSLTRALFYMVMQCLGAICGAGVVKGFKKGLYENNG  163



>gb|AHX99531.1| aquaporin PIP1 [Chrysanthemum x morifolium]
Length=287

 Score =   282 bits (721),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANK+SERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKYSERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYI+VLTVMGVVKS +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYISVLTVMGVVKSPTKCGTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRALFYMVMQCLGAICGAGVVKGF  153



>gb|AAF80556.1|AF188843_1 plasma membrane aquaporin [Vitis vinifera]
Length=286

 Score =   282 bits (721),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGVV+S SKC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRAVFYM+MQCLGAICGA VVKGF
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGASVVKGF  153



>emb|CAH59432.1| aquaporin 2 [Plantago major]
Length=282

 Score =   281 bits (720),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 145/159 (91%), Gaps = 2/159 (1%)
 Frame = +2

Query  86   EDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMATFL  259
            EDVNLGANK+SERQ IGTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF+ATFL
Sbjct  1    EDVNLGANKYSERQPIGTAAQTHDDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFVATFL  60

Query  260  FLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFL  439
            FLYITVLTVMGV KS+SKC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFL
Sbjct  61   FLYITVLTVMGVSKSDSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFL  120

Query  440  ARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            ARKLSLTRAVFYM+MQCLGAICGAGVVKGFG+     +G
Sbjct  121  ARKLSLTRAVFYMIMQCLGAICGAGVVKGFGQTLYMTKG  159



>ref|XP_010661719.1| PREDICTED: aquaporin PIP1;2 isoform X1 [Vitis vinifera]
Length=313

 Score =   283 bits (723),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGVV+S SKC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGF  153



>emb|CAH60719.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=278

 Score =   281 bits (719),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF+ERQ +GTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFNERQPLGTAAQSQDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLYITVLTVMGVVK  +KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYITVLTVMGVVKDPTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYMLMQCLGAICGAGVVKGF  155



>ref|NP_001289835.1| probable aquaporin PIP-type pTOM75 [Solanum lycopersicum]
 dbj|BAO18621.1| plasmamembrane intrinsic protein 1;1 [Solanum lycopersicum]
Length=287

 Score =   281 bits (720),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDVNLGANKF E Q +GT+AQ DKDY EPP APL+E GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVNLGANKFREPQPLGTSAQTDKDYKEPPPAPLYEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF +   QR G
Sbjct  123  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMQGPYQRLG  163



>gb|ACB38232.1| aquaporin [Gerbera hybrid cultivar]
Length=287

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYI+VLTVMGV KS +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYISVLTVMGVAKSPTKCGTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRALFYMVMQCLGAICGAGVVKGF  153



>ref|XP_010053244.1| PREDICTED: aquaporin PIP1-3 [Eucalyptus grandis]
 gb|KCW77501.1| hypothetical protein EUGRSUZ_D01836 [Eucalyptus grandis]
Length=287

 Score =   281 bits (719),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S++KC+TVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSQSKTKCTTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            LFLARKLSLTRAVFY++MQCLGAICGAGVVKG   D
Sbjct  121  LFLARKLSLTRAVFYIIMQCLGAICGAGVVKGLQGD  156



>gb|AAZ91447.1| PIP1 aquaporin [Xerophyta humilis]
Length=286

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ ++DY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTSAQTERDYVEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGVVKS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVVKSPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRA+FYMVMQ LGAICGAGVVKGF +     QG
Sbjct  121  LFLARKLSLTRALFYMVMQRLGAICGAGVVKGFQKGLYMSQG  162



>gb|ABH09323.1| putative aquaporin [Vitis vinifera]
Length=286

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVRLGANKFTERQPIGTSAQTDKDYREPPPAPLFEPGELHSWSFWRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLF YITVLTVMGVV+S SKC+TVGIQGIAWAFGGMIFALVYCTAGISGGH+NPAVTFG
Sbjct  61   TFLFPYITVLTVMGVVRSPSKCATVGIQGIAWAFGGMIFALVYCTAGISGGHVNPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGF  153



>ref|XP_007160075.1| hypothetical protein PHAVU_002G290400g [Phaseolus vulgaris]
 gb|ESW32069.1| hypothetical protein PHAVU_002G290400g [Phaseolus vulgaris]
Length=287

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME++EEDV +GANKF+ERQ +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MENKEEDVKVGANKFTERQPLGTAAQGDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV +S SKCS+VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVNRSSSKCSSVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDG  541
            LFLARKLSLTRAVFY++MQCLGAICGAGVVKGF  +G
Sbjct  121  LFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFEGNG  157



>gb|AAY22204.1| putative aquaporin [Phaseolus vulgaris]
Length=287

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME++EEDV +GANKF+ERQ +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MENKEEDVKVGANKFTERQPLGTAAQGDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV +S SKCS+VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVNRSSSKCSSVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDG  541
            LFLARKLSLTRAVFY++MQCLGAICGAGVVKGF  +G
Sbjct  121  LFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFEGNG  157



>gb|AHB33476.1| plasma intrinsic protein 1-3 [Cucumis sativus]
Length=286

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APL+E GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLYEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLY T+L VMGV +S SKC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYTTILMVMGVNRSPSKCNSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            LFLARKLSLTRAVFY++MQCLGAICGAGVVKGF G   VQ+ G
Sbjct  121  LFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFEGSSYVQKLG  163



>ref|XP_007040268.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
 ref|XP_007040269.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
 gb|EOY24769.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
 gb|EOY24770.1| Plasma membrane intrinsic protein 1,4 isoform 1 [Theobroma cacao]
Length=287

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV +S++KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVSQSKTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            L LARKLSLTRAVFY++MQCLGAICGAGVVKGF  D
Sbjct  121  LLLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQGD  156



>gb|AAF71817.1| putative aquaporin PIP1-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
 gb|ABN14347.1| aquaporin PIP1;1 [Vitis vinifera]
 emb|CAN77353.1| hypothetical protein VITISV_038809 [Vitis vinifera]
Length=286

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANKFSERQ IGTAAQ  DKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MEGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLY++VLTVMGVV+++SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GLFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF
Sbjct  121  GLFLARKLSLTRAVYYMVMQCLGAICGAGVVKGF  154



>gb|AIP86906.1| aquaporin [Vitis heyneana]
Length=286

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANKFSERQ IGTAAQ  DKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MEGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLY++VLTVMGVV+++SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GLFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF
Sbjct  121  GLFLARKLSLTRAVYYMVMQCLGAICGAGVVKGF  154



>ref|NP_001267918.1| aquaporin-like [Vitis vinifera]
 gb|AEZ35024.1| plasma membrane 1;1 aquaporin [Vitis vinifera]
Length=286

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANKFSERQ IGTAAQ  DKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MEGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLY++VLTVMGVV+++SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GLFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF
Sbjct  121  GLFLARKLSLTRAVYYMVMQCLGAICGAGVVKGF  154



>gb|ABH09322.1| putative aquaporin [Vitis vinifera]
Length=286

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANKFSERQ IGTAAQ  DKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MEGKEEDVRVGANKFSERQPIGTAAQGDDKDYKEPPPAPLFEPGELCSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLY++VLTVMGVV+++SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYVSVLTVMGVVRADSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GLFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF
Sbjct  121  GLFLARKLSLTRAVYYMVMQCLGAICGAGVVKGF  154



>ref|XP_010089092.1| putative aquaporin PIP1-4 [Morus notabilis]
 gb|EXB37339.1| putative aquaporin PIP1-4 [Morus notabilis]
Length=287

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELTSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV K+ +KCSTVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVSKAPTKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRAVFY++MQ LGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRAVFYIIMQTLGAICGAGVVKGF  153



>ref|XP_010935853.1| PREDICTED: probable aquaporin PIP1-2 [Elaeis guineensis]
Length=287

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV LG +KF ERQ IGTAAQ QDKDY EPP APLFE GEL SWSFYRAGIAEFM
Sbjct  1    MEGKEEDVRLGVDKFPERQPIGTAAQTQDKDYKEPPPAPLFEPGELQSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGVVKS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVVKSPSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GL LARKLSL RA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  GLLLARKLSLIRALFYMVMQCLGAICGAGVVKGF  154



>sp|Q7XSQ9.3|PIP12_ORYSJ RecName: Full=Probable aquaporin PIP1-2; AltName: Full=OsPIP1;2; 
AltName: Full=Plasma membrane intrinsic protein 1-2 [Oryza 
sativa Japonica Group]
 emb|CAH68052.1| B0103C08-B0602B01.9 [Oryza sativa Indica Group]
 gb|EAY95145.1| hypothetical protein OsI_16963 [Oryza sativa Indica Group]
 gb|EAZ31617.1| hypothetical protein OsJ_15761 [Oryza sativa Japonica Group]
Length=288

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSERQ IGTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLYITVLTVMGV  S SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYITVLTVMGVNNSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  155



>ref|XP_010523742.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523743.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523744.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523746.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523747.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
 ref|XP_010523748.1| PREDICTED: aquaporin PIP1-1 [Tarenaya hassleriana]
Length=286

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLY+TVLTVMGV +S S CS+VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYVTVLTVMGVKRSPSMCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF     Q QG
Sbjct  121  LFLARKLSLTRAVYYMVMQCLGAICGAGVVKGFQPSQYQIQG  162



>gb|AFV92901.1| putative PIP-type aquaporin [Lolium perenne]
Length=288

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSERQ IGTAAQ  +DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLY+T+LTVMGV  S SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYVTILTVMGVNNSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  155



>ref|XP_010095072.1| Aquaporin PIP1-1 [Morus notabilis]
 gb|EXB58178.1| Aquaporin PIP1-1 [Morus notabilis]
Length=288

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD--KDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGANKFSERQ IGTAAQ QD  KDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQTQDDGKDYKEPPPAPLFEPGELTSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGVVK +SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FIATFLFLYITILTVMGVVKEDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  156



>ref|NP_001234139.1| probable aquaporin PIP-type pTOM75 [Solanum lycopersicum]
 sp|Q08451.1|PIP1_SOLLC RecName: Full=Probable aquaporin PIP-type pTOM75; AltName: Full=Ripening-associated 
membrane protein; Short=RAMP [Solanum 
lycopersicum]
 emb|CAA52068.1| tomato ripening associated membrane protein [Solanum lycopersicum]
 dbj|BAO18624.1| plasmamembrane intrinsic protein 1;5 [Solanum lycopersicum]
Length=286

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV LGANKF E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF     QR G
Sbjct  123  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMVGPYQRLG  163



>ref|XP_010240237.1| PREDICTED: probable aquaporin PIP1-2 [Brachypodium distachyon]
Length=288

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSERQ IGTAAQ  +DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLY+T+LTVMGV  S SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYVTILTVMGVNNSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  155



>gb|KDP25424.1| hypothetical protein JCGZ_20580 [Jatropha curcas]
Length=287

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ IGTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVRLGANKFTERQPIGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV KS +KC+TVG QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVSKSGNKCATVGTQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRALFYIIMQCLGAICGAGVVKGF  153



>ref|XP_003570076.1| PREDICTED: aquaporin PIP1-1-like [Brachypodium distachyon]
Length=286

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGANKFSERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGGGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYITVLTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FIATFLFLYITVLTVMGVSKSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGF  156



>ref|XP_007009059.1| Plasma membrane intrinsic protein 1,4 [Theobroma cacao]
 gb|EOY17869.1| Plasma membrane intrinsic protein 1,4 [Theobroma cacao]
Length=289

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGANKFSERQ IGTAAQ   ++KDY+EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQSQDEEKDYTEPPPAPLFEPGELTSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGVVK  +KC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVVKETTKCPTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGF  156



>ref|XP_004976483.1| PREDICTED: aquaporin PIP1-1-like [Setaria italica]
Length=288

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANK+SERQ IGTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKYSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI++LTVMGV KS+SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISILTVMGVSKSQSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGF  155



>ref|XP_010544738.1| PREDICTED: aquaporin PIP1-1-like [Tarenaya hassleriana]
Length=286

 Score =   279 bits (714),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S S C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+YMVMQCLGAICGAGVVKGF     Q QG
Sbjct  121  LFLARKLSLTRAVYYMVMQCLGAICGAGVVKGFQPSQYQIQG  162



>ref|XP_009600058.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana tomentosiformis]
Length=287

 Score =   279 bits (714),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV LGANKF E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF     QR G
Sbjct  123  FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFMVGPYQRHG  163



>dbj|BAA20075.1| water channel protein [Nicotiana excelsior]
Length=287

 Score =   279 bits (714),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV LGANKF E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRA+FYMVMQCLGAICGAGVVKGF     QR G
Sbjct  123  FLARKLSLTRAIFYMVMQCLGAICGAGVVKGFMVGPYQRLG  163



>emb|CAA04652.1| major intrinsic protein PIPa2 [Craterostigma plantagineum]
Length=287

 Score =   279 bits (714),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSER  IGTAAQ   DKDY+EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEAKEEDVRLGANKFSERNPIGTAAQTHDDKDYTEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLYIT+LTVMGV ++ +KC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYITILTVMGVNRAPNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF +     +G
Sbjct  121  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFYKPTYNLEG  164



>ref|XP_009383904.1| PREDICTED: probable aquaporin PIP1-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   279 bits (714),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV LGAN+FSERQ IGTAAQ Q+KDY EPP APLFE  E  SWSFYRAGIAEFM
Sbjct  1    MEGKEEDVRLGANRFSERQPIGTAAQNQEKDYKEPPPAPLFEPAEFFSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGVVKS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVVKSTTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GL LARKLSL RA+FYMVMQCLGAICGAGVVKGF +   Q  G
Sbjct  121  GLLLARKLSLNRALFYMVMQCLGAICGAGVVKGFQKGLYQSNG  163



>ref|XP_011035995.1| PREDICTED: probable aquaporin PIP1-2 [Populus euphratica]
Length=287

 Score =   279 bits (713),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF+ERQ +GTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFNERQPLGTAAQSQDDKDYKEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLYITVLTVMGV K  +KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYITVLTVMGVSKDTTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYMLMQCLGAICGAGVVKGF  155



>gb|KFK30621.1| hypothetical protein AALP_AA6G005800 [Arabis alpina]
Length=286

 Score =   279 bits (713),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF E+Q IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPEKQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF  +  Q QG
Sbjct  121  LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPNAYQLQG  162



>gb|EYU32132.1| hypothetical protein MIMGU_mgv1a011344mg [Erythranthe guttata]
Length=210

 Score =   276 bits (706),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 145/162 (90%), Gaps = 1/162 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV+LGANK+SERQ +GT+AQ  KDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVSLGANKYSERQPLGTSAQ-TKDYKEPPPAPLFEPGELKSWSFWRAGIAEFVA  59

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV KS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  60   TFLFLYITVLTVMGVSKSPSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  119

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF     Q  G
Sbjct  120  LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPKIYQAMG  161



>gb|AFU61115.1| water channel protein PIP [Capsicum annuum]
Length=286

 Score =   279 bits (713),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV+LGANK+ E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVSLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRA+FY+VMQCLGAICGAGVVKGF +   QR G
Sbjct  123  FLARKLSLTRAIFYIVMQCLGAICGAGVVKGFMQGPYQRLG  163



>gb|KJB41349.1| hypothetical protein B456_007G100000 [Gossypium raimondii]
Length=286

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT AQ DKDY+EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTTAQTDKDYNEPPPAPLFEHGELYSWSFWRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ SKC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVNRAPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRAIFYMVMQCLGAICGAGVVKGF  153



>gb|KJB74255.1| hypothetical protein B456_011G283200 [Gossypium raimondii]
Length=218

 Score =   276 bits (706),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF ERQ IGTAAQ   DKDY+EPP APLFE  EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFPERQPIGTAAQSQDDKDYTEPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVK ++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISVLTVMGVVKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFL RKLSLTRA++YMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLGRKLSLTRAIYYMVMQCLGAICGAGVVKGF  155



>ref|XP_004953388.1| PREDICTED: aquaporin PIP1-2-like [Setaria italica]
Length=289

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGANKFSERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVSKSNSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGF  156



>gb|KHG18900.1| putative aquaporin PIP1-4 -like protein [Gossypium arboreum]
Length=286

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT AQ DKDY+EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTTAQTDKDYNEPPPAPLFEHGELYSWSFWRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ SKC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVNRAPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRAIFYMVMQCLGAICGAGVVKGF  153



>ref|XP_010556545.1| PREDICTED: aquaporin PIP1-3-like [Tarenaya hassleriana]
Length=286

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF+ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVRVGANKFTERQPIGTSAQTDKDYKEPPPAPLFEPGELTSWSFWRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYMVMQ LGAICGAGVVKGF     QR G
Sbjct  121  LFLARKLSLTRAVFYMVMQSLGAICGAGVVKGFMPSHYQRLG  162



>gb|KDO69068.1| hypothetical protein CISIN_1g018895mg [Citrus sinensis]
 gb|KDO69069.1| hypothetical protein CISIN_1g018895mg [Citrus sinensis]
 gb|KDO69070.1| hypothetical protein CISIN_1g018895mg [Citrus sinensis]
Length=213

 Score =   276 bits (705),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF+ERQ IGTAAQ QD KDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVKS +KCSTVGIQGIAWAFGGMIF LVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  LGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  155



>gb|AFH36339.1| aquaporin PIP1;1 [Quercus petraea]
Length=289

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 147/165 (89%), Gaps = 4/165 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD---KDYSEPPAAPLFEEGELMSWSFYRAGIA  238
            ME +EEDV LGANKF ERQ IGTAAQ QD   KDY EPP APLFE GEL SWSFYRAGIA
Sbjct  1    MEGKEEDVRLGANKFPERQPIGTAAQSQDDEAKDYKEPPPAPLFEPGELTSWSFYRAGIA  60

Query  239  EFMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPA  418
            EF+ATFLFLYIT+LTVMGVVKS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPA
Sbjct  61   EFVATFLFLYITILTVMGVVKSPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPA  120

Query  419  VTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQ  553
            VTFGLFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF +   + Q
Sbjct  121  VTFGLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFEKSQYEIQ  165



>ref|XP_002454508.1| hypothetical protein SORBIDRAFT_04g032430 [Sorghum bicolor]
 gb|EES07484.1| hypothetical protein SORBIDRAFT_04g032430 [Sorghum bicolor]
Length=289

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGANKFSERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVSKSNSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGF  156



>ref|XP_006652632.1| PREDICTED: probable aquaporin PIP1-2-like [Oryza brachyantha]
Length=295

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSERQ IGTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLYITVLTVMGV  S SKC++VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYITVLTVMGVNNSPSKCASVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  155



>ref|XP_006647653.1| PREDICTED: aquaporin PIP1-1-like isoform X1 [Oryza brachyantha]
Length=295

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGAN+FSERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANRFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYITVLTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITVLTVMGVSKSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGF  156



>ref|XP_006435692.1| hypothetical protein CICLE_v10032298mg [Citrus clementina]
 ref|XP_006486356.1| PREDICTED: probable aquaporin PIP1-2-like [Citrus sinensis]
 gb|ESR48932.1| hypothetical protein CICLE_v10032298mg [Citrus clementina]
 gb|KDO69061.1| hypothetical protein CISIN_1g023021mg [Citrus sinensis]
Length=288

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF+ERQ IGTAAQ QD KDY EPP APLFEE EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFTERQPIGTAAQSQDGKDYVEPPPAPLFEEEELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVKS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  155



>ref|XP_006647654.1| PREDICTED: aquaporin PIP1-1-like isoform X2 [Oryza brachyantha]
Length=289

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGAN+FSERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANRFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYITVLTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITVLTVMGVSKSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGF  156



>emb|CAA04653.1| major intrinsic protein PIPB [Craterostigma plantagineum]
Length=288

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E+REEDV LGANK+ E Q IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+AT
Sbjct  3    ENREEDVRLGANKYRETQPIGTSAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMGV ++ +KC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGVSRAPNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRA+FYM+MQCLGAICGAGVVKGF     QR G
Sbjct  123  FLARKLSLTRAIFYMIMQCLGAICGAGVVKGFQVGPYQRLG  163



>gb|AIA83105.1| putative aquaporin PIP1 [Citrus x paradisi x Citrus trifoliata]
Length=288

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF+ERQ IGTAAQ QD KDY EPP APLFEE EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFNERQPIGTAAQSQDGKDYVEPPPAPLFEEEELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVKS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  155



>gb|ABJ97677.1| major intrinsic protein [Solanum tuberosum]
Length=288

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDVNLGANK+ E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  123  FLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  154



>gb|ACC59097.1| aquaporin [Saccharum officinarum]
Length=289

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGANKFSERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGF  156



>gb|AIA83103.1| putative aquaporin PIP1 [Citrus sinensis x Citrus trifoliata]
Length=288

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF+ERQ IGTAAQ QD KDY EPP APLFEE EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFNERQPIGTAAQSQDGKDYVEPPPAPLFEEEELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVKS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  155



>emb|CAA04750.1| aquaporin 1 [Nicotiana tabacum]
 gb|AAB81601.1| aquaporin 1 [Nicotiana tabacum]
Length=287

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV LGANKF E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRA+FY+VMQCLGAICGAGVVKGF     QR G
Sbjct  123  FLARKLSLTRAIFYIVMQCLGAICGAGVVKGFMVGPYQRLG  163



>ref|XP_009780083.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana sylvestris]
 gb|ABI93215.1| water channel protein [Nicotiana tabacum]
Length=287

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV LGANKF E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRA+FY+VMQCLGAICGAGVVKGF     QR G
Sbjct  123  FLARKLSLTRAIFYIVMQCLGAICGAGVVKGFMVGPYQRLG  163



>ref|XP_009793682.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana sylvestris]
 tpg|DAA64669.1| TPA_exp: aquaporin PIP1 2a [Nicotiana tabacum]
Length=287

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV LGANK+ E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVKLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRA+FYMVMQCLGAICGAGVVKGF     QR G
Sbjct  123  FLARKLSLTRALFYMVMQCLGAICGAGVVKGFMVGPYQRLG  163



>ref|XP_006360691.1| PREDICTED: probable aquaporin PIP-type pTOM75 isoform X2 [Solanum 
tuberosum]
Length=292

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDVNLGANK+ E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  123  FLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  154



>gb|ABC01892.1| major intrinsic protein 1-like protein [Solanum tuberosum]
Length=288

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDVNLGANK+ E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  123  FLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  154



>gb|AAO86706.1| plasma membrane intrinsic protein [Zea mays]
 gb|ACF82668.1| unknown [Zea mays]
 gb|ACF84488.1| unknown [Zea mays]
 tpg|DAA36473.1| TPA: aquaporin PIP1-1(ZmPIP1-1) [Zea mays]
Length=288

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSERQ IGTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGTDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI++LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGF  155



>ref|XP_002531349.1| Aquaporin PIP1.1, putative [Ricinus communis]
 gb|EEF31033.1| Aquaporin PIP1.1, putative [Ricinus communis]
Length=288

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME REEDV++GAN++ ERQ IGTAAQ QD KDYSEPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGREEDVSVGANRYGERQPIGTAAQTQDVKDYSEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYITVLTVMGVVKS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYITVLTVMGVVKSPSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVK  
Sbjct  121  FGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKAL  155



>ref|NP_001274291.1| probable aquaporin PIP-type pTOM75-like [Solanum lycopersicum]
 dbj|BAO18623.1| plasmamembrane intrinsic protein 1;3 [Solanum lycopersicum]
Length=288

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDVNLGANK+ E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VG+QG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGVQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF     +R G
Sbjct  123  FLARKLSLTRAVFYIVMQCLGAICGAGVVKGFMVGPYERLG  163



>ref|XP_009630280.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana tomentosiformis]
 tpg|DAA64670.1| TPA_exp: aquaporin PIP1 2b [Nicotiana tabacum]
Length=287

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV LGANK+ E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVKLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRA+FYMVMQCLGAICGAGVVKGF     QR G
Sbjct  123  FLARKLSLTRALFYMVMQCLGAICGAGVVKGFMVGPYQRLG  163



>ref|XP_011022675.1| PREDICTED: aquaporin PIP1-2 [Populus euphratica]
Length=288

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 145/164 (88%), Gaps = 2/164 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY E P APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEAPPAPLFEPGELKSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKS-ESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            TFLFLYITVLTVMGV K   SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   TFLFLYITVLTVMGVTKPGTSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            GLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF G    + QG
Sbjct  121  GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQGSSSYEVQG  164



>emb|CAH60718.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=288

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 145/164 (88%), Gaps = 2/164 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY E P APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEAPPAPLFEPGELKSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKS-ESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            TFLFLYITVLTVMGV K   SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   TFLFLYITVLTVMGVTKPGTSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            GLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF G    + QG
Sbjct  121  GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQGSHNFELQG  164



>gb|ACU00100.1| plasma membrane intrinsic protein PIP1.3 [Populus trichocarpa 
x Populus deltoides]
Length=288

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 145/164 (88%), Gaps = 2/164 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY E P APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEAPPAPLFEPGELKSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKS-ESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            TFLFLYITVLTVMGV K   SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   TFLFLYITVLTVMGVTKPGTSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            GLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF G    + QG
Sbjct  121  GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQGSHNYELQG  164



>emb|CDY15165.1| BnaC05g00440D [Brassica napus]
Length=324

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   KMEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            KME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+
Sbjct  38   KMEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFI  97

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  98   ATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  157

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF     Q  G
Sbjct  158  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQPSPYQTLG  200



>gb|AAF71819.1|AF141899_1 putative aquaporin PIP1-3 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=287

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFTERQPLGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV KS + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVKKSSTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRAIFYIIMQCLGAICGAGVVKGF  153



>dbj|BAA20076.1| water channel protein [Nicotiana excelsior]
Length=287

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV LGANK+ E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVKLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRA+FYMVMQCLGAICGAGVVKGF     QR G
Sbjct  123  FLARKLSLTRALFYMVMQCLGAICGAGVVKGFMVGPYQRLG  163



>gb|KJB74256.1| hypothetical protein B456_011G283300 [Gossypium raimondii]
Length=288

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSERQ IGTAAQ   DKDY+EPP APLFE  EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQSQDDKDYTEPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVK ++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISVLTVMGVVKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFL RKLSLTRA++YMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLGRKLSLTRAIYYMVMQCLGAICGAGVVKGF  155



>gb|AAL49748.1|AF452010_1 channel-like protein [Petunia x hybrida]
Length=286

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV LGANKF E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVKLGANKFRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMGV +S+S C +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGVKRSDSLCHSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTRA+FY+VMQCLGAICGAGVVKG+ +   QR G
Sbjct  123  FLARKLSLTRALFYIVMQCLGAICGAGVVKGYMQGPYQRLG  163



>gb|KHG01288.1| putative aquaporin PIP-type 7a [Gossypium arboreum]
Length=288

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSERQ IGTAAQ   DKDY+EPP APLFE  EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQSQDDKDYTEPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGV+K ++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISVLTVMGVLKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFL RKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLGRKLSLTRAIFYMVMQCLGAICGAGVVKGF  155



>gb|ACF84511.1| unknown [Zea mays]
 gb|ACG37183.1| aquaporin PIP1.1 [Zea mays]
 gb|AFW72702.1| plasma membrane intrinsic protein1 [Zea mays]
Length=289

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGANKFSERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGAADDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRALFYIIMQCLGAICGAGVVKGF  156



>gb|ACV66985.1| plasma membrane aquaporin 1 [Hevea brasiliensis]
Length=287

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVRLGANKFTERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMG  K  +KC+TVG QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGFSKPNNKCTTVGTQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRA+FYM+MQCLGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRALFYMIMQCLGAICGAGVVKGF  153



>gb|AFH36340.1| aquaporin PIP1;2 [Quercus petraea]
Length=286

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANK+SERQ +GT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKVGANKYSERQPLGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMG  KS +KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGYNKSTNKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            L LARKLSLTRAVFY++MQCLGAICGAGVVKGFG    +  G
Sbjct  121  LLLARKLSLTRAVFYIIMQCLGAICGAGVVKGFGPTFYEGNG  162



>ref|XP_002889360.1| hypothetical protein ARALYDRAFT_470115 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65619.1| hypothetical protein ARALYDRAFT_470115 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF  +  Q  G
Sbjct  121  LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPNPYQTLG  162



>ref|XP_002315171.1| hypothetical protein POPTR_0010s19930g [Populus trichocarpa]
 gb|ABK95101.1| unknown [Populus trichocarpa]
 gb|EEF01342.1| hypothetical protein POPTR_0010s19930g [Populus trichocarpa]
Length=287

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF+ERQ +GTAAQ   DKDY EPP APLFE  EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFNERQPLGTAAQSQDDKDYKEPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLYITVLTVMGV K  +KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYITVLTVMGVFKDTTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYMLMQCLGAICGAGVVKGF  155



>tpg|DAA33861.1| TPA_inf: aquaporin PIP1;7 [Gossypium hirsutum]
Length=288

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSERQ IGTAAQ   DKDY+EPP APLFE  EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQSQDDKDYTEPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGV+K ++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISVLTVMGVLKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFL RKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLGRKLSLTRAIFYMVMQCLGAICGAGVVKGF  155



>gb|KHM99966.1| Putative aquaporin PIP1-2 [Glycine soja]
Length=287

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GA KFSERQ IGTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MESKEEDVRVGATKFSERQPIGTAAQGDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV +S SKC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVNRSPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRALFYIIMQCLGAICGAGVVKGF  153



>gb|ACB56912.1| aquaporin [Ananas comosus]
Length=288

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV+LGANKFSERQ IGTAAQ QD KDY EPPAAPLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVSLGANKFSERQPIGTAAQSQDSKDYKEPPAAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLY+++LTVMGVVKS SKCSTVG+QGIAWAFGGMIFALVYCTAGISGGHIN AVT
Sbjct  61   MATFLFLYVSILTVMGVVKSPSKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINXAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGL LARKLSLTRA+FY+VMQCLGAICGAGVVKGF
Sbjct  121  FGLLLARKLSLTRAIFYIVMQCLGAICGAGVVKGF  155



>ref|NP_001275388.1| major intrinsic protein 1-like protein [Solanum tuberosum]
 emb|CBI99235.1| major intrinsic protein 1 [Solanum tuberosum]
Length=288

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDVNLGANK+ E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VG+QG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGVQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  123  FLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  154



>ref|XP_007026768.1| Plasma membrane intrinsic protein 1,4 [Theobroma cacao]
 gb|EOY07270.1| Plasma membrane intrinsic protein 1,4 [Theobroma cacao]
Length=287

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 147/164 (90%), Gaps = 2/164 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME + EDV LGANK+ ERQ IGTAAQ QD KDY++PP+AP+FE GEL SWSFYRAGIAEF
Sbjct  1    MEGQNEDVRLGANKYRERQPIGTAAQSQDVKDYNDPPSAPIFEPGELSSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYITVLTVMGVVKS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYITVLTVMGVVKSSSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FGLFLARKLSLTRAVFYM+MQCLGAICGA VVK F +   +R G
Sbjct  121  FGLFLARKLSLTRAVFYMIMQCLGAICGAAVVKSFQKTPYERLG  164



>ref|NP_001242504.1| uncharacterized protein LOC100793242 [Glycine max]
 gb|ACU24246.1| unknown [Glycine max]
Length=287

 Score =   277 bits (708),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GA KFSERQ IGTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MESKEEDVRVGATKFSERQPIGTAAQGDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV +S SKC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVNRSPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRALFYIIMQCLGAICGAGVVKGF  153



>ref|NP_001290534.1| uncharacterized protein LOC105042909 [Elaeis guineensis]
 gb|ACB45460.1| aquaporin [Elaeis guineensis]
Length=287

 Score =   277 bits (708),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV LGANKF+ERQ IGTAAQ QDKDY EPP APLFE GEL SWSFYRAGIAEFM
Sbjct  1    MEGKEEDVKLGANKFAERQPIGTAAQSQDKDYKEPPPAPLFEPGELRSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYI++LTV+GV K+ SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYISILTVVGVAKAPSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GL LARKLSL RAVFYMVMQCLGAICG GVVKGF
Sbjct  121  GLLLARKLSLIRAVFYMVMQCLGAICGVGVVKGF  154



>gb|ABB16979.1| major intrinsic protein 1-like protein [Solanum tuberosum]
Length=288

 Score =   277 bits (708),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDVNLGANK+ E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VG+QG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGVQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  123  FLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  154



>ref|XP_009779003.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana sylvestris]
Length=288

 Score =   277 bits (708),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            E++EEDVNLGANK+ E Q +GTAAQ ++KDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  3    ENKEEDVNLGANKYRETQPLGTAAQTENKDYVEPPPAPLFEPGELSSWSFYRAGIAEFMA  62

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  63   TFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFG  122

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF +   QR G
Sbjct  123  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMKGPYQRLG  164



>gb|AFM37319.1| aquaporin [Oryza sativa Japonica Group]
Length=289

 Score =   277 bits (708),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGAN++SERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGF  156



>ref|XP_002446929.1| hypothetical protein SORBIDRAFT_06g025150 [Sorghum bicolor]
 gb|EES11257.1| hypothetical protein SORBIDRAFT_06g025150 [Sorghum bicolor]
Length=288

 Score =   277 bits (708),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANK+SERQ IGTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKYSERQPIGTAAQGTDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI++LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGF  155



>ref|NP_001047672.1| Os02g0666200 [Oryza sativa Japonica Group]
 sp|Q6EU94.1|PIP11_ORYSJ RecName: Full=Aquaporin PIP1-1; AltName: Full=OsPIP1;1; AltName: 
Full=Plasma membrane intrinsic protein 1-1; AltName: Full=Plasma 
membrane intrinsic protein 1a; Short=PIP1a; AltName: 
Full=Water channel protein RWC1; Short=RWC-1 [Oryza sativa 
Japonica Group]
 emb|CAA11896.1| aquaporin [Oryza sativa]
 dbj|BAD28398.1| aquaporin [Oryza sativa Japonica Group]
 dbj|BAD27775.1| aquaporin [Oryza sativa Japonica Group]
 dbj|BAF09586.1| Os02g0666200 [Oryza sativa Japonica Group]
 gb|EAY86995.1| hypothetical protein OsI_08388 [Oryza sativa Indica Group]
 gb|ACA50520.1| aquaporin [Oryza sativa Japonica Group]
 gb|AEV58397.1| aquaporin [Oryza sativa Japonica Group]
 gb|AIR95997.1| aquaporin [Oryza sativa Japonica Group]
Length=289

 Score =   277 bits (708),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGAN++SERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGF  156



>ref|NP_001104934.1| aquaporin PIP1-2 [Zea mays]
 sp|Q9XF59.1|PIP12_MAIZE RecName: Full=Aquaporin PIP1-2; AltName: Full=Plasma membrane 
intrinsic protein 1-2; AltName: Full=ZmPIP1-2; AltName: Full=ZmPIP1;2; 
AltName: Full=ZmPIP1b [Zea mays]
 gb|AAD29676.1|AF131201_1 plasma membrane MIP protein [Zea mays]
Length=289

 Score =   277 bits (708),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGANKFSERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGAADDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY++MQCLGA+CGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRALFYIIMQCLGAVCGAGVVKGF  156



>ref|XP_002526866.1| Aquaporin PIP1.3, putative [Ricinus communis]
 gb|EEF35497.1| Aquaporin PIP1.3, putative [Ricinus communis]
Length=287

 Score =   277 bits (708),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANK+ E Q IGTAAQ   DKDY+EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKYRETQPIGTAAQSQDDKDYTEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVK+ +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  155



>ref|XP_011080941.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Sesamum indicum]
Length=289

 Score =   277 bits (708),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E+REEDV LGANKF+ERQ +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA 
Sbjct  3    ENREEDVKLGANKFTERQPLGTAAQTDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMAI  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMGV ++ +KC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLFLYITILTVMGVGRANNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FLARKLSLTRA+FY+VMQCLGAICGAGVVKGF
Sbjct  123  FLARKLSLTRALFYIVMQCLGAICGAGVVKGF  154



>gb|EYU32131.1| hypothetical protein MIMGU_mgv1a011344mg [Erythranthe guttata]
Length=285

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 145/162 (90%), Gaps = 1/162 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV+LGANK+SERQ +GT+AQ  KDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVSLGANKYSERQPLGTSAQT-KDYKEPPPAPLFEPGELKSWSFWRAGIAEFVA  59

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV KS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  60   TFLFLYITVLTVMGVSKSPSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  119

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF     Q  G
Sbjct  120  LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPKIYQAMG  161



>emb|CAA70156.1| transmembrane protein [Oryza sativa]
 gb|AAB18817.1| transmembrane protein [Oryza sativa Indica Group]
Length=291

 Score =   277 bits (708),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSERQ IGTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLYITVLTVMGV  S SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYITVLTVMGVNNSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLAR LSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARNLSLTRALFYMVMQCLGAICGAGVVKGF  155



>ref|XP_010533655.1| PREDICTED: aquaporin PIP1-3-like [Tarenaya hassleriana]
Length=286

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGTAAQ  KDY EPP APL E  EL SWSFYRAGIAEFMA
Sbjct  1    MESKEEDVRLGANKFSERQPIGTAAQTGKDYKEPPPAPLIEPSELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV +S S C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQ  547
            L LARKLSLTRAVFYM+MQCLGAICGAGVVKGF E   Q
Sbjct  121  LLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQEGPYQ  159



>ref|XP_010480063.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 ref|XP_010457103.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 ref|XP_010457104.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 ref|XP_010474769.1| PREDICTED: aquaporin PIP1-3 [Camelina sativa]
 gb|KFK42522.1| hypothetical protein AALP_AA1G005400 [Arabis alpina]
Length=286

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF  +  Q  G
Sbjct  121  LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPNPYQTFG  162



>ref|XP_006848145.1| hypothetical protein AMTR_s00029p00227660 [Amborella trichopoda]
 gb|ERN09726.1| hypothetical protein AMTR_s00029p00227660 [Amborella trichopoda]
Length=287

 Score =   276 bits (707),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV LGANK+SERQ IGTAAQ QDKDY EPP APLFE GEL SWSF+RAGIAEF+
Sbjct  1    MEGKEEDVKLGANKYSERQPIGTAAQSQDKDYKEPPPAPLFEPGELQSWSFWRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGV K  + CS+VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVKKETTLCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GL LARKLSLTRAVFYMVMQCLGAICGAGVVKGF +   Q  G
Sbjct  121  GLLLARKLSLTRAVFYMVMQCLGAICGAGVVKGFEKSQYQVHG  163



>ref|XP_009609568.1| PREDICTED: probable aquaporin PIP-type pTOM75 [Nicotiana tomentosiformis]
Length=288

 Score =   276 bits (707),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            E++EEDVNLGANK+ E Q +GTAAQ ++KDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  3    ENKEEDVNLGANKYRETQPLGTAAQTENKDYIEPPPAPLFEPGELSSWSFYRAGIAEFMA  62

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  63   TFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFG  122

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF +   QR G
Sbjct  123  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMKGPYQRLG  164



>ref|XP_006573347.1| PREDICTED: aquaporin PIP1-2-like [Glycine max]
Length=260

 Score =   275 bits (704),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 146/162 (90%), Gaps = 1/162 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GAN++ ERQ IGTAAQ  KDY EPP+APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVRVGANRYGERQPIGTAAQA-KDYREPPSAPLFEAGELSSWSFYRAGIAEFVA  59

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV KS+SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  60   TFLFLYITVLTVMGVAKSKSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  119

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLS+TRA+FY++MQCLGAICGAGVVKGF     +R G
Sbjct  120  LFLARKLSMTRAIFYIIMQCLGAICGAGVVKGFEPHLYERLG  161



>dbj|BAG68659.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=286

 Score =   276 bits (707),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 144/154 (94%), Gaps = 2/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV LGANKF+ERQ IGT+AQ QDKDY+EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MEGKEEDVRLGANKFTERQPIGTSAQTQDKDYTEPPPAPLFEPGELASWSFYRAGIAEFV  60

Query  248  ATFLFLYITVLTVMGVVKSESK-CSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            ATFLFLYIT+LTVMGV KS +K C+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   ATFLFLYITILTVMGVSKSPTKKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKG  526
            FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKG
Sbjct  121  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKG  154



>emb|CDY51161.1| BnaA09g51960D [Brassica napus]
Length=286

 Score =   276 bits (707),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLG  162



>ref|XP_009134562.1| PREDICTED: probable aquaporin PIP1-4 [Brassica rapa]
 emb|CDX74334.1| BnaA03g27130D [Brassica napus]
Length=288

 Score =   276 bits (707),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLG  162



>ref|XP_002526867.1| Aquaporin PIP1.3, putative [Ricinus communis]
 emb|CAE53882.1| aquaporin [Ricinus communis]
 gb|EEF35498.1| Aquaporin PIP1.3, putative [Ricinus communis]
Length=288

 Score =   276 bits (707),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANK+ E Q IGTAAQ   DKDY+EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKYRETQPIGTAAQSQDDKDYTEPPPAPLFEPGELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVK+ +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  155



>gb|ACU87553.1| PIP protein [Gossypium hirsutum]
 gb|ACU87554.1| PIP protein [Gossypium hirsutum]
Length=288

 Score =   276 bits (707),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSERQ IGTAAQ   DKDY+EPP APLFE  EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQSQDDKDYTEPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGV+K ++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISVLTVMGVLKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFL RKLSLTRA++YMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLGRKLSLTRAIYYMVMQCLGAICGAGVVKGF  155



>gb|KDO69067.1| hypothetical protein CISIN_1g018895mg [Citrus sinensis]
Length=272

 Score =   276 bits (705),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF+ERQ IGTAAQ QD KDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVKS +KCSTVGIQGIAWAFGGMIF LVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  LGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  155



>gb|AAL33585.1|AF440271_1 aquaporin [Nicotiana tabacum]
Length=286

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            E++EEDVNLGANK+ E Q +GTAAQ ++KDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  3    ENKEEDVNLGANKYRETQPLGTAAQTENKDYIEPPPAPLFEPGELSSWSFYRAGIAEFMA  62

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  63   TFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFG  122

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF +   QR G
Sbjct  123  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMKGPYQRLG  164



>gb|AAV80228.1| aquaporin 1 [Aegiceras corniculatum]
Length=288

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQ--DKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF+ERQ IGTAAQ   DKDY EPPAAPLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFAERQPIGTAAQGAGDKDYKEPPAAPLFEPGELSSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLYITVLTVMGV +S SKC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYITVLTVMGVSRSGSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGL LARKLSLTRA FYM+MQCLGAICGAGVVKGF
Sbjct  121  FGLLLARKLSLTRAXFYMIMQCLGAICGAGVVKGF  155



>ref|XP_008778916.1| PREDICTED: probable aquaporin PIP1-2 isoform X1 [Phoenix dactylifera]
Length=287

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANKF+ERQ IGTAAQ QDKDY EPP APLFE  EL SWSFYRAGIAEFM
Sbjct  1    MEGKEEDVRVGANKFAERQPIGTAAQTQDKDYKEPPPAPLFELEELWSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGVV+++SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVVQAKSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GL LARKLSLTRA+ YMVMQCLGAICGAGVVKGF
Sbjct  121  GLLLARKLSLTRALLYMVMQCLGAICGAGVVKGF  154



>gb|ACV60508.1| aquaporin [Triticum aestivum]
Length=290

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGAN++SERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANRYSERQPIGTAAQGGGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLY+TVLTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FIATFLFLYVTVLTVMGVSKSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGF  156



>gb|ACL52629.1| unknown [Zea mays]
Length=289

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 142/156 (91%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGANKFSERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGI E
Sbjct  1    MEGKEEDVRLGANKFSERQPIGTAAQGAADDKDYKEPPPAPLFEPGELKSWSFYRAGITE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRALFYIIMQCLGAICGAGVVKGF  156



>gb|ACA50530.1| putative aquaporin [Brassica napus]
Length=286

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME REEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGREEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>gb|AFD32162.1| plasma membrane intrinsic protein [Chrysopogon zizanioides]
Length=288

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME + EDV LGANKFSERQ IGTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKAEDVRLGANKFSERQPIGTAAQGTDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI++LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISILTVMGVSKSNSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGF  155



>ref|XP_010508083.1| PREDICTED: aquaporin PIP1-2-like isoform X1 [Camelina sativa]
Length=286

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S S C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>gb|ABO71659.2| trans-membrane water channel protein [Brassica juncea]
Length=288

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYM+MQCLGAICGAGV+KGF     Q  G
Sbjct  121  LFLARKLSLTRAVFYMIMQCLGAICGAGVIKGFQPTPYQTLG  162



>ref|XP_010506589.1| PREDICTED: aquaporin PIP1-2 [Camelina sativa]
 ref|XP_010518252.1| PREDICTED: aquaporin PIP1-2 isoform X1 [Camelina sativa]
Length=286

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S S C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>ref|XP_010241866.1| PREDICTED: aquaporin PIP1-2 [Nelumbo nucifera]
Length=286

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGTAAQ DKDY EPP APLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTAAQTDKDYKEPPPAPLFEPGELKSWSFWRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV ++ SKC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVGRAPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQ  547
            L LARKLSL RA+FY++MQCLGAICGAGVVKGF     Q
Sbjct  121  LLLARKLSLVRALFYIIMQCLGAICGAGVVKGFQRHQYQ  159



>gb|AAB61378.1| aquaporin [Brassica rapa subsp. oleifera]
 emb|CDX83385.1| BnaA03g21210D [Brassica napus]
Length=286

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S S C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>gb|AEN95117.1| aquaporin PIP1 [Dimocarpus longan]
Length=299

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 142/165 (86%), Gaps = 12/165 (7%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQGDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGH--------  406
            TFLFLYIT+LTVMGV KS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGH        
Sbjct  61   TFLFLYITILTVMGVSKSNSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  407  ----INPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
                INPAVTFGL LARKLSLTRAVFY++MQCLGAICGAGVVKGF
Sbjct  121  LLLAINPAVTFGLLLARKLSLTRAVFYIIMQCLGAICGAGVVKGF  165



>gb|KJB74254.1| hypothetical protein B456_011G283200 [Gossypium raimondii]
Length=288

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF ERQ IGTAAQ   DKDY+EPP APLFE  EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFPERQPIGTAAQSQDDKDYTEPPPAPLFEPSELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVK ++KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISVLTVMGVVKDKTKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFL RKLSLTRA++YMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLGRKLSLTRAIYYMVMQCLGAICGAGVVKGF  155



>gb|ACR56610.1| plasma intrinsic protein 1;1 [Juglans regia]
Length=287

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANK+ ERQ +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKYGERQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFVA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV KS+SKC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVGKSDSKCKSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            L LARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  LLLARKLSLTRALFYIIMQCLGAICGAGVVKGF  153



>emb|CDY48920.1| BnaA09g39170D [Brassica napus]
Length=286

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY+EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S + CS+VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPNMCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRA++Y+VMQCLGAICGAGVVKGF  +  Q  G
Sbjct  121  LFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPNQYQALG  162



>emb|CDX91911.1| BnaC03g32130D [Brassica napus]
Length=288

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYM+MQCLGA+CGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVFYMIMQCLGAVCGAGVVKGFQPTPYQTLG  162



>ref|NP_001078066.1| aquaporin PIP1-2 [Arabidopsis thaliana]
 dbj|BAH19586.1| AT2G45960 [Arabidopsis thaliana]
 gb|AEC10623.1| aquaporin PIP1-2 [Arabidopsis thaliana]
Length=274

 Score =   275 bits (704),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>gb|AEO79975.1| plasma intrinsic protein 1 [Gladiolus communis]
 gb|AFU52635.1| plasma membrane intrinsic protein, partial [Gladiolus hybrid 
cultivar]
Length=288

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 144/164 (88%), Gaps = 2/164 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSE Q IGTAAQ    KDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVKLGANKFSEGQPIGTAAQVSDSKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYIT+LTVMGV KS SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYITILTVMGVSKSPSKCQTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKG+ +   + +G
Sbjct  121  FGLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGYQKGLYETKG  164



>ref|XP_002303596.1| plasma membrane aquaporin family protein [Populus trichocarpa]
 gb|ABK93430.1| unknown [Populus trichocarpa]
 gb|EEE78575.1| plasma membrane aquaporin family protein [Populus trichocarpa]
Length=288

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 144/164 (88%), Gaps = 2/164 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY E P APLFE GEL SWSFYRAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEAPPAPLFEPGELKSWSFYRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKS-ESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            TFLFLYITVLTVMGV K   SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   TFLFLYITVLTVMGVTKPGTSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF-GEDGVQRQG  556
            GLFLARKLSLTRAVFY++MQCLGAICGAGVVKG  G    + QG
Sbjct  121  GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGLQGSHNYELQG  164



>gb|AFM37320.1| aquaporin [Oryza sativa Japonica Group]
Length=289

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGAN++S+RQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANRYSDRQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGF  156



>gb|ABJ98540.1| PIP1 protein [Stipa breviflora]
Length=287

 Score =   275 bits (704),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 139/155 (90%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKFSERQ +GTAAQ   DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFSERQPVGTAAQGSNDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
             ATFLFLYI++LTVMGV  S SKC TVGIQGIAW+FGGMIF LVYCTAGISGGHINPAVT
Sbjct  61   PATFLFLYISILTVMGVSNSSSKCGTVGIQGIAWSFGGMIFVLVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  155



>ref|XP_006396241.1| hypothetical protein EUTSA_v10028860mg [Eutrema salsugineum]
 dbj|BAJ34288.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ37694.1| hypothetical protein EUTSA_v10028860mg [Eutrema salsugineum]
Length=286

 Score =   275 bits (704),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            M+ +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MDGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLG  162



>emb|CDY07221.1| BnaCnng02360D [Brassica napus]
Length=286

 Score =   275 bits (704),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGF  153



>gb|AAS55867.2| aquaporin-like protein [Ipomoea nil]
Length=284

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 144/162 (89%), Gaps = 1/162 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            MEHREEDV LGANKF E+QAIGTAAQ DKDY+E P   LFE  EL SWSFYRAGIAEF+A
Sbjct  1    MEHREEDVRLGANKFPEKQAIGTAAQ-DKDYTEAPPTALFEPSELSSWSFYRAGIAEFIA  59

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV KS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  60   TFLFLYITILTVMGVSKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  119

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARK+SLTR V+Y+VMQCLGAICGAGVVKGFG+     +G
Sbjct  120  LFLARKVSLTRLVYYIVMQCLGAICGAGVVKGFGKTLYNSKG  161



>gb|ABB87103.1| water channel protein-like [Solanum tuberosum]
Length=254

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDVNLGANK+ E Q +GTAAQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVNLGANKYRETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FL LYIT+LTVMG+ +S+S CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  63   FLSLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  123  FLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  154



>emb|CDX95670.1| BnaC03g25510D [Brassica napus]
Length=286

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S S C++VGIQGIAWAFGGMIFALVYCTAG+SGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGVSGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKRYQALG  162



>ref|XP_006435690.1| hypothetical protein CICLE_v10032308mg [Citrus clementina]
 ref|XP_006435691.1| hypothetical protein CICLE_v10032308mg [Citrus clementina]
 ref|XP_006486357.1| PREDICTED: probable aquaporin PIP1-2-like [Citrus sinensis]
 gb|ESR48930.1| hypothetical protein CICLE_v10032308mg [Citrus clementina]
 gb|ESR48931.1| hypothetical protein CICLE_v10032308mg [Citrus clementina]
 gb|KDO69064.1| hypothetical protein CISIN_1g018895mg [Citrus sinensis]
 gb|KDO69065.1| hypothetical protein CISIN_1g018895mg [Citrus sinensis]
 gb|KDO69066.1| hypothetical protein CISIN_1g018895mg [Citrus sinensis]
Length=286

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF+ERQ IGTAAQ QD KDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVKS +KCSTVGIQGIAWAFGGMIF LVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  LGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  155



>gb|KDP44816.1| hypothetical protein JCGZ_01316 [Jatropha curcas]
Length=287

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF E Q IGTAAQ   DKDY+EPP APLFE  EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFRETQPIGTAAQSQDDKDYTEPPPAPLFEPTELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVK+ +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRA++YMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAIYYMVMQCLGAICGAGVVKGF  155



>gb|AEH76327.1| plasma membrane intrinsic protein 1 [Jatropha curcas]
Length=289

 Score =   275 bits (704),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF E Q IGTAAQ   DKDY+EPP APLFE  EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFRETQPIGTAAQSQDDKDYTEPPPAPLFEPTELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVK+ +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYISVLTVMGVVKAPTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRA++YMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAIYYMVMQCLGAICGAGVVKGF  155



>gb|AFQ98315.1| MIP2 [Eutrema halophilum]
Length=284

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            M+ +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MDGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLG  162



>ref|XP_006343971.1| PREDICTED: probable aquaporin PIP-type pTOM75-like [Solanum tuberosum]
Length=286

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  74   EHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
            E++EEDV LGANKF E Q +GT+AQ DKDY EPP APLFE GEL SWSFYRAGIAEFMAT
Sbjct  3    ENKEEDVKLGANKFRETQPLGTSAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMAT  62

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMG+ +S+S CS+VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT GL
Sbjct  63   FLFLYITILTVMGLKRSDSLCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTLGL  122

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FLARKLSLTR+VFY+VMQCLGAICGAGVVKGF     QR G
Sbjct  123  FLARKLSLTRSVFYIVMQCLGAICGAGVVKGFMVGPYQRLG  163



>gb|AGQ21874.1| putative PIP-type aquaporin [Miscanthus sinensis]
Length=288

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGA KFSERQ IGTAAQ  +DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGAYKFSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLY+T+LTVMGV  S SKC++VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYVTILTVMGVNNSPSKCASVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  155



>ref|XP_006294736.1| hypothetical protein CARUB_v10023782mg [Capsella rubella]
 gb|EOA27634.1| hypothetical protein CARUB_v10023782mg [Capsella rubella]
Length=286

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GE+ SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGEIASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S S C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>ref|XP_010518253.1| PREDICTED: aquaporin PIP1-2 isoform X2 [Camelina sativa]
Length=289

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S S C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>gb|AGQ21873.1| putative PIP-type aquaporin [Panicum virgatum]
Length=288

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGA KFSERQ IGTAAQ  +DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGAYKFSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLY+T+LTVMGV  S SKC++VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYVTILTVMGVNNSPSKCASVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  155



>gb|KHG11128.1| putative aquaporin PIP1-2 [Gossypium arboreum]
Length=287

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAA--QQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME + EDV LGANK+ ERQ IGTAA  Q DKDY EPPAAPLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGQYEDVRLGANKYRERQPIGTAAETQDDKDYKEPPAAPLFEPGELSSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYITVLTVMGVVKS  KCSTVG QGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYITVLTVMGVVKSSHKCSTVGFQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FGL LARKLSLTRAVFYM+MQCLGAICGA VVK F +   +R G
Sbjct  121  FGLLLARKLSLTRAVFYMIMQCLGAICGAAVVKSFQKTQYERLG  164



>ref|XP_010508084.1| PREDICTED: aquaporin PIP1-2-like isoform X2 [Camelina sativa]
Length=289

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S S C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPSMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>ref|XP_011092531.1| PREDICTED: probable aquaporin PIP1-5 isoform X1 [Sesamum indicum]
Length=285

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 144/162 (89%), Gaps = 1/162 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKF+ERQ IGT+AQ  KDY E P APLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFTERQPIGTSAQ-SKDYKEAPPAPLFEPGELQSWSFWRAGIAEFMA  59

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV KS SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  60   TFLFLYITILTVMGVSKSGSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  119

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF     Q +G
Sbjct  120  LFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQPSLYQTKG  161



>dbj|BAA92258.1| plasma membrane aquaporin 1b [Raphanus sativus]
 gb|AHV84996.1| aquaporin [Brassica rapa]
 emb|CDX74777.1| BnaA05g05230D [Brassica napus]
Length=286

 Score =   275 bits (702),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>ref|XP_006284249.1| hypothetical protein CARUB_v10005414mg [Capsella rubella]
 gb|EOA17147.1| hypothetical protein CARUB_v10005414mg [Capsella rubella]
Length=287

 Score =   275 bits (702),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDVN+GANKF ERQ IGTAAQ + KDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MEGKEEDVNVGANKFPERQPIGTAAQTESKDYKEPPPAPLFEPGELKSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQSGPYQSNG  163



>ref|XP_008778924.1| PREDICTED: probable aquaporin PIP1-2 isoform X2 [Phoenix dactylifera]
Length=336

 Score =   276 bits (707),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANKF+ERQ IGTAAQ QDKDY EPP APLFE  EL SWSFYRAGIAEFM
Sbjct  1    MEGKEEDVRVGANKFAERQPIGTAAQTQDKDYKEPPPAPLFELEELWSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGVV+++SKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVVQAKSKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GL LARKLSLTRA+ YMVMQCLGAICGAGVVKGF +   +  G
Sbjct  121  GLLLARKLSLTRALLYMVMQCLGAICGAGVVKGFQKGIYESNG  163



>emb|CDX71738.1| BnaC08g31360D [Brassica napus]
Length=286

 Score =   275 bits (702),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY+EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRA++Y+VMQCLGAICGAGVVKGF  +  Q  G
Sbjct  121  LFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPNQYQALG  162



>ref|XP_010262799.1| PREDICTED: probable aquaporin PIP1-2 [Nelumbo nucifera]
Length=286

 Score =   275 bits (702),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANK+SE+Q IGTAAQ  D+DY EPP APLFE GEL SWSFYRAGIAEFM
Sbjct  1    MEGKEEDVRVGANKYSEKQPIGTAAQSDDRDYKEPPPAPLFEPGELSSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGV +S +KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVSRSSNKCATVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GL LARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  GLLLARKLSLTRALFYMVMQCLGAICGAGVVKGF  154



>gb|AAG23179.1|AF299050_1 aquaporin PIP1b1 [Brassica oleracea]
 emb|CDY18886.1| BnaC04g04640D [Brassica napus]
Length=286

 Score =   275 bits (702),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>ref|NP_974489.1| plasma membrane intrinsic protein 1;4 [Arabidopsis thaliana]
 gb|AEE81878.1| plasma membrane intrinsic protein 1;4 [Arabidopsis thaliana]
Length=219

 Score =   272 bits (696),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQ-DKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV +GANKF ERQ IGT+AQ  DKDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRAVFYM+MQCLGAICGAGVVKGF     Q  G
Sbjct  121  GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLG  163



>dbj|BAA32777.1| plasma membrane aquaporin (PAQ1) [Raphanus sativus]
Length=286

 Score =   275 bits (702),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY+EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYNEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRA++Y+VMQCLGAICGAGVVKGF  +  Q  G
Sbjct  121  LFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPNQYQALG  162



>ref|XP_009118823.1| PREDICTED: aquaporin PIP1-3 [Brassica rapa]
Length=286

 Score =   275 bits (702),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELSSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFY+VMQCLGA+CGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVFYIVMQCLGAVCGAGVVKGFQPSPYQTLG  162



>ref|NP_182120.1| aquaporin PIP1-2 [Arabidopsis thaliana]
 ref|XP_006397781.1| hypothetical protein EUTSA_v10001573mg [Eutrema salsugineum]
 sp|Q06611.1|PIP12_ARATH RecName: Full=Aquaporin PIP1-2; Short=AtPIP1;2; AltName: Full=Plasma 
membrane intrinsic protein 1b; Short=PIP1b; AltName: 
Full=Transmembrane protein A; Short=AthH2; Short=TMP-A [Arabidopsis 
thaliana]
 emb|CAA48356.1| transmembrane protein [Arabidopsis thaliana]
 gb|AAC28529.1| aquaporin (plasma membrane intrinsic protein 1B) [Arabidopsis 
thaliana]
 gb|AAK82556.1| At2g45960/F4I18.6 [Arabidopsis thaliana]
 gb|AAL36287.1| putative aquaporin, plasma membrane intrinsic protein 1B [Arabidopsis 
thaliana]
 gb|AAM14193.1| putative aquaporin protein [Arabidopsis thaliana]
 gb|ADJ21813.1| aquaporin [Arabidopsis thaliana]
 gb|AEC10622.1| aquaporin PIP1-2 [Arabidopsis thaliana]
 gb|AFT64208.1| MIP4 [Eutrema halophilum]
 gb|ESQ39234.1| hypothetical protein EUTSA_v10001573mg [Eutrema salsugineum]
Length=286

 Score =   275 bits (702),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>gb|AAV41024.1| plasma membrane intrinsic protein [Glycyrrhiza uralensis]
Length=289

 Score =   275 bits (702),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD--KDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +E+DV+LGANKF ERQ IGTAAQ QD  KDY EPP APLFE  EL SWSFYRAGIAE
Sbjct  1    MEGKEQDVSLGANKFPERQPIGTAAQTQDDGKDYKEPPPAPLFEPNELTSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGV +SESKC +VGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVNRSESKCKSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  156



>gb|KDO69063.1| hypothetical protein CISIN_1g018895mg [Citrus sinensis]
Length=307

 Score =   275 bits (703),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANKF+ERQ IGTAAQ QD KDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI+VLTVMGVVKS +KCSTVGIQGIAWAFGGMIF LVYCTAGISGGHINPAVT
Sbjct  61   IATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
             GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  LGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  155



>ref|XP_010067506.1| PREDICTED: probable aquaporin PIP1-2 [Eucalyptus grandis]
 ref|XP_010067507.1| PREDICTED: probable aquaporin PIP1-2 [Eucalyptus grandis]
 gb|KCW65650.1| hypothetical protein EUGRSUZ_G03037 [Eucalyptus grandis]
Length=287

 Score =   274 bits (701),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 143/158 (91%), Gaps = 2/158 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME REEDV +GANKFSERQ IGTAAQ QD KDY EPP APL E  EL SWSFYRAGIAEF
Sbjct  1    MEGREEDVRVGANKFSERQPIGTAAQTQDGKDYREPPPAPLIEPSELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYITVLTVMGV +S +KC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYITVLTVMGVSRSPTKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVK FG+ 
Sbjct  121  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKAFGKS  158



>gb|ACF39901.1| aquaporin [Camellia oleifera]
 gb|ACF39902.1| aquaporin [Camellia oleifera]
Length=287

 Score =   274 bits (701),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQ-DKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV LGANKF ERQ IGT+AQ  DKDY+EPP APLFE  EL SWSFYRAGIAEFM
Sbjct  1    MEGKEEDVRLGANKFPERQPIGTSAQGGDKDYTEPPPAPLFEPDELTSWSFYRAGIAEFM  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYIT+LTVMGVV S++KCSTVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITILTVMGVVSSKTKCSTVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            GL LARKLSLTRAVFYMVMQCLGAICGA VV+GF
Sbjct  121  GLLLARKLSLTRAVFYMVMQCLGAICGAAVVRGF  154



>ref|XP_010255327.1| PREDICTED: aquaporin PIP1-2-like [Nelumbo nucifera]
Length=286

 Score =   274 bits (701),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ +GTAAQ DKDY EPP APLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVKLGANKFSERQPLGTAAQTDKDYKEPPPAPLFEPGELKSWSFWRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMGV +S +KC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGVGRSGNKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQR  550
            + LARKLSL RAVFY++MQCLGAICGAGVVKGF     +R
Sbjct  121  MLLARKLSLVRAVFYIIMQCLGAICGAGVVKGFQRHEYER  160



>gb|AFB83065.1| plasma intrinsic protein PIP1.1 [Helianthemum almeriense]
Length=290

 Score =   274 bits (701),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 144/157 (92%), Gaps = 4/157 (3%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD---KDYSEPPAAPLFEEGELMSWSFYRAGIA  238
            ME +EEDV LGANK+SERQ +GTAAQ QD   KDYSEPP APLFE  EL SWSFYRAGIA
Sbjct  1    MEGKEEDVRLGANKYSERQPLGTAAQSQDDNGKDYSEPPPAPLFEPSELSSWSFYRAGIA  60

Query  239  EFMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPA  418
            EF+ATFLFLYI+V+TVMGVVK+ SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPA
Sbjct  61   EFIATFLFLYISVMTVMGVVKAPSKCQTVGIQGIAWAFGGMIFALVYCTAGISGGHINPA  120

Query  419  VTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            VTFGLFLARKLSLTRA++YMVMQCLGAICGAGVVKGF
Sbjct  121  VTFGLFLARKLSLTRAIYYMVMQCLGAICGAGVVKGF  157



>dbj|BAA23746.2| HvPIP1;5 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90537.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91636.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   274 bits (701),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ---QDKDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +EEDV LGAN++SERQ IGTAAQ    DKDY EPP APLFE GEL SWSFYRAGIAE
Sbjct  1    MEGKEEDVRLGANRYSERQPIGTAAQGGGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLY+TVLTVMGV K+ SKC+TVG+QGIAW+FGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FIATFLFLYVTVLTVMGVSKAPSKCATVGVQGIAWSFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  TFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGF  156



>ref|XP_004503705.1| PREDICTED: probable aquaporin PIP1-2-like [Cicer arietinum]
Length=286

 Score =   274 bits (701),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  80   REEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMATFL  259
            +EEDV +GA+KFSERQA+GTAAQ DKDY E PAAPLFE GEL SWSFYRAGIAEF+ATFL
Sbjct  3    KEEDVKVGASKFSERQALGTAAQNDKDYKEVPAAPLFEPGELKSWSFYRAGIAEFIATFL  62

Query  260  FLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFL  439
            FLYIT+LTVMGV +S SKCS+VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTFGLFL
Sbjct  63   FLYITILTVMGVNRSTSKCSSVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLFL  122

Query  440  ARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            ARKLSLTRA+FY+VMQCLGAICGAGVVKGF
Sbjct  123  ARKLSLTRAIFYIVMQCLGAICGAGVVKGF  152



>ref|XP_006413559.1| hypothetical protein EUTSA_v10025910mg [Eutrema salsugineum]
 gb|ESQ55012.1| hypothetical protein EUTSA_v10025910mg [Eutrema salsugineum]
Length=287

 Score =   274 bits (701),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDVN+GANKF ERQ IGTAAQ + KDY EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MEGKEEDVNVGANKFPERQPIGTAAQTESKDYQEPPPAPLFEPGELKSWSFYRAGIAEFI  60

Query  248  ATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  427
            ATFLFLYITVLTVMGV ++ + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF
Sbjct  61   ATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF  120

Query  428  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            GLFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQSGPYQANG  163



>dbj|BAD90696.1| plasma membrane intrinsic protein 1;1 [Mimosa pudica]
Length=289

 Score =   274 bits (701),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD--KDYSEPPAAPLFEEGELMSWSFYRAGIAE  241
            ME +E+DV+LGANKF ERQ IGTAAQ QD  KDY EPP APLFE  EL SWSFYRAGIAE
Sbjct  1    MEGKEQDVSLGANKFPERQPIGTAAQSQDDGKDYQEPPPAPLFEPSELTSWSFYRAGIAE  60

Query  242  FMATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  421
            F+ATFLFLYIT+LTVMGVVKS+SKC TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV
Sbjct  61   FVATFLFLYITILTVMGVVKSDSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV  120

Query  422  TFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            TFGLFL RKLSLTRA+FY+VMQCLGAICGAGVVKGF
Sbjct  121  TFGLFLGRKLSLTRAIFYIVMQCLGAICGAGVVKGF  156



>ref|XP_009783438.1| PREDICTED: aquaporin PIP1-1-like [Nicotiana sylvestris]
Length=178

 Score =   270 bits (690),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME++EEDV LGANK+SERQAIGTAAQ DKDY+EPP APLFE GEL SWSFYRAGIAEFMA
Sbjct  1    MENKEEDVRLGANKYSERQAIGTAAQSDKDYTEPPPAPLFEAGELTSWSFYRAGIAEFMA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
             FLFLYIT+LTVMGV KSESK STVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   IFLFLYITILTVMGVSKSESKFSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGA  499
            LFLARKLSLTRAVFYMVMQCLGA
Sbjct  121  LFLARKLSLTRAVFYMVMQCLGA  143



>gb|AFH36341.1| aquaporin PIP1;3 [Quercus petraea]
Length=286

 Score =   274 bits (700),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV LGANKFSERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVKLGANKFSERQPIGTSAQTDKDYKEPPPAPLFEPGELHSWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYIT+LTVMG  ++ +KC++VG QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITILTVMGYSRTTNKCASVGAQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF
Sbjct  121  LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGF  153



>ref|XP_004954451.1| PREDICTED: aquaporin PIP1-5-like [Setaria italica]
 gb|AET81042.1| plasma membrane intrinsic protein 1 [Setaria italica]
Length=288

 Score =   274 bits (701),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGAN++SERQ IGTAAQ   DKDY EPP APLFE  EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANRYSERQPIGTAAQGSDDKDYKEPPPAPLFEAEELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI++LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISILTVMGVSKSPSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF  155



>ref|XP_009629839.1| PREDICTED: probable aquaporin PIP1-5 isoform X1 [Nicotiana tomentosiformis]
Length=285

 Score =   274 bits (700),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 145/162 (90%), Gaps = 1/162 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANK+SERQ +GT+AQ  KDY EPPAAPLFE GEL SWSF+RAGIAEFMA
Sbjct  1    MEGKEEDVKVGANKYSERQPLGTSAQ-SKDYKEPPAAPLFEPGELHSWSFWRAGIAEFMA  59

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMG  ++ SKCSTVG+QGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  60   TFLFLYITVLTVMGYSRANSKCSTVGVQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  119

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAVFY+VMQCLGAICGAGVVKGF     Q +G
Sbjct  120  LFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPSLYQVKG  161



>gb|ACR56612.1| plasma intrinsic protein 1;3 [Juglans regia]
Length=285

 Score =   274 bits (700),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME ++EDV LGAN++ ERQ IGT AQ QD KDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKDEDVRLGANRYRERQPIGTTAQSQDVKDYQEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYITVLTVMGV +S SKCS+VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYITVLTVMGVARSPSKCSSVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF +   +R G
Sbjct  121  FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQKTQYERLG  164



>gb|ACZ51371.1| plasma membrane intrinsic protein [Triticum aestivum]
 gb|AEG80463.1| plasma membrane intrinsic protein [Leymus chinensis]
Length=288

 Score =   274 bits (700),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANK+SERQ IGTAAQ  +DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKYSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLY+T+LTVMG   + SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYVTILTVMGYSGATSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGF  155



>ref|XP_003532817.1| PREDICTED: probable aquaporin PIP1-2 [Glycine max]
 gb|KHN16814.1| Putative aquaporin PIP1-2 [Glycine soja]
Length=289

 Score =   274 bits (700),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQ--DKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDVN+GANKFSERQ IGTAAQ   DKDY E P APLFE GEL SWSFYRAGIAEF
Sbjct  1    MESKEEDVNVGANKFSERQPIGTAAQGGGDKDYKEAPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYIT+LTVMGV +S SKC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYITILTVMGVNRSPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRALFYIIMQCLGAICGAGVVKGF  155



>dbj|BAF41978.1| aquaporin [Hordeum vulgare]
Length=288

 Score =   274 bits (700),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANK+SERQ IGTAAQ  +DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKYSERQPIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLY+T+LTVMG   + SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYVTILTVMGYSGAASKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGF  155



>dbj|BAG68660.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   274 bits (700),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ-QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFM  247
            ME +EEDV+LGANKF+E Q +GTAAQ  DKDY+EPP APLFE GEL SWSFYRAGIAEF+
Sbjct  1    MEGKEEDVSLGANKFTEHQPLGTAAQTHDKDYTEPPPAPLFEPGELASWSFYRAGIAEFV  60

Query  248  ATFLFLYITVLTVMGVVKSES-KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            ATFLFLYIT+LTVMGV KS + KC+TVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   ATFLFLYITILTVMGVSKSPTNKCTTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFYM+MQCLGAICGAGVVKG+
Sbjct  121  FGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGY  155



>ref|NP_001105131.1| aquaporin PIP1-5 [Zea mays]
 sp|Q9AR14.1|PIP15_MAIZE RecName: Full=Aquaporin PIP1-5; AltName: Full=Plasma membrane 
intrinsic protein 1-5; AltName: Full=ZmPIP1-5; AltName: Full=ZmPIP1-5b; 
AltName: Full=ZmPIP1;5 [Zea mays]
 emb|CAC33802.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAK26756.1| plasma membrane integral protein ZmPIP1-5 [Zea mays]
 gb|ACF78166.1| unknown [Zea mays]
 gb|ACR34169.1| unknown [Zea mays]
 gb|AFW63933.1| plasma membrane intrinsic protein1 [Zea mays]
Length=288

 Score =   274 bits (700),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 144/157 (92%), Gaps = 2/157 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGAN++SERQ IGTAAQ  ++KDY EPP APLFE  EL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANRYSERQPIGTAAQGTEEKDYKEPPPAPLFEAEELTSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYI++LTVMGV KS SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYISILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGE  535
            FGLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGF E
Sbjct  121  FGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQE  157



>gb|ACU24274.1| unknown [Glycine max]
Length=289

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQ--DKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDVN+GANKFSERQ IGTAAQ   DKDY E P APLFE GEL SWSFYRAGIAEF
Sbjct  1    MESKEEDVNVGANKFSERQPIGTAAQGGGDKDYKEAPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYIT+LTVMGV +S SKC++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYITILTVMGVNRSPSKCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRALFYIIMQCLGAICGAGVVKGF  155



>emb|CAA64895.1| transmembrane channel protein [Brassica oleracea]
Length=286

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GEL SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLS+TRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSMTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>ref|XP_002880210.1| hypothetical protein ARALYDRAFT_483737 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56469.1| hypothetical protein ARALYDRAFT_483737 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQDKDYSEPPAAPLFEEGELMSWSFYRAGIAEFMA  250
            ME +EEDV +GANKF ERQ IGT+AQ DKDY EPP APLFE GE+ SWSF+RAGIAEF+A
Sbjct  1    MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGEIASWSFWRAGIAEFIA  60

Query  251  TFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  430
            TFLFLYITVLTVMGV +S + C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG
Sbjct  61   TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG  120

Query  431  LFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGEDGVQRQG  556
            LFLARKLSLTRAV+Y+VMQCLGAICGAGVVKGF     Q  G
Sbjct  121  LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALG  162



>emb|CAA54233.1| transmembrane protein [Hordeum vulgare subsp. vulgare]
Length=288

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQ--QDKDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME +EEDV LGANK+SER AIGTAAQ  +DKDY EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGKEEDVRLGANKYSERHAIGTAAQGSEDKDYKEPPPAPLFEPGELKSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            MATFLFLY+T+LTVMG   + SKC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   MATFLFLYVTILTVMGYSGAASKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FGLFLARKLSLTRAVFY++MQCLGAICGAGVVKGF
Sbjct  121  FGLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGF  155



>ref|XP_011047429.1| PREDICTED: probable aquaporin PIP1-4 [Populus euphratica]
Length=287

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = +2

Query  71   MEHREEDVNLGANKFSERQAIGTAAQQD--KDYSEPPAAPLFEEGELMSWSFYRAGIAEF  244
            ME REEDV +GANK+ ERQ IGTAAQ    KDY+EPP APLFE GEL SWSFYRAGIAEF
Sbjct  1    MEGREEDVRVGANKYGERQPIGTAAQARDVKDYTEPPPAPLFEPGELSSWSFYRAGIAEF  60

Query  245  MATFLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  424
            +ATFLFLYITVLTVMGV KS +KCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT
Sbjct  61   VATFLFLYITVLTVMGVAKSATKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT  120

Query  425  FGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGED  538
            FGL LARKLSLTRAVFYM+MQCLGAICGAGVVK F ++
Sbjct  121  FGLLLARKLSLTRAVFYMIMQCLGAICGAGVVKAFQKN  158



>gb|KEH21073.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=235

 Score =   272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 141/152 (93%), Gaps = 1/152 (1%)
 Frame = +2

Query  77   HREEDVNLGANKFSERQAIGTAAQQD-KDYSEPPAAPLFEEGELMSWSFYRAGIAEFMAT  253
             +EEDV +GANKFSERQ +GTAAQ D KDY EPP APLFE GEL SWSFYRAGIAEF+AT
Sbjct  2    EKEEDVKVGANKFSERQPLGTAAQSDSKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVAT  61

Query  254  FLFLYITVLTVMGVVKSESKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL  433
            FLFLYIT+LTVMGV +S SKCS+VGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTFGL
Sbjct  62   FLFLYITILTVMGVNRSTSKCSSVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGL  121

Query  434  FLARKLSLTRAVFYMVMQCLGAICGAGVVKGF  529
            FLARKLSLTRA+FY+VMQCLGAICGAGVVKGF
Sbjct  122  FLARKLSLTRAIFYIVMQCLGAICGAGVVKGF  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920