BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G13

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAN07899.1|  20S proteasome alpha 6 subunit                          380   2e-130   Nicotiana benthamiana
ref|XP_009771200.1|  PREDICTED: proteasome subunit alpha type-1-B...    380   2e-130   Nicotiana sylvestris
ref|XP_009614945.1|  PREDICTED: proteasome subunit alpha type-1-B...    380   2e-130   Nicotiana tomentosiformis
ref|XP_006341960.1|  PREDICTED: proteasome subunit alpha type-1-B...    375   1e-128   Solanum tuberosum [potatoes]
ref|XP_009611760.1|  PREDICTED: proteasome subunit alpha type-1-A...    375   2e-128   Nicotiana tomentosiformis
ref|XP_004238282.1|  PREDICTED: proteasome subunit alpha type-1-A       375   2e-128   Solanum lycopersicum
gb|ABK92956.1|  unknown                                                 374   3e-128   Populus trichocarpa [western balsam poplar]
ref|XP_002300761.2|  hypothetical protein POPTR_0002s03530g             374   5e-128   Populus trichocarpa [western balsam poplar]
gb|KHG20880.1|  Proteasome subunit alpha type-1-B -like protein         374   8e-128   Gossypium arboreum [tree cotton]
ref|XP_007223366.1|  hypothetical protein PRUPE_ppa007472mg             376   2e-127   
ref|XP_011028865.1|  PREDICTED: proteasome subunit alpha type-1-A...    373   2e-127   Populus euphratica
gb|EYU32910.1|  hypothetical protein MIMGU_mgv1a009555mg                375   2e-127   Erythranthe guttata [common monkey flower]
ref|XP_011028867.1|  PREDICTED: proteasome subunit alpha type-1-A...    372   2e-127   Populus euphratica
ref|XP_002510414.1|  proteasome subunit alpha type, putative            373   2e-127   Ricinus communis
ref|XP_011028868.1|  PREDICTED: proteasome subunit alpha type-1-B...    372   2e-127   Populus euphratica
gb|KJB59788.1|  hypothetical protein B456_009G272200                    372   3e-127   Gossypium raimondii
gb|KDP38529.1|  hypothetical protein JCGZ_04454                         372   4e-127   Jatropha curcas
ref|XP_009336153.1|  PREDICTED: proteasome subunit alpha type-1-A...    370   4e-127   
gb|KJB63635.1|  hypothetical protein B456_010G009100                    372   5e-127   Gossypium raimondii
ref|XP_004291861.1|  PREDICTED: proteasome subunit alpha type-1-A...    371   1e-126   Fragaria vesca subsp. vesca
ref|XP_002307665.2|  hypothetical protein POPTR_0005s25080g             371   1e-126   Populus trichocarpa [western balsam poplar]
ref|XP_011007459.1|  PREDICTED: proteasome subunit alpha type-1-B       371   1e-126   Populus euphratica
ref|XP_004152689.1|  PREDICTED: proteasome subunit alpha type-1-A...    371   1e-126   Cucumis sativus [cucumbers]
ref|XP_009336144.1|  PREDICTED: proteasome subunit alpha type-1-A...    371   1e-126   Pyrus x bretschneideri [bai li]
ref|XP_011083661.1|  PREDICTED: proteasome subunit alpha type-1-B       370   1e-126   Sesamum indicum [beniseed]
emb|CAN79638.1|  hypothetical protein VITISV_014475                     370   1e-126   Vitis vinifera
ref|XP_008444739.1|  PREDICTED: proteasome subunit alpha type-1-B...    370   1e-126   Cucumis melo [Oriental melon]
ref|XP_007160738.1|  hypothetical protein PHAVU_001G013000g             370   1e-126   Phaseolus vulgaris [French bean]
ref|XP_008220829.1|  PREDICTED: proteasome subunit alpha type-1-A       370   1e-126   Prunus mume [ume]
ref|XP_008388039.1|  PREDICTED: proteasome subunit alpha type-1-A...    370   2e-126   Malus domestica [apple tree]
ref|XP_002281948.1|  PREDICTED: proteasome subunit alpha type-1-B       370   2e-126   Vitis vinifera
gb|KHG18625.1|  Proteasome subunit alpha type-1-A -like protein         370   2e-126   Gossypium arboreum [tree cotton]
ref|XP_009365059.1|  PREDICTED: proteasome subunit alpha type-1-A...    370   2e-126   
gb|AGJ26431.1|  hypothetical protein                                    370   2e-126   Salicornia brachiata
ref|XP_003544399.1|  PREDICTED: proteasome subunit alpha type-1-B...    370   3e-126   Glycine max [soybeans]
ref|XP_003550390.1|  PREDICTED: proteasome subunit alpha type-1-A...    370   3e-126   Glycine max [soybeans]
ref|XP_003534072.1|  PREDICTED: proteasome subunit alpha type-1-B...    370   3e-126   Glycine max [soybeans]
gb|KHM99758.1|  Proteasome subunit alpha type-1-A                       370   3e-126   Glycine soja [wild soybean]
ref|XP_006473530.1|  PREDICTED: proteasome subunit alpha type-1-B...    369   4e-126   Citrus sinensis [apfelsine]
ref|XP_006435026.1|  hypothetical protein CICLE_v10002110mg             369   4e-126   Citrus clementina [clementine]
gb|KDO84609.1|  hypothetical protein CISIN_1g023620mg                   369   4e-126   Citrus sinensis [apfelsine]
ref|XP_009792806.1|  PREDICTED: proteasome subunit alpha type-1-A...    369   4e-126   Nicotiana sylvestris
gb|KHN20966.1|  Proteasome subunit alpha type-1-A                       370   4e-126   Glycine soja [wild soybean]
ref|XP_006342581.1|  PREDICTED: proteasome subunit alpha type-1-A...    369   4e-126   Solanum tuberosum [potatoes]
ref|XP_011074557.1|  PREDICTED: proteasome subunit alpha type-1-A...    369   4e-126   Sesamum indicum [beniseed]
ref|XP_004499172.1|  PREDICTED: proteasome subunit alpha type-1-B...    369   4e-126   Cicer arietinum [garbanzo]
ref|XP_010263616.1|  PREDICTED: proteasome subunit alpha type-1-B...    368   7e-126   Nelumbo nucifera [Indian lotus]
gb|ACJ84423.1|  unknown                                                 366   1e-125   Medicago truncatula
ref|XP_010254783.1|  PREDICTED: proteasome subunit alpha type-1-B       367   1e-125   Nelumbo nucifera [Indian lotus]
ref|XP_010060968.1|  PREDICTED: proteasome subunit alpha type-1-A...    367   2e-125   Eucalyptus grandis [rose gum]
ref|XP_007150857.1|  hypothetical protein PHAVU_004G000100g             367   2e-125   Phaseolus vulgaris [French bean]
ref|XP_010102069.1|  Proteasome subunit alpha type-1-B                  367   2e-125   Morus notabilis
ref|XP_009365533.1|  PREDICTED: proteasome subunit alpha type-1-A...    367   2e-125   Pyrus x bretschneideri [bai li]
gb|EPS65575.1|  proteasome subunit alpha type                           367   3e-125   Genlisea aurea
gb|KJB14263.1|  hypothetical protein B456_002G126700                    367   4e-125   Gossypium raimondii
gb|AFK42936.1|  unknown                                                 367   4e-125   Medicago truncatula
gb|AFK33498.1|  unknown                                                 367   6e-125   Medicago truncatula
ref|XP_010684086.1|  PREDICTED: proteasome subunit alpha type-1-A...    366   9e-125   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010538098.1|  PREDICTED: proteasome subunit alpha type-1-A       362   3e-123   Tarenaya hassleriana [spider flower]
ref|XP_010523602.1|  PREDICTED: proteasome subunit alpha type-1-B...    361   7e-123   Tarenaya hassleriana [spider flower]
gb|KFK31814.1|  hypothetical protein AALP_AA6G162100                    360   2e-122   Arabis alpina [alpine rockcress]
ref|XP_009123698.1|  PREDICTED: proteasome subunit alpha type-1-A...    360   2e-122   Brassica rapa
emb|CDX95156.1|  BnaC09g17140D                                          359   3e-122   
ref|XP_006280673.1|  hypothetical protein CARUB_v10026636mg             362   4e-122   
ref|XP_009114036.1|  PREDICTED: proteasome subunit alpha type-1-A       359   4e-122   Brassica rapa
emb|CDY52371.1|  BnaA09g15700D                                          359   4e-122   Brassica napus [oilseed rape]
ref|XP_006403347.1|  hypothetical protein EUTSA_v10003255mg             359   4e-122   Eutrema salsugineum [saltwater cress]
emb|CDX71518.1|  BnaC04g17530D                                          358   7e-122   
ref|XP_007017581.1|  20S proteasome alpha subunit F2                    359   8e-122   
ref|XP_006303756.1|  hypothetical protein CARUB_v10011928mg             358   9e-122   Capsella rubella
ref|XP_002891341.1|  hypothetical protein ARALYDRAFT_473874             358   1e-121   
ref|XP_002863736.1|  20S proteasome subunit PAF1                        358   1e-121   Arabidopsis lyrata subsp. lyrata
gb|AFK49441.1|  unknown                                                 353   1e-121   Lotus japonicus
ref|XP_010481942.1|  PREDICTED: proteasome subunit alpha type-1-A       358   1e-121   Camelina sativa [gold-of-pleasure]
gb|AAC32062.1|  20S proteasome subunit PAF1                             358   1e-121   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61575.1|  20S proteasome subunit PAF1                             358   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494236.1|  PREDICTED: proteasome subunit alpha type-1-A...    357   1e-121   Camelina sativa [gold-of-pleasure]
ref|XP_010442116.1|  PREDICTED: proteasome subunit alpha type-1-A...    357   2e-121   Camelina sativa [gold-of-pleasure]
ref|NP_199093.1|  proteasome alpha subunit F1                           357   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175158.1|  20S proteasome alpha subunit F2                       357   3e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008364990.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    356   9e-121   
ref|XP_009107431.1|  PREDICTED: proteasome subunit alpha type-1-B       355   1e-120   Brassica rapa
ref|XP_006435025.1|  hypothetical protein CICLE_v10002110mg             354   3e-120   
ref|XP_006393606.1|  hypothetical protein EUTSA_v10011712mg             354   3e-120   Eutrema salsugineum [saltwater cress]
ref|XP_010461521.1|  PREDICTED: proteasome subunit alpha type-1-B...    354   3e-120   Camelina sativa [gold-of-pleasure]
gb|KFK36156.1|  hypothetical protein AALP_AA4G085300                    353   5e-120   Arabis alpina [alpine rockcress]
ref|XP_010500246.1|  PREDICTED: proteasome subunit alpha type-1-B...    353   5e-120   
ref|XP_010500244.1|  PREDICTED: proteasome subunit alpha type-1-B...    353   6e-120   Camelina sativa [gold-of-pleasure]
ref|XP_010500245.1|  PREDICTED: proteasome subunit alpha type-1-B...    353   6e-120   
emb|CDY17035.1|  BnaA08g03990D                                          350   9e-119   Brassica napus [oilseed rape]
ref|XP_010940099.1|  PREDICTED: proteasome subunit alpha type-1-like    349   2e-118   Elaeis guineensis
ref|XP_006841541.1|  hypothetical protein AMTR_s00003p00165080          348   3e-118   Amborella trichopoda
emb|CDY47593.1|  BnaC08g04630D                                          349   3e-118   Brassica napus [oilseed rape]
ref|XP_009403902.1|  PREDICTED: proteasome subunit alpha type-1-like    349   5e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784923.1|  PREDICTED: proteasome subunit alpha type-1-like    348   6e-118   Phoenix dactylifera
ref|XP_010906336.1|  PREDICTED: proteasome subunit alpha type-1-like    347   9e-118   Elaeis guineensis
ref|XP_009380372.1|  PREDICTED: proteasome subunit alpha type-1-like    347   2e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001770750.1|  predicted protein                                  345   1e-116   
gb|ABR17415.1|  unknown                                                 343   5e-116   Picea sitchensis
gb|ABR18455.1|  unknown                                                 343   5e-116   Picea sitchensis
ref|XP_001752541.1|  predicted protein                                  339   4e-114   
emb|CAA73625.1|  multicatalytic endopeptidase                           334   1e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CAC43322.1|  putative alpha6 proteasome subunit                     327   4e-111   Nicotiana tabacum [American tobacco]
gb|ABK25101.1|  unknown                                                 330   8e-111   Picea sitchensis
ref|XP_003574154.1|  PREDICTED: proteasome subunit alpha type-1         328   7e-110   Brachypodium distachyon [annual false brome]
dbj|BAJ91315.1|  predicted protein                                      328   1e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001149085.1|  proteasome subunit alpha type 1                    325   8e-109   Zea mays [maize]
ref|NP_001241780.1|  proteasome subunit alpha type 1                    325   9e-109   Zea mays [maize]
ref|XP_004951978.1|  PREDICTED: proteasome subunit alpha type-1-like    324   2e-108   Setaria italica
ref|XP_002451490.1|  hypothetical protein SORBIDRAFT_04g002770          321   3e-107   Sorghum bicolor [broomcorn]
ref|XP_004961454.1|  PREDICTED: proteasome subunit alpha type-1-like    320   5e-107   Setaria italica
ref|XP_002987541.1|  hypothetical protein SELMODRAFT_158876             318   6e-106   Selaginella moellendorffii
ref|NP_001045808.1|  Os02g0133800                                       313   3e-104   
ref|XP_006646843.1|  PREDICTED: proteasome subunit alpha type-1-like    312   7e-104   Oryza brachyantha
ref|XP_002947343.1|  20S proteasome alpha subunit F                     303   5e-100   Volvox carteri f. nagariensis
ref|XP_001691250.1|  20S proteasome alpha subunit F                     300   7e-99    Chlamydomonas reinhardtii
gb|AES86663.2|  20S proteasome subunit alpha type 1                     300   1e-95    Medicago truncatula
ref|XP_011396562.1|  Proteasome subunit alpha type-1-A                  295   3e-91    Auxenochlorella protothecoides
ref|XP_005715759.1|  20S core proteasome subunit alpha 6                278   2e-90    Chondrus crispus [carageen]
ref|XP_005839084.1|  20S proteasome subunit alpha type 1                276   9e-90    Guillardia theta CCMP2712
gb|EMT13225.1|  Proteasome subunit alpha type-1                         275   2e-89    
ref|XP_005646283.1|  20S proteasome alpha subunit F                     273   3e-88    Coccomyxa subellipsoidea C-169
ref|XP_004342791.2|  20S proteasome alpha6 subunit                      273   2e-87    Capsaspora owczarzaki ATCC 30864
ref|XP_003604466.1|  Proteasome subunit alpha type                      283   2e-86    
ref|XP_004367445.1|  20S proteasome alpha subunit F, putative           265   2e-85    Acanthamoeba castellanii str. Neff
ref|XP_789764.2|  PREDICTED: proteasome subunit alpha type-1-like       261   8e-85    
gb|KDR22485.1|  Proteasome subunit alpha type-1                         263   1e-84    Zootermopsis nevadensis
ref|XP_001607375.1|  PREDICTED: proteasome subunit alpha type-1-like    263   2e-84    Nasonia vitripennis
ref|XP_002422679.1|  proteasome subunit alpha type, putative            262   6e-84    Pediculus humanus corporis [human body lice]
ref|XP_009055927.1|  hypothetical protein LOTGIDRAFT_232677             261   2e-83    Lottia gigantea
gb|EFA79106.1|  20S proteasome subunit C2                               260   2e-83    Heterostelium album PN500
ref|XP_002681735.1|  20S proteosome alpha subunit                       258   4e-83    Naegleria gruberi strain NEG-M
ref|XP_008546608.1|  PREDICTED: proteasome subunit alpha type-1         260   4e-83    Microplitis demolitor
ref|XP_011256527.1|  PREDICTED: proteasome subunit alpha type-1         259   5e-83    Camponotus floridanus
gb|ELT94608.1|  hypothetical protein CAPTEDRAFT_178575                  259   5e-83    Capitella teleta
dbj|BAD08003.1|  putative Proteasome subunit alpha type 1               258   5e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011172575.1|  PREDICTED: proteasome subunit alpha type-1-l...    259   7e-83    
dbj|GAM21792.1|  hypothetical protein SAMD00019534_049670               258   7e-83    Acytostelium subglobosum LB1
ref|XP_011344203.1|  PREDICTED: proteasome subunit alpha type-1         259   8e-83    Ooceraea biroi
ref|XP_002370508.1|  proteasome subunit alpha type 1, putative          258   9e-83    Toxoplasma gondii ME49
ref|XP_011172573.1|  PREDICTED: proteasome subunit alpha type-1-l...    259   1e-82    Solenopsis invicta [imported red fire ant]
gb|KDO19917.1|  hypothetical protein SPRG_14825                         258   1e-82    Saprolegnia parasitica CBS 223.65
ref|XP_011056444.1|  PREDICTED: proteasome subunit alpha type-1         258   1e-82    Acromyrmex echinatior
ref|XP_003886399.1|  Proteasome subunit alpha type,related              258   1e-82    Neospora caninum Liverpool
gb|EPR63227.1|  putative proteasome subunit alpha type 1                258   1e-82    Toxoplasma gondii GT1
ref|XP_008887077.1|  proteasome subunit alpha type 1, putative          258   1e-82    
ref|XP_008607531.1|  20S proteasome subunit alpha 6                     258   1e-82    Saprolegnia diclina VS20
ref|XP_004357665.1|  20S proteasome subunit C2                          258   1e-82    Cavenderia fasciculata
ref|XP_006616169.1|  PREDICTED: proteasome subunit alpha type-1-l...    257   4e-82    Apis dorsata [rock honeybee]
ref|XP_966973.1|  PREDICTED: proteasome subunit alpha type-1            257   4e-82    Tribolium castaneum [rust-red flour beetle]
ref|XP_003283237.1|  proteasome subunit alpha type 1                    256   6e-82    Dictyostelium purpureum
ref|XP_006571536.1|  PREDICTED: proteasome subunit alpha type-1-like    257   6e-82    
ref|XP_011137774.1|  PREDICTED: proteasome subunit alpha type-1         256   8e-82    Harpegnathos saltator
ref|XP_003695504.1|  PREDICTED: proteasome subunit alpha type-1-like    256   9e-82    Apis florea [dwarf honeybee]
gb|EGI64149.1|  Proteasome subunit alpha type-1                         256   9e-82    Acromyrmex echinatior
ref|XP_004922650.1|  PREDICTED: proteasome subunit alpha type-1-like    255   2e-81    Bombyx mori [silk moth]
ref|XP_008475286.1|  PREDICTED: proteasome subunit alpha type-1-like    255   3e-81    
ref|XP_011439711.1|  PREDICTED: proteasome subunit alpha type-1-like    255   3e-81    Crassostrea gigas
ref|XP_011311364.1|  PREDICTED: proteasome subunit alpha type-1         255   3e-81    Fopius arisanus
gb|KFM81604.1|  Proteasome subunit alpha type-1                         255   3e-81    Stegodyphus mimosarum
ref|XP_003392942.1|  PREDICTED: proteasome subunit alpha type-1-like    255   3e-81    Bombus terrestris [large earth bumblebee]
ref|XP_005707022.1|  20S proteasome subunit alpha 6                     254   4e-81    Galdieria sulphuraria
ref|XP_001663312.1|  AAEL013089-PA                                      253   5e-81    
ref|XP_640037.1|  20S proteasome subunit C2                             253   7e-81    Dictyostelium discoideum AX4
ref|XP_003489898.1|  PREDICTED: proteasome subunit alpha type-1-like    254   7e-81    
ref|XP_001650228.1|  AAEL015007-PA                                      254   9e-81    Aedes aegypti
gb|EFX71454.1|  hypothetical protein DAPPUDRAFT_308807                  254   1e-80    Daphnia pulex
ref|XP_011498365.1|  PREDICTED: proteasome subunit alpha type-1         254   1e-80    Ceratosolen solmsi marchali
ref|XP_001842520.1|  proteasome subunit alpha type 1                    253   2e-80    Culex quinquefasciatus
dbj|BAM18671.1|  proteasome 35kD subunit                                252   3e-80    Papilio xuthus [Chinese swallowtail]
gb|ACF82642.1|  unknown                                                 251   4e-80    Zea mays [maize]
ref|XP_008485407.1|  PREDICTED: proteasome subunit alpha type-1-like    250   4e-80    
ref|XP_002141867.1|  proteasome subunit alpha type 1                    251   6e-80    Cryptosporidium muris RN66
ref|XP_666272.1|  proteasome A type subunit                             251   8e-80    Cryptosporidium hominis TU502
ref|XP_009026631.1|  hypothetical protein HELRODRAFT_151021             249   9e-80    Helobdella robusta
ref|XP_003606314.1|  Proteasome subunit alpha type                      252   2e-79    
gb|AAC23597.1|  proteasome A type subunit                               249   2e-79    Cryptosporidium parvum
ref|XP_626412.1|  proteasome subunit alpha type 1, NTN hydrolase        250   4e-79    Cryptosporidium parvum Iowa II
ref|XP_003703829.1|  PREDICTED: proteasome subunit alpha type-1-like    249   5e-79    
ref|XP_004168681.1|  PREDICTED: proteasome subunit alpha type-1-B...    244   6e-79    
gb|AES88511.2|  20S proteasome subunit alpha type 1                     251   6e-79    Medicago truncatula
emb|CCA25390.1|  proteasome subunit alpha putative                      248   8e-79    Albugo laibachii Nc14
ref|XP_009519261.1|  hypothetical protein PHYSODRAFT_541580             248   1e-78    Phytophthora sojae
emb|CBN79978.1|  20S proteasome subunit alpha type 1                    248   1e-78    Ectocarpus siliculosus
gb|AEE61485.1|  unknown                                                 248   1e-78    Dendroctonus ponderosae
ref|XP_004711673.1|  PREDICTED: proteasome subunit alpha type-1         249   1e-78    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_011004997.1|  PREDICTED: proteasome subunit alpha type-1-B...    243   1e-78    Populus euphratica
ref|XP_004090717.1|  PREDICTED: proteasome subunit alpha type-1-like    244   2e-78    
ref|NP_001090002.1|  proteasome (prosome, macropain) subunit, alp...    247   2e-78    Xenopus laevis [clawed frog]
ref|XP_007121548.1|  PREDICTED: proteasome subunit alpha type-1 i...    246   3e-78    
ref|XP_319444.3|  AGAP010253-PA                                         247   3e-78    Anopheles gambiae str. PEST
gb|AAH84394.1|  Unknown (protein for MGC:86195)                         246   3e-78    Xenopus laevis [clawed frog]
ref|XP_002901731.1|  proteasome subunit alpha, putative                 246   3e-78    Phytophthora infestans T30-4
ref|XP_003387223.1|  PREDICTED: proteasome subunit alpha type-1-like    247   3e-78    Amphimedon queenslandica
gb|ACI67379.1|  Proteasome subunit alpha type-1                         246   4e-78    Salmo salar
gb|ACO11000.1|  Proteasome subunit alpha type-1                         246   4e-78    Caligus rogercresseyi
ref|XP_001628693.1|  predicted protein                                  245   4e-78    Nematostella vectensis
ref|XP_005099514.1|  PREDICTED: proteasome subunit alpha type-1-l...    247   4e-78    Aplysia californica
ref|XP_004409693.1|  PREDICTED: proteasome subunit alpha type-1-like    246   6e-78    
ref|XP_008891774.1|  hypothetical protein PPTG_02446                    245   7e-78    Phytophthora parasitica INRA-310
ref|XP_005099513.1|  PREDICTED: proteasome subunit alpha type-1-l...    247   7e-78    Aplysia californica
ref|NP_001124812.1|  proteasome subunit alpha type-1                    246   7e-78    Pongo abelii [orang utan]
tpg|DAA34467.1|  TPA: proteasome alpha type 1                           245   8e-78    Amblyomma variegatum
ref|XP_001504993.1|  PREDICTED: proteasome subunit alpha type-1 i...    246   8e-78    Equus caballus [domestic horse]
ref|XP_003225371.1|  PREDICTED: proteasome subunit alpha type-1         246   8e-78    Anolis carolinensis [Carolina anole]
ref|XP_006978682.1|  PREDICTED: proteasome subunit alpha type-1         246   8e-78    Peromyscus maniculatus bairdii
ref|NP_036095.1|  proteasome subunit alpha type-1                       246   8e-78    Mus musculus [mouse]
ref|XP_003781174.1|  PREDICTED: proteasome subunit alpha type-1         246   8e-78    Otolemur garnettii
ref|XP_004279205.1|  PREDICTED: proteasome subunit alpha type-1         246   8e-78    Orcinus orca [Orca]
ref|NP_001279970.1|  proteasome (prosome, macropain) subunit, alp...    246   9e-78    Callorhinchus milii [Australian ghost shark]
gb|AFM85610.1|  proteasome (prosome macropain) subunit alpha type 1     246   9e-78    Callorhinchus milii [Australian ghost shark]
ref|XP_003506454.1|  PREDICTED: proteasome subunit alpha type-1         246   9e-78    Cricetulus griseus [Chinese hamsters]
emb|CCI41834.1|  unnamed protein product                                245   9e-78    Albugo candida
ref|XP_008851742.1|  PREDICTED: proteasome subunit alpha type-1         246   9e-78    Nannospalax galili
ref|XP_007521203.1|  PREDICTED: proteasome subunit alpha type-1         246   9e-78    Erinaceus europaeus [common hedgehog]
ref|NP_001030387.1|  proteasome subunit alpha type-1                    245   1e-77    Bos taurus [bovine]
ref|NP_002777.1|  proteasome subunit alpha type-1 isoform 2             245   1e-77    Homo sapiens [man]
ref|XP_004613637.1|  PREDICTED: proteasome subunit alpha type-1         245   1e-77    Sorex araneus [Eurasian shrew]
ref|XP_004418519.1|  PREDICTED: proteasome subunit alpha type-1 i...    245   1e-77    
ref|XP_010590515.1|  PREDICTED: proteasome subunit alpha type-1         245   1e-77    Loxodonta africana [African bush elephant]
gb|AFM86854.1|  proteasome (prosome macropain) subunit alpha type 1     245   1e-77    Callorhinchus milii [Australian ghost shark]
emb|CDQ77284.1|  unnamed protein product                                246   1e-77    Oncorhynchus mykiss
ref|NP_058974.1|  proteasome subunit alpha type-1                       245   1e-77    Rattus norvegicus [brown rat]
dbj|BAD42872.1|  20S proteasome alpha6 subunit                          245   1e-77    Xenopus laevis [clawed frog]
emb|CAJ81554.1|  proteasome (prosome macropain) subunit alpha type 1    245   1e-77    Xenopus tropicalis [western clawed frog]
ref|XP_002923350.1|  PREDICTED: proteasome subunit alpha type-1         245   1e-77    Ailuropoda melanoleuca
gb|ACH70727.1|  proteasome (prosome, macropain) subunit alpha type 1    245   2e-77    Salmo salar
gb|ACO08743.1|  Proteasome subunit alpha type 1                         245   2e-77    Oncorhynchus mykiss
ref|XP_005309653.1|  PREDICTED: proteasome subunit alpha type-1 i...    244   2e-77    Chrysemys picta bellii
ref|XP_005885948.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    244   2e-77    
gb|AFM87180.1|  proteasome (prosome macropain) subunit alpha type 1     244   2e-77    Callorhinchus milii [Australian ghost shark]
ref|XP_007174951.1|  PREDICTED: proteasome subunit alpha type-1         244   2e-77    Balaenoptera acutorostrata scammoni
gb|ACI67883.1|  Proteasome subunit alpha type-1                         244   2e-77    Salmo salar
gb|ESA05083.1|  hypothetical protein GLOINDRAFT_336022                  244   3e-77    
gb|ETE67788.1|  Proteasome subunit alpha type-1                         246   3e-77    Ophiophagus hannah
ref|XP_005991016.1|  PREDICTED: proteasome subunit alpha type-1-like    244   4e-77    Latimeria chalumnae
emb|CDQ71348.1|  unnamed protein product                                245   4e-77    Oncorhynchus mykiss
gb|AFM87582.1|  proteasome (prosome macropain) subunit alpha type 1     244   4e-77    Callorhinchus milii [Australian ghost shark]
ref|NP_001290578.1|  proteasome (prosome, macropain) subunit, alp...    244   4e-77    Esox lucius
gb|ACO07890.1|  Proteasome subunit alpha type 1                         244   5e-77    Oncorhynchus mykiss
ref|NP_001271999.1|  proteasome subunit alpha type-1                    244   5e-77    Macaca fascicularis [crab eating macaque]
emb|CDQ87916.1|  unnamed protein product                                244   7e-77    Oncorhynchus mykiss
ref|NP_683877.1|  proteasome subunit alpha type-1 isoform 1             243   7e-77    Homo sapiens [man]
ref|XP_005989712.1|  PREDICTED: proteasome subunit alpha type-1 i...    243   7e-77    
ref|XP_001521804.1|  PREDICTED: proteasome subunit alpha type-1         243   7e-77    
ref|XP_005887610.1|  PREDICTED: proteasome subunit alpha type-1 i...    243   7e-77    Bos mutus
ref|XP_005989711.1|  PREDICTED: proteasome subunit alpha type-1 i...    243   8e-77    Latimeria chalumnae
gb|EHB12903.1|  Proteasome subunit alpha type-1                         243   8e-77    Heterocephalus glaber [naked mole rat]
gb|EHH56426.1|  hypothetical protein EGM_05833                          243   8e-77    Macaca fascicularis [crab eating macaque]
gb|EHH23082.1|  hypothetical protein EGK_06468                          243   8e-77    Macaca mulatta [rhesus macaque]
gb|ELR62359.1|  Proteasome subunit alpha type-1                         243   8e-77    Bos mutus
ref|XP_006642657.1|  PREDICTED: proteasome subunit alpha type-1-like    243   8e-77    
gb|ACI67972.1|  Proteasome subunit alpha type-1                         243   9e-77    Salmo salar
ref|XP_004650730.1|  PREDICTED: proteasome subunit alpha type-1         243   1e-76    
ref|XP_008880278.1|  hypothetical protein H310_14245                    242   1e-76    Aphanomyces invadans
gb|ACO08042.1|  Proteasome subunit alpha type 1                         243   1e-76    Oncorhynchus mykiss
ref|XP_005958058.1|  PREDICTED: proteasome subunit alpha type-1         243   1e-76    Pantholops hodgsonii [Tibetan antelope]
gb|AFK10587.1|  proteasome (prosome macropain) subunit alpha type 1     243   1e-76    Callorhinchus milii [Australian ghost shark]
gb|ERE77703.1|  proteasome subunit alpha type-1-like protein            243   1e-76    Cricetulus griseus [Chinese hamsters]
gb|EFB17192.1|  hypothetical protein PANDA_012479                       242   1e-76    Ailuropoda melanoleuca
ref|XP_006126397.1|  PREDICTED: proteasome subunit alpha type-1         243   1e-76    
ref|XP_004485246.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    243   1e-76    Dasypus novemcinctus
ref|XP_006018292.1|  PREDICTED: proteasome subunit alpha type-1         243   1e-76    Alligator sinensis
ref|XP_006892143.1|  PREDICTED: proteasome subunit alpha type-1-like    244   1e-76    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007954983.1|  PREDICTED: proteasome subunit alpha type-1         243   1e-76    Orycteropus afer afer
gb|EAW68477.1|  proteasome (prosome, macropain) subunit, alpha ty...    244   1e-76    Homo sapiens [man]
ref|XP_010789590.1|  PREDICTED: proteasome subunit alpha type-1         240   1e-76    Notothenia coriiceps [yellowbelly rockcod]
ref|NP_001003427.1|  proteasome subunit alpha type-1                    242   2e-76    Danio rerio [leopard danio]
ref|XP_009100488.1|  PREDICTED: proteasome subunit alpha type-1         242   2e-76    Serinus canaria [canary]
ref|XP_005529066.1|  PREDICTED: proteasome subunit alpha type-1         242   2e-76    Pseudopodoces humilis [Tibetan ground-jay]
gb|AAH05932.1|  Proteasome (prosome, macropain) subunit, alpha ty...    242   2e-76    Homo sapiens [man]
ref|XP_005153319.1|  PREDICTED: proteasome subunit alpha type-1         242   2e-76    Melopsittacus undulatus
ref|XP_008149311.1|  PREDICTED: proteasome subunit alpha type-1         243   2e-76    
gb|ACH45264.1|  putative proteasome alpha 1 subunit                     242   2e-76    Taeniopygia guttata
gb|ACI68584.1|  Proteasome subunit alpha type-1                         242   2e-76    Salmo salar
ref|XP_007430978.1|  PREDICTED: proteasome subunit alpha type-1         242   2e-76    Python bivittatus
ref|XP_004369884.1|  PREDICTED: proteasome subunit alpha type-1         243   2e-76    
gb|AAP36756.1|  Homo sapiens proteasome (prosome, macropain) subu...    242   2e-76    synthetic construct
ref|XP_007057194.1|  PREDICTED: proteasome subunit alpha type-1         242   2e-76    
ref|XP_008309749.1|  PREDICTED: proteasome subunit alpha type-1         242   3e-76    
ref|XP_005807498.1|  PREDICTED: proteasome subunit alpha type-1-l...    242   3e-76    
gb|ACI66688.1|  Proteasome subunit alpha type-1                         242   3e-76    
ref|XP_007497103.1|  PREDICTED: proteasome subunit alpha type-1         242   3e-76    
gb|ACI68466.1|  Proteasome subunit alpha type-1                         241   3e-76    
gb|ELK18048.1|  Proteasome subunit alpha type-1                         243   3e-76    
ref|XP_008503046.1|  PREDICTED: proteasome subunit alpha type-1         241   3e-76    
ref|XP_003773626.1|  PREDICTED: proteasome subunit alpha type-1         244   4e-76    
emb|CDQ81279.1|  unnamed protein product                                242   4e-76    
gb|KFP46432.1|  Proteasome subunit alpha type-1                         239   4e-76    
ref|XP_010736965.1|  PREDICTED: proteasome subunit alpha type-1         241   4e-76    
gb|KFQ57172.1|  Proteasome subunit alpha type-1                         241   4e-76    
ref|XP_005633752.1|  PREDICTED: proteasome subunit alpha type-1         244   4e-76    
ref|XP_008292573.1|  PREDICTED: proteasome subunit alpha type-1         241   4e-76    
ref|XP_004050785.1|  PREDICTED: proteasome subunit alpha type-1         245   4e-76    
ref|XP_007241147.1|  PREDICTED: proteasome subunit alpha type-1-like    241   5e-76    
ref|XP_002786174.1|  proteasome A type subunit, putative                241   5e-76    
ref|XP_002778255.1|  proteasome A type subunit, putative                241   6e-76    
ref|XP_002770938.1|  proteasome A type subunit, putative                241   6e-76    
ref|XP_006782433.1|  PREDICTED: proteasome subunit alpha type-1-like    241   7e-76    
gb|AAX61158.1|  proteasome subunit alpha type 1                         238   7e-76    
ref|XP_004564544.1|  PREDICTED: proteasome subunit alpha type-1-l...    241   7e-76    
ref|XP_003455462.1|  PREDICTED: proteasome subunit alpha type-1-like    241   7e-76    
ref|XP_009461426.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    241   9e-76    
gb|KFO04415.1|  Proteasome subunit alpha type-1                         240   9e-76    
ref|XP_004069440.1|  PREDICTED: proteasome subunit alpha type-1         240   1e-75    
gb|KFV86351.1|  Proteasome subunit alpha type-1                         240   1e-75    
ref|XP_002117753.1|  hypothetical protein TRIADDRAFT_33023              239   1e-75    
gb|KFQ73252.1|  Proteasome subunit alpha type-1                         240   1e-75    
gb|ADO28408.1|  proteasome subunit alpha type-1                         240   1e-75    
gb|KFU87106.1|  Proteasome subunit alpha type-1                         240   1e-75    
gb|KFW85667.1|  Proteasome subunit alpha type-1                         240   1e-75    
ref|XP_007566044.1|  PREDICTED: proteasome subunit alpha type-1 i...    242   1e-75    
gb|KFV70849.1|  Proteasome subunit alpha type-1                         240   1e-75    
emb|CEG63970.1|  Putative Proteasome subunit alpha type                 240   1e-75    
ref|XP_004564543.1|  PREDICTED: proteasome subunit alpha type-1-l...    240   2e-75    
gb|KFP93005.1|  Proteasome subunit alpha type-1                         240   2e-75    
gb|ACO08956.1|  Proteasome subunit alpha type 1                         240   2e-75    
gb|KFQ91040.1|  Proteasome subunit alpha type-1                         239   2e-75    
ref|XP_008409105.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    241   2e-75    
ref|XP_010124896.1|  PREDICTED: proteasome subunit alpha type-1         240   2e-75    
ref|XP_010709279.1|  PREDICTED: proteasome subunit alpha type-1         240   2e-75    
gb|KGL98037.1|  Proteasome subunit alpha type-1                         239   2e-75    
ref|XP_008643107.1|  PREDICTED: proteasome subunit alpha type-1         240   2e-75    
ref|XP_010153806.1|  PREDICTED: proteasome subunit alpha type-1         239   2e-75    
ref|XP_005442778.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    239   2e-75    
ref|XP_009683029.1|  PREDICTED: proteasome subunit alpha type-1         240   2e-75    
ref|XP_007566043.1|  PREDICTED: proteasome subunit alpha type-1 i...    242   2e-75    
ref|XP_009845565.1|  hypothetical protein H257_18242                    239   2e-75    
ref|XP_010222013.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    240   2e-75    
ref|XP_008933701.1|  PREDICTED: proteasome subunit alpha type-1         239   2e-75    
ref|XP_009992581.1|  PREDICTED: proteasome subunit alpha type-1         240   2e-75    
ref|XP_009814818.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    239   2e-75    
ref|XP_005807499.1|  PREDICTED: proteasome subunit alpha type-1-l...    240   2e-75    
ref|XP_010290808.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    239   2e-75    
gb|KFO93473.1|  Proteasome subunit alpha type-1                         239   2e-75    
gb|EMC88084.1|  Proteasome subunit alpha type-1                         239   2e-75    
ref|XP_005426382.1|  PREDICTED: proteasome subunit alpha type-1         239   2e-75    
gb|KFQ30693.1|  Proteasome subunit alpha type-1                         239   2e-75    
ref|XP_009933615.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    239   3e-75    
ref|NP_001008159.1|  proteasome (prosome, macropain) subunit, alp...    239   3e-75    
pdb|4R3O|F  Chain F, Human Constitutive 20s Proteasome                  238   4e-75    
ref|XP_004635005.1|  PREDICTED: proteasome subunit alpha type-1         246   4e-75    
ref|XP_005236374.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    240   4e-75    
gb|AAA92734.1|  prosomal protein P30-33K                                239   5e-75    
ref|XP_005188201.1|  PREDICTED: proteasome subunit alpha type-1-like    239   5e-75    
ref|XP_001423772.1|  hypothetical protein                               238   6e-75    
dbj|GAA94266.1|  hypothetical protein E5Q_00915                         239   6e-75    
emb|CDH50792.1|  20s proteasome subunit                                 238   7e-75    
ref|XP_008710197.1|  PREDICTED: proteasome subunit alpha type-1         241   7e-75    
ref|XP_001449467.1|  hypothetical protein                               238   7e-75    
ref|XP_001434755.1|  hypothetical protein                               238   7e-75    
ref|XP_006270649.1|  PREDICTED: proteasome subunit alpha type-1         238   8e-75    
ref|XP_006865888.1|  PREDICTED: proteasome subunit alpha type-1         241   8e-75    
ref|NP_001187433.1|  proteasome subunit alpha type-1                    238   8e-75    
gb|ACH45268.1|  putative proteasome alpha 1 subunit                     238   9e-75    
ref|XP_001452390.1|  hypothetical protein                               237   1e-74    
ref|XP_010335684.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    238   1e-74    
gb|ELW70779.1|  Proteasome subunit alpha type-1                         242   1e-74    
ref|XP_009861883.1|  PREDICTED: proteasome subunit alpha type-1-like    238   1e-74    
emb|CDS11774.1|  hypothetical protein LRAMOSA04037                      238   2e-74    
gb|KFP30532.1|  Proteasome subunit alpha type-1                         237   2e-74    
gb|ACI66511.1|  Proteasome subunit alpha type-1                         237   2e-74    
emb|CAG05614.1|  unnamed protein product                                239   2e-74    
gb|AAR09853.1|  similar to Drosophila melanogaster Pros35               234   3e-74    
ref|XP_007409786.1|  hypothetical protein MELLADRAFT_48314              236   4e-74    
ref|XP_003036867.1|  hypothetical protein SCHCODRAFT_13020              236   4e-74    
ref|XP_010395374.1|  PREDICTED: proteasome subunit alpha type-1         238   4e-74    
gb|KII95950.1|  hypothetical protein PLICRDRAFT_233988                  239   4e-74    
ref|XP_005046777.1|  PREDICTED: proteasome subunit alpha type-1         239   5e-74    
ref|XP_005535632.1|  20S core proteasome subunit alpha 6                236   6e-74    
gb|KIK03786.1|  hypothetical protein K443DRAFT_676446                   236   7e-74    
ref|XP_005486720.1|  PREDICTED: proteasome subunit alpha type-1         238   8e-74    
ref|XP_002036447.1|  GM18005                                            236   9e-74    
ref|XP_002078888.1|  GD23664                                            236   1e-73    
gb|KIM83870.1|  hypothetical protein PILCRDRAFT_818878                  235   1e-73    
ref|XP_007846912.1|  proteasome subunit alpha type 1                    235   2e-73    
ref|XP_006957221.1|  20S proteasome subunit                             235   2e-73    
ref|XP_002014358.1|  GL18993                                            235   2e-73    
ref|XP_002291026.1|  20S proteasome subunit alpha type 1                235   2e-73    
gb|KIK65580.1|  hypothetical protein GYMLUDRAFT_56267                   234   2e-73    
gb|EJT97699.1|  N-terminal nucleophile aminohydrolase                   236   2e-73    
ref|XP_001878192.1|  20S proteasome subunit                             235   2e-73    
ref|XP_002074550.1|  GK23128                                            234   2e-73    
gb|EWM22408.1|  proteasome subunit alpha                                238   2e-73    
gb|KDQ06250.1|  hypothetical protein BOTBODRAFT_60704                   234   3e-73    
gb|EMD41011.1|  20S proteasome subunit                                  235   3e-73    
ref|NP_001280325.1|  proteasome subunit alpha type-1                    234   3e-73    
ref|XP_007315328.1|  hypothetical protein SERLADRAFT_460292             234   3e-73    
gb|KJA24584.1|  hypothetical protein HYPSUDRAFT_1075004                 234   3e-73    
ref|XP_002156031.2|  PREDICTED: proteasome subunit alpha type-1-like    234   4e-73    
gb|AAL48800.1|  RE23081p                                                234   4e-73    
ref|NP_523532.1|  proteasome alpha6 subunit, isoform A                  234   4e-73    
dbj|GAA30927.1|  proteasome subunit alpha type-1                        234   4e-73    
ref|XP_005499423.1|  PREDICTED: proteasome subunit alpha type-1         234   5e-73    
gb|KIJ70431.1|  hypothetical protein HYDPIDRAFT_172251                  234   5e-73    
gb|KIY45873.1|  20S proteasome subunit                                  234   5e-73    
emb|CDO74103.1|  hypothetical protein BN946_scf185043.g153              234   6e-73    
emb|CDI77650.1|  proteasome subunit alpha type 1, putative              233   7e-73    
gb|KIK42971.1|  hypothetical protein CY34DRAFT_804288                   233   7e-73    
ref|XP_007382339.1|  20S proteasome subunit                             233   7e-73    
gb|KIM26328.1|  hypothetical protein M408DRAFT_330683                   233   8e-73    
ref|XP_003967825.1|  PREDICTED: proteasome subunit alpha type-1-like    236   1e-72    
emb|CDJ70100.1|  proteasome subunit alpha type 1, putative              233   1e-72    
ref|XP_003336867.2|  20S proteasome subunit alpha 6                     232   1e-72    
gb|KIM45898.1|  hypothetical protein M413DRAFT_440949                   233   1e-72    
gb|KFP85061.1|  Proteasome subunit alpha type-1                         232   1e-72    
gb|KIK21757.1|  hypothetical protein PISMIDRAFT_681029                  233   1e-72    
ref|XP_002089046.1|  Pros35                                             233   2e-72    
dbj|GAN10049.1|  proteasome subunit alpha type 1                        233   2e-72    
gb|KDE02680.1|  20S proteasome subunit alpha 6                          234   2e-72    
gb|EPB91326.1|  20S proteasome subunit alpha 6                          232   3e-72    
gb|KIK99693.1|  hypothetical protein PAXRUDRAFT_822463                  232   3e-72    
ref|XP_001969415.1|  GG10092                                            232   3e-72    
ref|XP_003639437.1|  PREDICTED: proteasome subunit alpha type-1-like    231   3e-72    
emb|CDJ56165.1|  proteasome subunit alpha type 1, putative              231   4e-72    
ref|XP_007303004.1|  20S proteasome subunit                             231   4e-72    
ref|XP_007364373.1|  20S proteasome subunit                             232   4e-72    
ref|XP_009077615.1|  PREDICTED: proteasome subunit alpha type-1         230   4e-72    
ref|XP_003738557.1|  PREDICTED: proteasome subunit alpha type-1-like    231   5e-72    
ref|XP_006459974.1|  20S proteasome subunit                             231   7e-72    
ref|XP_009038251.1|  hypothetical protein AURANDRAFT_37911              230   9e-72    
gb|KIP09865.1|  hypothetical protein PHLGIDRAFT_102207                  231   9e-72    
gb|KDQ29046.1|  hypothetical protein PLEOSDRAFT_185889                  230   1e-71    
ref|XP_001963056.1|  GF15751                                            231   1e-71    
emb|CDJ43273.1|  proteasome subunit alpha type 1, putative              230   1e-71    
ref|XP_004403356.1|  PREDICTED: proteasome subunit alpha type-1-like    229   1e-71    
ref|XP_007862485.1|  20S proteasome subunit                             230   1e-71    
ref|XP_001734914.1|  proteasome subunit alpha type-1                    229   2e-71    
ref|XP_011186568.1|  PREDICTED: proteasome subunit alpha type-1-like    230   2e-71    
ref|XP_004994983.1|  proteasome subunit alpha type-1                    229   2e-71    
gb|EMS23668.1|  20S proteasome subunit alpha 6                          231   2e-71    
ref|XP_008034920.1|  20S proteasome subunit                             230   2e-71    
emb|CAX70624.1|  20S proteasome subunit alpha 6                         229   2e-71    
gb|KIN95675.1|  hypothetical protein M404DRAFT_165102                   229   2e-71    
emb|CEP19002.1|  hypothetical protein                                   231   2e-71    
ref|XP_011214007.1|  PREDICTED: proteasome subunit alpha type-1         230   2e-71    
ref|XP_009544143.1|  threonine protease                                 229   3e-71    
ref|XP_004522773.1|  PREDICTED: proteasome subunit alpha type-1-like    229   3e-71    
ref|XP_009310379.1|  putative proteasome alpha 1 subunit                228   5e-71    
emb|CCA71800.1|  probable PRE5-20S proteasome subunit (alpha6)          229   5e-71    
ref|XP_002060108.1|  GJ15428                                            229   5e-71    
ref|XP_653086.1|  proteasome alpha subunit                              228   5e-71    
emb|CDI82589.1|  proteasome subunit alpha type 1, putative              232   5e-71    
gb|KIM67779.1|  hypothetical protein SCLCIDRAFT_1070138                 228   5e-71    
emb|CDY21248.1|  BnaC02g28750D                                          224   6e-71    
emb|CAX70627.1|  20S proteasome subunit alpha 6                         228   6e-71    
dbj|BAC40496.1|  unnamed protein product                                228   6e-71    
ref|XP_008779409.1|  PREDICTED: proteasome subunit alpha type-1-B...    224   7e-71    
gb|KIY72978.1|  20S proteasome subunit                                  228   8e-71    
ref|XP_002004144.1|  GI18287                                            228   1e-70    
emb|CAX75564.1|  20S proteasome subunit alpha 6                         227   1e-70    
emb|CDJ02668.1|  20S proteasome subunit alpha 6                         227   1e-70    
emb|CDS15105.1|  20S proteasome subunit alpha 6                         227   1e-70    
ref|XP_008855336.1|  proteasome subunit alpha type 1, putative          226   2e-70    
gb|KIJ56576.1|  hypothetical protein M422DRAFT_57277                    228   2e-70    
gb|KHJ45970.1|  putative multicatalytic endopeptidase                   227   2e-70    
emb|CEL57852.1|  20S proteasome subunit alpha 6                         227   3e-70    
ref|XP_462266.2|  DEHA2G16676p                                          227   3e-70    
gb|EUC66683.1|  proteasome subunit alpha type protein                   226   3e-70    
ref|XP_007349227.1|  N-terminal nucleophile aminohydrolase              226   3e-70    
emb|CDJ50940.1|  proteasome subunit alpha type 1, putative              230   3e-70    
ref|XP_011121220.1|  hypothetical protein AOL_s00076g366                227   4e-70    
ref|XP_002175468.1|  20S proteasome component alpha 6 subunit Pre5      226   4e-70    
gb|KIO30017.1|  hypothetical protein M407DRAFT_14429                    226   7e-70    
ref|XP_001969659.1|  GG23827                                            226   1e-69    
ref|NP_609623.1|  proteasome alpha6 subunit, Testis-specific            226   1e-69    
gb|EDK40422.2|  conserved hypothetical protein                          226   1e-69    
ref|NP_990351.1|  proteasome subunit alpha type-1                       224   1e-69    
ref|XP_002180146.1|  predicted protein                                  224   2e-69    
ref|XP_002042137.1|  GM10300                                            224   2e-69    
gb|KFH63250.1|  20S proteasome subunit alpha 6                          224   2e-69    
ref|XP_002180142.1|  predicted protein                                  224   2e-69    
gb|EKC19323.1|  Proteasome subunit alpha type-1                         224   2e-69    
dbj|BAN21027.1|  proteasome subunit alpha type                          224   2e-69    
ref|XP_002079303.1|  GD23876                                            224   3e-69    
ref|XP_001992943.1|  GH13363                                            224   3e-69    
ref|XP_852713.1|  PREDICTED: proteasome subunit alpha type-1-like       226   3e-69    
gb|KEP54092.1|  proteasome subunit alpha type protein                   224   3e-69    
ref|XP_777450.1|  hypothetical protein CNBB0240                         225   4e-69    
ref|XP_009171283.1|  hypothetical protein T265_07486                    232   4e-69    
gb|KIR85370.1|  20S proteasome subunit alpha 6                          224   4e-69    
ref|NP_594101.1|  20S proteasome component alpha 6 subunit Pre5 (...    224   4e-69    
gb|KIR46733.1|  20S proteasome subunit alpha 6                          224   4e-69    
gb|KGB79569.1|  proteasome subunit alpha type 1                         224   4e-69    
emb|CCC51547.1|  putative proteasome alpha 1 subunit                    223   5e-69    
gb|KIR32952.1|  20S proteasome subunit alpha 6                          224   5e-69    
emb|CCF49419.1|  probable PRE5-20S proteasome subunit (alpha6)          224   5e-69    
ref|XP_569297.1|  proteasome subunit alpha type 1                       224   5e-69    
ref|XP_007007866.1|  hypothetical protein TREMEDRAFT_70236              224   7e-69    
gb|EWC44562.1|  putative proteasome subunit alpha type-1                223   7e-69    
ref|XP_004200557.1|  Piso0_003148                                       224   7e-69    
ref|XP_002088559.1|  GE18630                                            223   8e-69    
ref|XP_009270043.1|  Proteasome subunit alpha type-1                    223   8e-69    
gb|KIL68238.1|  hypothetical protein M378DRAFT_176952                   223   9e-69    
ref|XP_001483791.1|  conserved hypothetical protein                     224   1e-68    
ref|XP_001257686.1|  proteasome component Pre5, putative                222   1e-68    
gb|EPS95885.1|  N-terminal nucleophile aminohydrolase                   223   1e-68    
gb|KJE05166.1|  20S proteasome subunit alpha 6                          223   1e-68    
gb|KIY34475.1|  20S proteasome subunit alpha 6                          223   1e-68    
gb|ESW98184.1|  proteasome subunit alpha type-6                         223   1e-68    



>gb|AAN07899.1| 20S proteasome alpha 6 subunit [Nicotiana benthamiana]
Length=274

 Score =   380 bits (976),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/180 (99%), Positives = 180/180 (100%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHV+LACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVILACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSY+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYAYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  180



>ref|XP_009771200.1| PREDICTED: proteasome subunit alpha type-1-B-like [Nicotiana 
sylvestris]
Length=274

 Score =   380 bits (976),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/180 (99%), Positives = 180/180 (100%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHV+LACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVILACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSY+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYAYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  180



>ref|XP_009614945.1| PREDICTED: proteasome subunit alpha type-1-B-like [Nicotiana 
tomentosiformis]
Length=274

 Score =   380 bits (976),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/180 (99%), Positives = 180/180 (100%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHV+LACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVILACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSY+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYAYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  180



>ref|XP_006341960.1| PREDICTED: proteasome subunit alpha type-1-B-like [Solanum tuberosum]
Length=274

 Score =   375 bits (964),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/180 (98%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHV+LA VNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVILASVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR ECINYSYSYESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRTECINYSYSYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FETFM
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFETFM  180



>ref|XP_009611760.1| PREDICTED: proteasome subunit alpha type-1-A-like [Nicotiana 
tomentosiformis]
Length=273

 Score =   375 bits (962),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/179 (98%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHV+LACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVILACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYSYSYESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSYSYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>ref|XP_004238282.1| PREDICTED: proteasome subunit alpha type-1-A [Solanum lycopersicum]
Length=274

 Score =   375 bits (962),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/180 (98%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHV+LA VNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVILASVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR ECINYSYSYESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRTECINYSYSYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FETFM
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFETFM  180



>gb|ABK92956.1| unknown [Populus trichocarpa]
 gb|ABK93492.1| unknown [Populus trichocarpa]
Length=274

 Score =   374 bits (961),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 175/180 (97%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRTECINYSFNYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGG DESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE FM
Sbjct  121  QRSWKRPYGVGLLVGGTDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFM  180



>ref|XP_002300761.2| hypothetical protein POPTR_0002s03530g [Populus trichocarpa]
 gb|EEE80034.2| hypothetical protein POPTR_0002s03530g [Populus trichocarpa]
Length=268

 Score =   374 bits (959),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 175/180 (97%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRTECINYSFNYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGG DESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE FM
Sbjct  121  QRSWKRPYGVGLLVGGTDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFM  180



>gb|KHG20880.1| Proteasome subunit alpha type-1-B -like protein [Gossypium arboreum]
Length=277

 Score =   374 bits (959),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|XP_007223366.1| hypothetical protein PRUPE_ppa007472mg [Prunus persica]
 gb|EMJ24565.1| hypothetical protein PRUPE_ppa007472mg [Prunus persica]
Length=366

 Score =   376 bits (965),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  45   RSQRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKAN  224
            R     KMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKAN
Sbjct  77   RRNDAVKMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKAN  136

Query  225  SELSSHQKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLA  404
            SELSSHQKKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLA
Sbjct  137  SELSSHQKKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLA  196

Query  405  DKAQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLE  584
            DKAQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLE
Sbjct  197  DKAQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLE  256

Query  585  RRFETF  602
            RRFE F
Sbjct  257  RRFENF  262



>ref|XP_011028865.1| PREDICTED: proteasome subunit alpha type-1-A-like isoform X1 
[Populus euphratica]
Length=278

 Score =   373 bits (957),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/180 (97%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSK+HVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKSHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRTECINYSFNYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGG DESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE FM
Sbjct  121  QRSWKRPYGVGLLVGGTDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFM  180



>gb|EYU32910.1| hypothetical protein MIMGU_mgv1a009555mg [Erythranthe guttata]
Length=338

 Score =   375 bits (962),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/180 (98%), Positives = 180/180 (100%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  54   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  113

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSY+YESPLPVGRLVVQLADKAQVCT
Sbjct  114  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYTYESPLPVGRLVVQLADKAQVCT  173

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FE+F+
Sbjct  174  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFESFV  233



>ref|XP_011028867.1| PREDICTED: proteasome subunit alpha type-1-A-like isoform X2 
[Populus euphratica]
Length=267

 Score =   372 bits (955),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/180 (97%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSK+HVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKSHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRTECINYSFNYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGG DESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE FM
Sbjct  121  QRSWKRPYGVGLLVGGTDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFM  180



>ref|XP_002510414.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF52601.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=283

 Score =   373 bits (957),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/180 (97%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTY+ERRFE FM
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYMERRFENFM  180



>ref|XP_011028868.1| PREDICTED: proteasome subunit alpha type-1-B-like isoform X3 
[Populus euphratica]
Length=261

 Score =   372 bits (954),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/180 (97%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSK+HVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKSHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRTECINYSFNYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGG DESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE FM
Sbjct  121  QRSWKRPYGVGLLVGGTDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFM  180



>gb|KJB59788.1| hypothetical protein B456_009G272200 [Gossypium raimondii]
Length=279

 Score =   372 bits (955),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVL CVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLGCVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>gb|KDP38529.1| hypothetical protein JCGZ_04454 [Jatropha curcas]
Length=276

 Score =   372 bits (954),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 174/180 (97%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRP+GVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE FM
Sbjct  121  QRSWKRPFGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFM  180



>ref|XP_009336153.1| PREDICTED: proteasome subunit alpha type-1-A isoform X2 [Pyrus 
x bretschneideri]
Length=245

 Score =   370 bits (951),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E INY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F 
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFT  180

Query  606  G  608
            G
Sbjct  181  G  181



>gb|KJB63635.1| hypothetical protein B456_010G009100 [Gossypium raimondii]
Length=277

 Score =   372 bits (954),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVL CVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLGCVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|XP_004291861.1| PREDICTED: proteasome subunit alpha type-1-A-like [Fragaria vesca 
subsp. vesca]
Length=283

 Score =   371 bits (952),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVV+ACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVMACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF++F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFKSF  179



>ref|XP_002307665.2| hypothetical protein POPTR_0005s25080g [Populus trichocarpa]
 gb|ABK93062.1| unknown [Populus trichocarpa]
 gb|ABK94592.1| unknown [Populus trichocarpa]
 gb|EEE94661.2| hypothetical protein POPTR_0005s25080g [Populus trichocarpa]
Length=281

 Score =   371 bits (952),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSK+HVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKSHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRTECINYSFNYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGG DESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVGGTDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>ref|XP_011007459.1| PREDICTED: proteasome subunit alpha type-1-B [Populus euphratica]
Length=282

 Score =   371 bits (952),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSK+HVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKSHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRTECINYSFNYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGG DESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVGGTDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>ref|XP_004152689.1| PREDICTED: proteasome subunit alpha type-1-A-like [Cucumis sativus]
 gb|KGN62618.1| hypothetical protein Csa_2G361820 [Cucumis sativus]
Length=281

 Score =   371 bits (952),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRS THVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSNTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAI+GLTADGRVLSRYMR+ECINYSY+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAISGLTADGRVLSRYMRSECINYSYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>ref|XP_009336144.1| PREDICTED: proteasome subunit alpha type-1-A isoform X1 [Pyrus 
x bretschneideri]
Length=292

 Score =   371 bits (952),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E INY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F 
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFT  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_011083661.1| PREDICTED: proteasome subunit alpha type-1-B [Sesamum indicum]
Length=276

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/180 (97%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLA VNKA+SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLASVNKASSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSY+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FE FM
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFEGFM  180



>emb|CAN79638.1| hypothetical protein VITISV_014475 [Vitis vinifera]
Length=285

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF TF
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFGTF  179



>ref|XP_008444739.1| PREDICTED: proteasome subunit alpha type-1-B-like [Cucumis melo]
Length=281

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRS THVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSNTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAI+GLTADGRVLSRYMR+ECINYSY+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAISGLTADGRVLSRYMRSECINYSYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>ref|XP_007160738.1| hypothetical protein PHAVU_001G013000g [Phaseolus vulgaris]
 gb|ESW32732.1| hypothetical protein PHAVU_001G013000g [Phaseolus vulgaris]
Length=280

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVD+HIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDNHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF  FM
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFGNFM  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_008220829.1| PREDICTED: proteasome subunit alpha type-1-A [Prunus mume]
Length=279

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSK+HVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKSHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>ref|XP_008388039.1| PREDICTED: proteasome subunit alpha type-1-A-like [Malus domestica]
Length=286

 Score =   370 bits (951),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E INY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F 
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFT  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_002281948.1| PREDICTED: proteasome subunit alpha type-1-B [Vitis vinifera]
Length=284

 Score =   370 bits (951),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF TF
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFGTF  179



>gb|KHG18625.1| Proteasome subunit alpha type-1-A -like protein [Gossypium arboreum]
 gb|KHG19738.1| Proteasome subunit alpha type-1-A -like protein [Gossypium arboreum]
Length=273

 Score =   370 bits (950),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVL CVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLGCVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINY+++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYNFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>ref|XP_009365059.1| PREDICTED: proteasome subunit alpha type-1-A-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009365065.1| PREDICTED: proteasome subunit alpha type-1-A-like isoform X2 
[Pyrus x bretschneideri]
Length=285

 Score =   370 bits (950),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E INY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F 
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFT  180

Query  606  G  608
            G
Sbjct  181  G  181



>gb|AGJ26431.1| hypothetical protein [Salicornia brachiata]
Length=273

 Score =   370 bits (949),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MF+NQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKA SELSSHQ
Sbjct  1    MFKNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FETF
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFETF  179



>ref|XP_003544399.1| PREDICTED: proteasome subunit alpha type-1-B-like isoform 1 [Glycine 
max]
Length=288

 Score =   370 bits (950),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVD+HIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDNHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F+
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFV  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_003550390.1| PREDICTED: proteasome subunit alpha type-1-A-like isoform 1 [Glycine 
max]
 gb|KHN12696.1| Proteasome subunit alpha type-1-A [Glycine soja]
Length=284

 Score =   370 bits (949),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVD+HIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDNHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F+
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFV  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_003534072.1| PREDICTED: proteasome subunit alpha type-1-B-like isoform 1 [Glycine 
max]
Length=285

 Score =   370 bits (949),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVD+HIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDNHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F+
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFV  180

Query  606  G  608
            G
Sbjct  181  G  181



>gb|KHM99758.1| Proteasome subunit alpha type-1-A [Glycine soja]
Length=285

 Score =   370 bits (949),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVD+HIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDNHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F+
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFV  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_006473530.1| PREDICTED: proteasome subunit alpha type-1-B-like [Citrus sinensis]
Length=279

 Score =   369 bits (948),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVL CVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLGCVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYSY+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDE GAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVAGLDEKGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>ref|XP_006435026.1| hypothetical protein CICLE_v10002110mg [Citrus clementina]
 gb|ESR48266.1| hypothetical protein CICLE_v10002110mg [Citrus clementina]
Length=279

 Score =   369 bits (948),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVL CVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLGCVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYSY+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDE GAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVAGLDEKGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>gb|KDO84609.1| hypothetical protein CISIN_1g023620mg [Citrus sinensis]
Length=279

 Score =   369 bits (948),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVL CVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLGCVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYSY+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDE GAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVAGLDEKGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>ref|XP_009792806.1| PREDICTED: proteasome subunit alpha type-1-A-like [Nicotiana 
sylvestris]
Length=273

 Score =   369 bits (947),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSK+HV+LACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKSHVILACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYSYSYESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSYSYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERR+ +F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRYGSF  179



>gb|KHN20966.1| Proteasome subunit alpha type-1-A [Glycine soja]
Length=287

 Score =   370 bits (949),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVD+HIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDNHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F+
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFV  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_006342581.1| PREDICTED: proteasome subunit alpha type-1-A-like [Solanum tuberosum]
Length=273

 Score =   369 bits (947),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHV+LACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVILACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINY YSYES LPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYGYSYESALPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQ+FAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQSFAIGSRSQAAKTYLERRFENF  179



>ref|XP_011074557.1| PREDICTED: proteasome subunit alpha type-1-A-like [Sesamum indicum]
Length=275

 Score =   369 bits (947),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 174/180 (97%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKA+SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKASSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRY+RNECINYSY+YES LPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYLRNECINYSYTYESSLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FE FM
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFEGFM  180



>ref|XP_004499172.1| PREDICTED: proteasome subunit alpha type-1-B-like [Cicer arietinum]
Length=286

 Score =   369 bits (948),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF+ F
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFDNF  179



>ref|XP_010263616.1| PREDICTED: proteasome subunit alpha type-1-B-like [Nelumbo nucifera]
Length=262

 Score =   368 bits (945),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLA VNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLASVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFK+DDHIG+AIAGLTADGRVLSRY+R+ECINY+++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKIDDHIGIAIAGLTADGRVLSRYLRSECINYNFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FETFM
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFETFM  180



>gb|ACJ84423.1| unknown [Medicago truncatula]
Length=223

 Score =   366 bits (939),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+F  F
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFNNF  179



>ref|XP_010254783.1| PREDICTED: proteasome subunit alpha type-1-B [Nelumbo nucifera]
Length=261

 Score =   367 bits (943),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/180 (94%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTH VLA VNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHAVLASVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFK+DDHIG+AIAGLTADGRVLSRY+R+ECINYS++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKIDDHIGIAIAGLTADGRVLSRYLRSECINYSFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FETFM
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFETFM  180



>ref|XP_010060968.1| PREDICTED: proteasome subunit alpha type-1-A-like [Eucalyptus 
grandis]
 gb|KCW67870.1| hypothetical protein EUGRSUZ_F01586 [Eucalyptus grandis]
Length=273

 Score =   367 bits (942),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/180 (95%), Positives = 178/180 (99%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRS+THVVLACVNKAN+ELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSRTHVVLACVNKANNELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECIN++++YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINHAFTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE FM
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFEKFM  180



>ref|XP_007150857.1| hypothetical protein PHAVU_004G000100g [Phaseolus vulgaris]
 gb|ESW22851.1| hypothetical protein PHAVU_004G000100g [Phaseolus vulgaris]
Length=281

 Score =   367 bits (943),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVD+HIGVAIAGLTADG VLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDNHIGVAIAGLTADGHVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF+ F+
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFDNFI  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_010102069.1| Proteasome subunit alpha type-1-B [Morus notabilis]
 gb|EXB91919.1| Proteasome subunit alpha type-1-B [Morus notabilis]
Length=286

 Score =   367 bits (943),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINY+Y+YES LPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYNYTYESALPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF +F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFGSF  179



>ref|XP_009365533.1| PREDICTED: proteasome subunit alpha type-1-A-like [Pyrus x bretschneideri]
Length=285

 Score =   367 bits (943),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E INY+Y+YES LPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINYNYTYESQLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F 
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFT  180

Query  606  G  608
            G
Sbjct  181  G  181



>gb|EPS65575.1| proteasome subunit alpha type, partial [Genlisea aurea]
Length=286

 Score =   367 bits (943),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 172/180 (96%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  63   KMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSH  242
            +MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRSKTHVVLA VNKANSELSSH
Sbjct  4    EMFRNQYDTDVTTWSPVGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLASVNKANSELSSH  63

Query  243  QKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVC  422
            QKKIFK+DDHIGVAIAGLTADGRVLSRYMRNECINYSY+YESPLPVGRLVVQ+ADKAQVC
Sbjct  64   QKKIFKIDDHIGVAIAGLTADGRVLSRYMRNECINYSYTYESPLPVGRLVVQVADKAQVC  123

Query  423  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FE F
Sbjct  124  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFEGF  183



>gb|KJB14263.1| hypothetical protein B456_002G126700 [Gossypium raimondii]
Length=273

 Score =   367 bits (941),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVL CVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLGCVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINY+++YESPLPVGRLVVQLAD+AQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYNFTYESPLPVGRLVVQLADRAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE  
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENL  179



>gb|AFK42936.1| unknown [Medicago truncatula]
Length=284

 Score =   367 bits (941),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+F  F
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFNNF  179



>gb|AFK33498.1| unknown [Medicago truncatula]
 gb|KEH40169.1| 20S proteasome subunit alpha type 1 [Medicago truncatula]
Length=284

 Score =   367 bits (941),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINY+Y+YESPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYNYTYESPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+F  F
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFNNF  179



>ref|XP_010684086.1| PREDICTED: proteasome subunit alpha type-1-A-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010668207.1| PREDICTED: proteasome subunit alpha type-1-A-like [Beta vulgaris 
subsp. vulgaris]
Length=274

 Score =   366 bits (939),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVL CVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLGCVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYS++YES LPVGRLVVQLADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSFTYESSLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FETF 
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFETFD  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_010538098.1| PREDICTED: proteasome subunit alpha type-1-A [Tarenaya hassleriana]
Length=275

 Score =   362 bits (928),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLAC+NKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACLNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+ECIN+S++YESPLPVGRLVV+LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINHSFTYESPLPVGRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE FM
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFM  180



>ref|XP_010523602.1| PREDICTED: proteasome subunit alpha type-1-B-like [Tarenaya hassleriana]
Length=273

 Score =   361 bits (926),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+ECIN+ ++YESPLPVGRLVV+LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINHFFTYESPLPVGRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+FM
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESFM  180



>gb|KFK31814.1| hypothetical protein AALP_AA6G162100 [Arabis alpina]
Length=272

 Score =   360 bits (923),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS+THVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRTHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|XP_009123698.1| PREDICTED: proteasome subunit alpha type-1-A-like [Brassica rapa]
 emb|CDY02422.1| BnaA02g23310D [Brassica napus]
Length=271

 Score =   360 bits (923),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>emb|CDX95156.1| BnaC09g17140D [Brassica napus]
Length=277

 Score =   359 bits (922),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|XP_006280673.1| hypothetical protein CARUB_v10026636mg, partial [Capsella rubella]
 gb|EOA13571.1| hypothetical protein CARUB_v10026636mg, partial [Capsella rubella]
Length=365

 Score =   362 bits (930),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = +3

Query  63   KMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSH  242
            KMFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSH
Sbjct  86   KMFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSH  145

Query  243  QKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVC  422
            Q+KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVC
Sbjct  146  QRKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVC  205

Query  423  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  206  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  265



>ref|XP_009114036.1| PREDICTED: proteasome subunit alpha type-1-A [Brassica rapa]
Length=275

 Score =   359 bits (921),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>emb|CDY52371.1| BnaA09g15700D [Brassica napus]
Length=275

 Score =   359 bits (921),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|XP_006403347.1| hypothetical protein EUTSA_v10003255mg [Eutrema salsugineum]
 gb|ESQ44800.1| hypothetical protein EUTSA_v10003255mg [Eutrema salsugineum]
Length=279

 Score =   359 bits (921),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>emb|CDX71518.1| BnaC04g17530D [Brassica napus]
Length=271

 Score =   358 bits (919),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS +HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSSSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|XP_007017581.1| 20S proteasome alpha subunit F2 [Theobroma cacao]
 gb|EOY14806.1| 20S proteasome alpha subunit F2 [Theobroma cacao]
Length=301

 Score =   359 bits (921),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 176/201 (88%), Gaps = 22/201 (11%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVL CVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLGCVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKA----  413
            KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYS++YESPLPVGRLVVQLADKA    
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSFTYESPLPVGRLVVQLADKAQNSV  120

Query  414  ------------------QVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQA  539
                              QVCTQRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQA
Sbjct  121  LYENELTFKAVVLETLIDQVCTQRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQA  180

Query  540  FAIGSRSQAAKTYLERRFETF  602
            FAIGSRSQAAKTYLERRFE F
Sbjct  181  FAIGSRSQAAKTYLERRFENF  201



>ref|XP_006303756.1| hypothetical protein CARUB_v10011928mg [Capsella rubella]
 gb|EOA36654.1| hypothetical protein CARUB_v10011928mg [Capsella rubella]
Length=277

 Score =   358 bits (919),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV+LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|XP_002891341.1| hypothetical protein ARALYDRAFT_473874 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67600.1| hypothetical protein ARALYDRAFT_473874 [Arabidopsis lyrata subsp. 
lyrata]
Length=277

 Score =   358 bits (919),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|XP_002863736.1| 20S proteasome subunit PAF1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39995.1| 20S proteasome subunit PAF1 [Arabidopsis lyrata subsp. lyrata]
Length=276

 Score =   358 bits (918),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>gb|AFK49441.1| unknown [Lotus japonicus]
Length=171

 Score =   353 bits (907),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYSY+YESPLPVGRLVV LADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSYTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTY  578
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTY
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTY  171



>ref|XP_010481942.1| PREDICTED: proteasome subunit alpha type-1-A [Camelina sativa]
Length=278

 Score =   358 bits (918),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>gb|AAC32062.1| 20S proteasome subunit PAF1 [Arabidopsis thaliana]
Length=278

 Score =   358 bits (918),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>gb|AAM61575.1| 20S proteasome subunit PAF1 [Arabidopsis thaliana]
Length=278

 Score =   358 bits (918),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|XP_010494236.1| PREDICTED: proteasome subunit alpha type-1-A-like [Camelina sativa]
Length=271

 Score =   357 bits (917),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|XP_010442116.1| PREDICTED: proteasome subunit alpha type-1-A-like [Camelina sativa]
Length=277

 Score =   357 bits (917),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|NP_199093.1| proteasome alpha subunit F1 [Arabidopsis thaliana]
 sp|P34066.3|PSA1A_ARATH RecName: Full=Proteasome subunit alpha type-1-A; AltName: Full=20S 
proteasome alpha subunit F-1; AltName: Full=Proteasome 
30 kDa subunit; AltName: Full=Proteasome component 2A; Short=AtPSM30; 
AltName: Full=Proteasome subunit alpha type-6; AltName: 
Full=Protein ARSENIC TOLERANCE 5 [Arabidopsis thaliana]
 gb|AAK53031.1|AF375447_1 AT5g42790/MJB21_17 [Arabidopsis thaliana]
 gb|AAA16326.1| proteasome [Arabidopsis thaliana]
 dbj|BAB10635.1| 20S proteasome subunit PAF1 [Arabidopsis thaliana]
 gb|AAL25544.1| AT5g42790/MJB21_17 [Arabidopsis thaliana]
 gb|AAM47355.1| AT5g42790/MJB21_17 [Arabidopsis thaliana]
 gb|AED94864.1| proteasome alpha subunit F1 [Arabidopsis thaliana]
Length=278

 Score =   357 bits (917),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|NP_175158.1| 20S proteasome alpha subunit F2 [Arabidopsis thaliana]
 sp|O23712.2|PSA1B_ARATH RecName: Full=Proteasome subunit alpha type-1-B; AltName: Full=20S 
proteasome alpha subunit F-2; AltName: Full=Proteasome 
component 2B; AltName: Full=Proteasome subunit alpha type-6 
[Arabidopsis thaliana]
 gb|AAG52642.1|AC079677_6 20S proteasome subunit PAF2; 11103-9423 [Arabidopsis thaliana]
 gb|AAC32063.1| 20S proteasome subunit PAF2 [Arabidopsis thaliana]
 gb|AAL15280.1| At1g47250/F8G22_3 [Arabidopsis thaliana]
 gb|AAM98260.1| At1g47250/F8G22_3 [Arabidopsis thaliana]
 gb|AEE32143.1| 20S proteasome alpha subunit F2 [Arabidopsis thaliana]
Length=277

 Score =   357 bits (915),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFESF  179



>ref|XP_008364990.1| PREDICTED: LOW QUALITY PROTEIN: proteasome subunit alpha type-1-A-like 
[Malus domestica]
Length=298

 Score =   356 bits (914),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 177/196 (90%), Gaps = 15/196 (8%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKA----  413
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+E INY+Y+YES LPVGRLVVQLADKA    
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINYNYTYESQLPVGRLVVQLADKAQVKA  120

Query  414  -----------QVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRS  560
                       QVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRS
Sbjct  121  LILNLYIPCGXQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRS  180

Query  561  QAAKTYLERRFETFMG  608
            QAAKTYLERRFE F G
Sbjct  181  QAAKTYLERRFENFTG  196



>ref|XP_009107431.1| PREDICTED: proteasome subunit alpha type-1-B [Brassica rapa]
Length=270

 Score =   355 bits (911),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLA VNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLASVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV+LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  179



>ref|XP_006435025.1| hypothetical protein CICLE_v10002110mg [Citrus clementina]
 gb|ESR48265.1| hypothetical protein CICLE_v10002110mg [Citrus clementina]
Length=275

 Score =   354 bits (909),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 171/179 (96%), Gaps = 4/179 (2%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVL CVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLGCVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR+ECINYSY+YESPLPVGRLVVQLADKA    
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSYTYESPLPVGRLVVQLADKA----  116

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDE GAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  117  QRSWKRPYGVGLLVAGLDEKGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  175



>ref|XP_006393606.1| hypothetical protein EUTSA_v10011712mg [Eutrema salsugineum]
 gb|ESQ30892.1| hypothetical protein EUTSA_v10011712mg [Eutrema salsugineum]
Length=272

 Score =   354 bits (909),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV+LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q SWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QWSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENF  179



>ref|XP_010461521.1| PREDICTED: proteasome subunit alpha type-1-B-like [Camelina sativa]
 ref|XP_010479123.1| PREDICTED: proteasome subunit alpha type-1-B-like [Camelina sativa]
Length=277

 Score =   354 bits (908),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPL VGRLVV+LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLSVGRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERR+E+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRYESF  179



>gb|KFK36156.1| hypothetical protein AALP_AA4G085300 [Arabis alpina]
Length=274

 Score =   353 bits (907),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S+SYES LPVGRLVV+LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFSYESLLPVGRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFEGF  179



>ref|XP_010500246.1| PREDICTED: proteasome subunit alpha type-1-B isoform X3 [Camelina 
sativa]
Length=277

 Score =   353 bits (907),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPL VGRLVV+LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLSVGRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERR+E+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRYESF  179



>ref|XP_010500244.1| PREDICTED: proteasome subunit alpha type-1-B isoform X1 [Camelina 
sativa]
Length=277

 Score =   353 bits (907),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPL VGRLVV+LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLSVGRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERR+E+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRYESF  179



>ref|XP_010500245.1| PREDICTED: proteasome subunit alpha type-1-B isoform X2 [Camelina 
sativa]
Length=281

 Score =   353 bits (907),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPL VGRLVV+LADKAQVCT
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLSVGRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERR+E+F
Sbjct  121  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRYESF  179



>emb|CDY17035.1| BnaA08g03990D [Brassica napus]
Length=273

 Score =   350 bits (899),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 175/180 (97%), Gaps = 1/180 (1%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLA VNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLASVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKA-QVC  422
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV+LADKA QVC
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVRLADKAQQVC  120

Query  423  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE+F
Sbjct  121  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESF  180



>ref|XP_010940099.1| PREDICTED: proteasome subunit alpha type-1-like [Elaeis guineensis]
 ref|XP_010940100.1| PREDICTED: proteasome subunit alpha type-1-like [Elaeis guineensis]
 ref|XP_010940101.1| PREDICTED: proteasome subunit alpha type-1-like [Elaeis guineensis]
Length=262

 Score =   349 bits (896),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRS THVVLA VNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSATHVVLATVNKAASELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+FKVDDHIGVAIAGLTADGRVLSR++R+ECIN+++ YESPLPV RLVV LADKAQVCT
Sbjct  61   KKVFKVDDHIGVAIAGLTADGRVLSRFLRSECINHTFVYESPLPVSRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDE+GAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF+ F 
Sbjct  121  QRSWKRPYGVGLLVAGLDETGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFQAFN  180

Query  606  GF  611
             +
Sbjct  181  NY  182



>ref|XP_006841541.1| hypothetical protein AMTR_s00003p00165080 [Amborella trichopoda]
 gb|ERN03216.1| hypothetical protein AMTR_s00003p00165080 [Amborella trichopoda]
Length=266

 Score =   348 bits (894),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRS  HVVLA VNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSSKHVVLASVNKAASELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFKVDDH+G+AIAGLTADGRVLSRY+R+ECIN+++ YESPLPV RLVVQLADKAQVCT
Sbjct  61   RKIFKVDDHVGIAIAGLTADGRVLSRYLRSECINHTFVYESPLPVSRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDE GAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FETF
Sbjct  121  QRSWKRPYGVGLLVAGLDELGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFETF  179



>emb|CDY47593.1| BnaC08g04630D [Brassica napus]
Length=273

 Score =   349 bits (895),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 175/180 (97%), Gaps = 1/180 (1%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLA VNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLASVNKAQSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKA-QVC  422
            +KIFKVDDHIGVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV+LADKA QVC
Sbjct  61   RKIFKVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVRLADKAQQVC  120

Query  423  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF++F
Sbjct  121  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFKSF  180



>ref|XP_009403902.1| PREDICTED: proteasome subunit alpha type-1-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   349 bits (895),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQG+AA+GLRS +HVVLA VNKA S+LSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGAAAVGLRSTSHVVLATVNKAASDLSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+FK+DDHIGVAIAGLTADGRVLSRY+RNECIN+S+ YESPLPV RLVV+LADKAQVCT
Sbjct  61   RKVFKIDDHIGVAIAGLTADGRVLSRYLRNECINHSFVYESPLPVSRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRP+GVGLLV GLDE+GAHLYYNCPSGNYFEYQAFAIGSRSQAAKT++ERRFE F 
Sbjct  121  QRSWKRPFGVGLLVAGLDETGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTFMERRFEAFN  180

Query  606  GF  611
            G+
Sbjct  181  GY  182



>ref|XP_008784923.1| PREDICTED: proteasome subunit alpha type-1-like [Phoenix dactylifera]
Length=261

 Score =   348 bits (892),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRS THV LA VNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSATHVALATVNKAASELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+FKVDDHIGVAIAGLTADGRVLSR++R+ECINY++ YESPLPV RLVV LADKAQVCT
Sbjct  61   KKVFKVDDHIGVAIAGLTADGRVLSRFLRSECINYAFVYESPLPVSRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDE+GAHLYYNC SGNYFEYQAFAIGSRSQAAKTYLERRFE F 
Sbjct  121  QRSWKRPYGVGLLVAGLDETGAHLYYNCTSGNYFEYQAFAIGSRSQAAKTYLERRFEAFN  180

Query  606  GF  611
             +
Sbjct  181  SY  182



>ref|XP_010906336.1| PREDICTED: proteasome subunit alpha type-1-like [Elaeis guineensis]
Length=261

 Score =   347 bits (891),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRS THV LA VNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSATHVALATVNKAASELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+FKVDDH+GVAIAGLTADGRVLSR++R+ECIN+++ YESPLPV RLVV LADKAQVCT
Sbjct  61   KKVFKVDDHVGVAIAGLTADGRVLSRFLRSECINHAFVYESPLPVSRLVVHLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDE+GAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF+ F 
Sbjct  121  QRSWKRPYGVGLLVAGLDETGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFKAFN  180

Query  606  GF  611
             +
Sbjct  181  SY  182



>ref|XP_009380372.1| PREDICTED: proteasome subunit alpha type-1-like [Musa acuminata 
subsp. malaccensis]
Length=265

 Score =   347 bits (889),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQG+AA+GLRS +HVVLA VNKA S+LSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGAAAVGLRSTSHVVLATVNKAASDLSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+FK+DDHIGVAIAGLTADGRVLSRY+RNECIN+++ YESPLPV RLVV+LADKAQVCT
Sbjct  61   RKVFKIDDHIGVAIAGLTADGRVLSRYLRNECINHAFVYESPLPVSRLVVRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDE+GAHLYYNCPSGNYFEYQAFAIGSRSQAAKTY+ERRFE F 
Sbjct  121  QRSWKRPYGVGLLVAGLDETGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYMERRFEAFN  180

Query  606  GF  611
             +
Sbjct  181  NY  182



>ref|XP_001770750.1| predicted protein [Physcomitrella patens]
 gb|EDQ64432.1| predicted protein [Physcomitrella patens]
Length=282

 Score =   345 bits (885),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRL QVEYAMEAVKQGSAAIGLRSKTHVVLA VNKA+SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLHQVEYAMEAVKQGSAAIGLRSKTHVVLAAVNKASSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+FK+D+HIG+A+AGLTADGRVLSRYMR+ECIN+ + YESPLPVGRLVVQ+ADKAQVCT
Sbjct  61   KKLFKIDNHIGIAMAGLTADGRVLSRYMRSECINHKFVYESPLPVGRLVVQVADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDE+G HLY NCPSGNYFE+ AFAIGSRSQAAKTYLER+FE+FM
Sbjct  121  QRSWKRPYGVGLLVAGLDETGPHLYQNCPSGNYFEFHAFAIGSRSQAAKTYLERKFESFM  180



>gb|ABR17415.1| unknown [Picea sitchensis]
Length=269

 Score =   343 bits (880),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAA+GLRSKTHVVL CV KANSE SSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAVGLRSKTHVVLVCVGKANSEFSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLS +MR+ECI+Y + Y+SPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSLHMRSECIHYKFLYDSPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSW RPYGVGLLV GLDE+G HLY NCPSGNYFEYQAFAIG+RSQAAKTYLER+FETF
Sbjct  121  QRSWTRPYGVGLLVAGLDETGPHLYQNCPSGNYFEYQAFAIGARSQAAKTYLERKFETF  179



>gb|ABR18455.1| unknown [Picea sitchensis]
Length=269

 Score =   343 bits (880),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAA+GLRSKTHVVL CV KANSE SSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAVGLRSKTHVVLVCVGKANSEFSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLS +MR+ECI+Y + Y+SPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSLHMRSECIHYKFLYDSPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSW RPYGVGLLV GLDE+G HLY NCPSGNYFEYQAFAIG+RSQAAKTYLER+FETF
Sbjct  121  QRSWTRPYGVGLLVAGLDETGPHLYQNCPSGNYFEYQAFAIGARSQAAKTYLERKFETF  179



>ref|XP_001752541.1| predicted protein [Physcomitrella patens]
 gb|EDQ82780.1| predicted protein [Physcomitrella patens]
Length=282

 Score =   339 bits (869),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRL QVEYAMEAVKQGSAAIGLRSKTHVVLA VNKA+SELSS+Q
Sbjct  1    MFRNQYDTDVTTWSPAGRLHQVEYAMEAVKQGSAAIGLRSKTHVVLATVNKASSELSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+FK+D+HIG+A+AGLTADGRVLSRYMR+EC+ +++ YESPLPVGRLVVQ+ADKAQVCT
Sbjct  61   KKLFKIDNHIGIAMAGLTADGRVLSRYMRSECVTHNFVYESPLPVGRLVVQVADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDE+G HLY NCPSGNYFE+ AFAIGSRSQAAKTYLER+FE+FM
Sbjct  121  QRSWKRPYGVGLLVAGLDETGPHLYQNCPSGNYFEFHAFAIGSRSQAAKTYLERKFESFM  180



>emb|CAA73625.1| multicatalytic endopeptidase [Arabidopsis thaliana]
Length=267

 Score =   334 bits (857),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  96   TTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQKKIFKVDDHI  275
            TTWSP GRLFQVEYAMEAVKQGSAAIGLRS++HVVLACVNKA SELSSHQ+KIFKVDDHI
Sbjct  1    TTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQRKIFKVDDHI  60

Query  276  GVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQRSWKRPYGV  455
            GVAIAGLTADGRVLSRYMR+E IN+S++YESPLPVGRLVV LADKAQVCTQRSWKRPYGV
Sbjct  61   GVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGV  120

Query  456  GLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            GLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER+FE+F
Sbjct  121  GLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFESF  169



>emb|CAC43322.1| putative alpha6 proteasome subunit [Nicotiana tabacum]
Length=161

 Score =   327 bits (837),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 154/157 (98%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = +3

Query  81   YDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQKKIFK  260
            YDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHV+LACVNKANSELSSHQKKIFK
Sbjct  4    YDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVILACVNKANSELSSHQKKIFK  63

Query  261  VDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQRSWK  440
            VDDHIGVAIAGLTADGRVLSRYMRNECINYSY+YESPLP GRLVVQLADKAQVCTQRSWK
Sbjct  64   VDDHIGVAIAGLTADGRVLSRYMRNECINYSYAYESPLPAGRLVVQLADKAQVCTQRSWK  123

Query  441  RPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIG  551
            RPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIG
Sbjct  124  RPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIG  160



>gb|ABK25101.1| unknown [Picea sitchensis]
Length=269

 Score =   330 bits (846),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAA+GL SKTH VL  V K NSE SS+Q
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAVGLTSKTHAVLVSVGKTNSEFSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAIAGLTADGRVLS +MR+ECI+Y + Y+SPLPVGRLVVQLADKAQVCT
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSLHMRSECIHYKFLYDSPLPVGRLVVQLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSW RPYGVGLLV GLDE+G HLY NCPSGNYFEYQA+AIG+RSQAAKTYLER+FETF
Sbjct  121  QRSWTRPYGVGLLVAGLDETGPHLYLNCPSGNYFEYQAYAIGARSQAAKTYLERKFETF  179



>ref|XP_003574154.1| PREDICTED: proteasome subunit alpha type-1 [Brachypodium distachyon]
Length=283

 Score =   328 bits (841),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSA +GLRS TH VLA  NK+ +ELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSACVGLRSATHAVLAAANKSANELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+F+V DH GVA+AGLTADGRVLSR++R+ECIN+++ Y++PLPV RL ++LADKAQVCT
Sbjct  61   RKVFRVADHAGVALAGLTADGRVLSRFLRSECINHAFVYDAPLPVSRLALRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F 
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFEKFN  180

Query  606  GF  611
             +
Sbjct  181  DY  182



>dbj|BAJ91315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=288

 Score =   328 bits (840),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSA +GLRS TH VLA  NK+ +ELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPQGRLFQVEYAMEAVKQGSACVGLRSATHAVLAAANKSANELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+F+V DH GVA+AGLTADGRVLSR++RNECIN+++ Y++PLPV RL ++LADKAQVCT
Sbjct  61   RKVFRVADHAGVALAGLTADGRVLSRFLRNECINHAFVYDAPLPVSRLALRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F 
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFEKFN  180

Query  606  GF  611
             +
Sbjct  181  AY  182



>ref|NP_001149085.1| proteasome subunit alpha type 1 [Zea mays]
 gb|ACG34126.1| proteasome subunit alpha type 1 [Zea mays]
 gb|ACN31283.1| unknown [Zea mays]
Length=274

 Score =   325 bits (833),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSA +GLRS TH VLA VNK  SELSS+Q
Sbjct  1    MFRNQYDTDVTTWSPQGRLFQVEYAMEAVKQGSACVGLRSSTHAVLAAVNKPASELSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+F+V DH GVA+AGLTADGRVLSR++RNECIN+S+ YE+PLPV RL ++LADKAQVCT
Sbjct  61   RKVFRVADHAGVALAGLTADGRVLSRFLRNECINHSFVYEAPLPVSRLALKLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKT+LERRF+ +
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTFLERRFQGY  179



>ref|NP_001241780.1| proteasome subunit alpha type 1 [Zea mays]
 gb|ACG38810.1| proteasome subunit alpha type 1 [Zea mays]
Length=277

 Score =   325 bits (833),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSA +GLRS+TH VLA VNK  SELSS+Q
Sbjct  1    MFRNQYDTDVTTWSPQGRLFQVEYAMEAVKQGSACVGLRSRTHAVLAAVNKPASELSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+F+V DH GVA+AGLTADGRVLSR++RNECIN+S+ YE+PLPV RL ++LADKAQVCT
Sbjct  61   RKVFRVADHAGVALAGLTADGRVLSRFLRNECINHSFVYEAPLPVSRLALRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKT+LERRF+ +
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTFLERRFQGY  179



>ref|XP_004951978.1| PREDICTED: proteasome subunit alpha type-1-like [Setaria italica]
Length=275

 Score =   324 bits (830),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSA +GLRS+TH VLA  NK  SELSS+Q
Sbjct  1    MFRNQYDTDVTTWSPQGRLFQVEYAMEAVKQGSACVGLRSRTHAVLAAANKPASELSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+F+V +H GVA+AGLTADGRVLSR++RNECIN+S+ YE+PLPV RL ++LADKAQVCT
Sbjct  61   RKVFRVAEHAGVALAGLTADGRVLSRFLRNECINHSFVYEAPLPVSRLALRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKT+LERRFE +
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTFLERRFEGY  179



>ref|XP_002451490.1| hypothetical protein SORBIDRAFT_04g002770 [Sorghum bicolor]
 gb|EES04466.1| hypothetical protein SORBIDRAFT_04g002770 [Sorghum bicolor]
Length=270

 Score =   321 bits (822),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGSA +GL S+TH VLA VNK  SELSS+Q
Sbjct  1    MFRNQYDTDVTTWSPQGRLFQVEYAMEAVKQGSACVGLCSRTHAVLAAVNKPASELSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+F+V +H GVA+AGLTADGRVLSR++RNECIN+S+ YE+PLP+ RL ++LADKAQVCT
Sbjct  61   RKVFRVAEHAGVALAGLTADGRVLSRFLRNECINHSFVYEAPLPISRLALKLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKT+LERRF+ + 
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTFLERRFQGYK  180

Query  606  GF  611
             +
Sbjct  181  DY  182



>ref|XP_004961454.1| PREDICTED: proteasome subunit alpha type-1-like [Setaria italica]
Length=267

 Score =   320 bits (821),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVT WSPAGRLFQVEYAMEAVKQGSA +GL S+ HVVLA VNKA SELSSHQ
Sbjct  1    MFRNQYDTDVTMWSPAGRLFQVEYAMEAVKQGSACVGLCSQNHVVLASVNKAASELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+F+V DH GVA+AGLTADGRVLSR++RNECIN+S  YE+PLPV RL ++LADKAQVCT
Sbjct  61   RKVFRVADHAGVALAGLTADGRVLSRFLRNECINHSLVYEAPLPVSRLALRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVG LV GLDE+GAHLYYNCPSGNYFEYQAFAIGSRSQ AKT+LERRF+ + 
Sbjct  121  QRSWKRPYGVGFLVAGLDETGAHLYYNCPSGNYFEYQAFAIGSRSQVAKTFLERRFKGYK  180

Query  606  GF  611
             +
Sbjct  181  DY  182



>ref|XP_002987541.1| hypothetical protein SELMODRAFT_158876 [Selaginella moellendorffii]
 gb|EFJ11377.1| hypothetical protein SELMODRAFT_158876 [Selaginella moellendorffii]
Length=278

 Score =   318 bits (815),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRL QVEYAME VKQGSAA+GL+ KTHVVLA VNKA+SELSS+Q
Sbjct  1    MFRNQYDTDVTTWSPAGRLHQVEYAMEGVKQGSAAVGLKCKTHVVLASVNKASSELSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+FK+D++IGVA+AG+ ADGRVL ++MR+ECI + + +E+PLPV RLVVQ+ADKAQVCT
Sbjct  61   KKLFKIDENIGVAMAGIIADGRVLCKFMRSECIYHQFVFEAPLPVSRLVVQVADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDE+G HLYYNCPSGNY+EY AFAIGSRSQAAKTYLERRFETF
Sbjct  121  QRSWKRPYGVGLLVAGLDEAGPHLYYNCPSGNYYEYYAFAIGSRSQAAKTYLERRFETF  179



>ref|NP_001045808.1| Os02g0133800 [Oryza sativa Japonica Group]
 sp|P52428.1|PSA1_ORYSJ RecName: Full=Proteasome subunit alpha type-1; AltName: Full=20S 
proteasome alpha subunit F; AltName: Full=20S proteasome 
subunit alpha-6; AltName: Full=Proteasome component C2 [Oryza 
sativa Japonica Group]
 dbj|BAA07128.1| proteasome C2 subunit [Oryza sativa]
 dbj|BAF07722.1| Os02g0133800 [Oryza sativa Japonica Group]
 dbj|BAG96186.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98703.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72428.1| hypothetical protein OsI_05746 [Oryza sativa Indica Group]
 gb|EEE56253.1| hypothetical protein OsJ_05275 [Oryza sativa Japonica Group]
Length=270

 Score =   313 bits (802),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSA +GLRS+TH VLA  NKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSACVGLRSRTHAVLAAANKAASELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+F+V DH GVA+AGLTADGRVLSR++R+ECIN+++ Y++PLPV RL ++LADKAQVCT
Sbjct  61   RKVFRVADHAGVALAGLTADGRVLSRFLRSECINHAFVYDAPLPVSRLALRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKT+LERRFE +
Sbjct  121  QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTFLERRFEGY  179



>ref|XP_006646843.1| PREDICTED: proteasome subunit alpha type-1-like [Oryza brachyantha]
Length=264

 Score =   312 bits (799),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSA +GLRS+TH VLA  NKA SELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSACVGLRSRTHAVLAAANKAASELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+F+V DH GVA+AGLTADGRVLSR++R+ECIN+++ Y++PLPV RL ++LADKAQVCT
Sbjct  61   RKVFRVADHAGVALAGLTADGRVLSRFLRSECINHAFVYDAPLPVSRLALRLADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV GLDE+GAHLYYNCPSGNYFEYQAFAIGSRSQAAKT+LERRFE +
Sbjct  121  QRSWKRPYGVGLLVAGLDETGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTFLERRFEGY  179



>ref|XP_002947343.1| 20S proteasome alpha subunit F [Volvox carteri f. nagariensis]
 gb|EFJ51391.1| 20S proteasome alpha subunit F [Volvox carteri f. nagariensis]
Length=283

 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGS  +GL+S THVVLA + ++ SELSS Q
Sbjct  1    MFRNQYDTDVTTWSPQGRLFQVEYAMEAVKQGSCTVGLKSDTHVVLATLKRSQSELSSFQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+FK+DDH+G+AIAGLT DGR L +YMRNECIN+ Y YES +PVGRLV  +ADKAQVCT
Sbjct  61   RKVFKIDDHLGIAIAGLTGDGRSLCKYMRNECINHRYVYESSMPVGRLVRLVADKAQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVGLLV G+D  G HLY  CPSGNY+EY+A AIGSRSQAAKTYLE+ FETF 
Sbjct  121  QRSWKRPYGVGLLVAGVDSQGPHLYSTCPSGNYYEYKAMAIGSRSQAAKTYLEKHFETFP  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_001691250.1| 20S proteasome alpha subunit F [Chlamydomonas reinhardtii]
 gb|EDP04983.1| 20S proteasome alpha subunit F [Chlamydomonas reinhardtii]
Length=278

 Score =   300 bits (768),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GRLFQVEYAMEAVKQGS A+GL+S THVVLA + ++ SELSS Q
Sbjct  1    MFRNQYDTDVTTWSPQGRLFQVEYAMEAVKQGSCAVGLKSGTHVVLATLKRSQSELSSFQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+FK+DDH+G+AIAGLT DGR L +YMRNECIN+ Y YES +P GRLV Q+ADK+QVCT
Sbjct  61   RKVFKIDDHMGIAIAGLTGDGRSLCKYMRNECINFRYIYESAMPTGRLVRQIADKSQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QRSWKRPYGVGLLV G+D +G HL+  CPSGNY+EY+A AIG+RSQAAKTYLE+ FE+F
Sbjct  121  QRSWKRPYGVGLLVAGVDSTGPHLFNTCPSGNYYEYKAHAIGARSQAAKTYLEKHFESF  179



>gb|AES86663.2| 20S proteasome subunit alpha type 1 [Medicago truncatula]
Length=550

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 165/227 (73%), Gaps = 44/227 (19%)
 Frame = +3

Query  45   RSQRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEA------VKQGSAAIGLRSKTHVVLA  206
            R +++ +MFRNQY TD+ TWSPAG  FQVEYAMEA      VKQG AA  LRSKTHVV A
Sbjct  225  RQKKISEMFRNQYHTDIATWSPAGGHFQVEYAMEAEYAMEAVKQGPAATDLRSKTHVVPA  284

Query  207  CVNKANSELSSHQKKI-----------------------------------FKVDDHIGV  281
            CVNKANSELSS QKKI                                   FK+DDHIGV
Sbjct  285  CVNKANSELSSRQKKISEMFRNQYHTDVAPWKWNTPWKRNTPWKQLSKTKIFKIDDHIGV  344

Query  282  AIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQRSWKRPYGVGL  461
            AIAG    GRVLSRYMR+EC+NY+Y+YESPLPVGRLVVQLA+KAQVCTQRSWKRPYGVGL
Sbjct  345  AIAG---HGRVLSRYMRSECVNYNYTYESPLPVGRLVVQLANKAQVCTQRSWKRPYGVGL  401

Query  462  LVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            LV GLDES AHLYYNCPSGNYFEYQA AI SRSQAAKTYLER+F  F
Sbjct  402  LVAGLDESEAHLYYNCPSGNYFEYQAVAIDSRSQAAKTYLERKFNNF  448


 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 64/95 (67%), Gaps = 15/95 (16%)
 Frame = +3

Query  45   RSQRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEA------------VKQGSAAIGLRSK  188
            R +++ +MFRNQY TD+ TWSPAG  FQVEYAMEA            VKQG AA  LRSK
Sbjct  71   RQKKISEMFRNQYHTDIATWSPAGGHFQVEYAMEAEYAMEAEYAMEAVKQGPAATDLRSK  130

Query  189  THVVLACVNKANSELSSHQKKI---FKVDDHIGVA  284
            THVV ACVNKANSELSS QKKI   F+   H  +A
Sbjct  131  THVVPACVNKANSELSSRQKKISEMFRNQYHTDIA  165


 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 64/95 (67%), Gaps = 15/95 (16%)
 Frame = +3

Query  45   RSQRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEA------------VKQGSAAIGLRSK  188
            R +++ +MFRNQY TD+ TWSPAG  FQVEYAMEA            VKQG AA  LRSK
Sbjct  148  RQKKISEMFRNQYHTDIATWSPAGGHFQVEYAMEAEYAMEAEYAMEAVKQGPAATDLRSK  207

Query  189  THVVLACVNKANSELSSHQKKI---FKVDDHIGVA  284
            THVV ACVNKANSELSS QKKI   F+   H  +A
Sbjct  208  THVVPACVNKANSELSSRQKKISEMFRNQYHTDIA  242


 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 59/88 (67%), Gaps = 15/88 (17%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEA------------VKQGSAAIGLRSKTHVVLAC  209
            MFRNQY TDV TWSPAG  FQVEYAMEA            VKQG AA  LRSKTHVV AC
Sbjct  1    MFRNQYHTDVATWSPAGGHFQVEYAMEAEYAMEAEYAMEAVKQGPAATDLRSKTHVVPAC  60

Query  210  VNKANSELSSHQKKI---FKVDDHIGVA  284
            VNKANSELSS QKKI   F+   H  +A
Sbjct  61   VNKANSELSSRQKKISEMFRNQYHTDIA  88



>ref|XP_011396562.1| Proteasome subunit alpha type-1-A [Auxenochlorella protothecoides]
 gb|KFM23688.1| Proteasome subunit alpha type-1-A [Auxenochlorella protothecoides]
Length=764

 Score =   295 bits (754),  Expect = 3e-91, Method: Composition-based stats.
 Identities = 127/184 (69%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   QRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSE  230
            +R+  +    YDTDV TWSP GR+FQ+EYAMEAVKQGSAA+GL+SK   V+A + +A SE
Sbjct  489  ERLAAVAEQLYDTDVVTWSPQGRIFQIEYAMEAVKQGSAAVGLKSKDVAVMATLKRAPSE  548

Query  231  LSSHQKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADK  410
            LSS+Q+K+FK+DDH+G+AI+GLTADGR+L RYMRNEC+N+ + ++SP+P+GRLV QLADK
Sbjct  549  LSSYQRKVFKIDDHMGIAISGLTADGRILCRYMRNECLNHRFVFDSPMPLGRLVRQLADK  608

Query  411  AQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERR  590
            AQV TQRSWKRPYGVGL+V G+DESG H++YNCPSGNY++Y+AFA+G+RSQAAKTY+ER 
Sbjct  609  AQVGTQRSWKRPYGVGLIVAGVDESGPHIFYNCPSGNYYDYRAFAMGARSQAAKTYMERS  668

Query  591  FETF  602
            FETF
Sbjct  669  FETF  672



>ref|XP_005715759.1| 20S core proteasome subunit alpha 6 [Chondrus crispus]
 emb|CDF35940.1| 20S core proteasome subunit alpha 6 [Chondrus crispus]
Length=260

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTD+TT+SP GRL QVEYAMEAVKQGSA +GLRS THVV+A + ++ SEL+SHQ
Sbjct  1    MFRNQYDTDITTYSPQGRLHQVEYAMEAVKQGSAVVGLRSNTHVVMATLKRSASELASHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+  +DDHIGVAIAGLTAD RVLSR+MR EC+N+ Y YE PL + RL + +ADK QV T
Sbjct  61   KKLSVIDDHIGVAIAGLTADARVLSRFMRTECLNHKYVYEEPLALSRLALSVADKCQVST  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR+ KRPYGVGLL+ G D++G HL+  CPSGNY+EY A AIGSRSQ AKTYLER FE +
Sbjct  121  QRASKRPYGVGLLIAGYDQTGPHLFQTCPSGNYYEYMAMAIGSRSQGAKTYLERTFEQY  179



>ref|XP_005839084.1| 20S proteasome subunit alpha type 1 [Guillardia theta CCMP2712]
 gb|EKX52104.1| 20S proteasome subunit alpha type 1 [Guillardia theta CCMP2712]
Length=255

 Score =   276 bits (706),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSP GR+ QVEYAMEAVKQGSA +G++SKTH VL  + ++ +++SS+Q
Sbjct  1    MFRNQYDTDVTTWSPQGRIHQVEYAMEAVKQGSACVGVKSKTHAVLTALKRSTNDMSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVD+H+G+AI+GLTAD R L  YMR EC+ + Y YESP+PV RLV+ +ADK Q CT
Sbjct  61   KKIFKVDEHMGIAISGLTADARSLCMYMRTECLQHKYVYESPVPVQRLVIDIADKCQGCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q +  RPYGVGLLV G+D++G H+YYNCPSGNY+EY+A  IG+RSQAAKTYLE+ F +F
Sbjct  121  QSASARPYGVGLLVAGMDQTGPHVYYNCPSGNYYEYKAMTIGARSQAAKTYLEKHFASF  179



>gb|EMT13225.1| Proteasome subunit alpha type-1 [Aegilops tauschii]
Length=263

 Score =   275 bits (704),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  141  MEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQKKIFKVDDHIGVAIAGLTADGRVLS  320
            MEAVKQGSA +GLRS TH VLA  NK+ +ELSSHQ+K+F+V DH GVA+AGLTADGRVLS
Sbjct  1    MEAVKQGSACVGLRSATHAVLAAANKSANELSSHQRKVFRVADHAGVALAGLTADGRVLS  60

Query  321  RYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQRSWKRPYGVGLLVGGLDESGAHLY  500
            R++RNECIN+++ Y++PLPV RL ++LADKAQVCTQRSWKRPYGVGLLV GLDESGAHLY
Sbjct  61   RFLRNECINHAFVYDAPLPVSRLALRLADKAQVCTQRSWKRPYGVGLLVAGLDESGAHLY  120

Query  501  YNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFMGF  611
            YNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE F  +
Sbjct  121  YNCPSGNYFEYQAFAIGSRSQAAKTYLERRFEKFNAY  157



>ref|XP_005646283.1| 20S proteasome alpha subunit F [Coccomyxa subellipsoidea C-169]
 gb|EIE21739.1| 20S proteasome alpha subunit F [Coccomyxa subellipsoidea C-169]
Length=279

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DV TWSP GR+ Q+EYAMEAVKQGSA +GL+S THVVLA + + ++EL + Q
Sbjct  1    MFRNQYDQDVVTWSPQGRIHQIEYAMEAVKQGSAVVGLKSTTHVVLASIKRTSAELGAFQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFK+DDH+G+ ++GL +DGR +SR++RNEC+++ + +E P+ V RLV  LAD+AQV T
Sbjct  61   RKIFKIDDHLGIGVSGLISDGRSISRFLRNECLSHRFVFEQPIQVARLVRDLADRAQVAT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRSWKRPYGVG+L  G D++GAHL+YNCPSG Y++Y+A AIG+RSQAAKTYLER FE F 
Sbjct  121  QRSWKRPYGVGVLAAGHDKTGAHLFYNCPSGAYYDYKAMAIGARSQAAKTYLERNFEEFA  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_004342791.2| 20S proteasome alpha6 subunit [Capsaspora owczarzaki ATCC 30864]
 gb|KJE98188.1| 20S proteasome alpha6 subunit [Capsaspora owczarzaki ATCC 30864]
Length=340

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD D+TTWSP GR+ Q+EYAMEAVKQGS A+GL+SK + V+  + +++SELS+HQ
Sbjct  46   MFRNQYDNDITTWSPQGRIHQIEYAMEAVKQGSCAVGLKSKQYAVIVALKRSSSELSAHQ  105

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +KIFK+DDH+G+AI+GLT+D RVLS++MRNEC+N  Y +E+PLPV RL+  + DK QVCT
Sbjct  106  RKIFKLDDHVGIAISGLTSDARVLSKFMRNECLNSRYVFEAPLPVSRLISSVGDKTQVCT  165

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR+ +RPYGVGLLV G DESG H+Y  CPS NY++ +A +IG+RSQ+AKTYLER FE F
Sbjct  166  QRAGRRPYGVGLLVAGFDESGTHIYQTCPSSNYYDCKAMSIGARSQSAKTYLERHFEEF  224



>ref|XP_003604466.1| Proteasome subunit alpha type [Medicago truncatula]
Length=817

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 152/188 (81%), Gaps = 12/188 (6%)
 Frame = +3

Query  45   RSQRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKAN  224
            R +++ +MFRNQY TDV    PA    +        K  SAAIGLRSKTHVVLACVNKAN
Sbjct  485  RQKKISEMFRNQYHTDVQ--GPAATDLRS-------KTHSAAIGLRSKTHVVLACVNKAN  535

Query  225  SELSSHQKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLA  404
            SEL  HQ KIFK+DDHIGVAIAG    GRVLSRYMR+EC+NY+Y+YESPLPVGRLVVQLA
Sbjct  536  SELYYHQTKIFKIDDHIGVAIAG---HGRVLSRYMRSECVNYNYTYESPLPVGRLVVQLA  592

Query  405  DKAQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLE  584
            +KAQVCTQRSWKRPYGVGLLV GLDES AHLYYNCPSGNYFEYQA AI SRSQAAKTYLE
Sbjct  593  NKAQVCTQRSWKRPYGVGLLVAGLDESEAHLYYNCPSGNYFEYQAVAIDSRSQAAKTYLE  652

Query  585  RRFETFMG  608
            R+F  F  
Sbjct  653  RKFNNFTA  660


 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 64/95 (67%), Gaps = 15/95 (16%)
 Frame = +3

Query  45   RSQRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEA------------VKQGSAAIGLRSK  188
            R +++ +MFRNQY TDV TWSPAG  FQVEYAMEA            VKQG AA  LRSK
Sbjct  183  RQKKISEMFRNQYHTDVATWSPAGGHFQVEYAMEAEYAMEAEYAMEAVKQGPAATDLRSK  242

Query  189  THVVLACVNKANSELSSHQKKI---FKVDDHIGVA  284
            THVV ACVNKANSELSS QKKI   F+   H  +A
Sbjct  243  THVVPACVNKANSELSSRQKKISEMFRNQYHTDIA  277


 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 64/95 (67%), Gaps = 15/95 (16%)
 Frame = +3

Query  45   RSQRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEA------------VKQGSAAIGLRSK  188
            R +++ +MFRNQY TD+ TWSPAG  FQVEYAMEA            VKQG AA  LRSK
Sbjct  260  RQKKISEMFRNQYHTDIATWSPAGGHFQVEYAMEAEYAMEAEYAMEAVKQGPAATDLRSK  319

Query  189  THVVLACVNKANSELSSHQKKI---FKVDDHIGVA  284
            THVV ACVNKANSELSS QKKI   F+   H  +A
Sbjct  320  THVVPACVNKANSELSSRQKKISEMFRNQYHTDIA  354


 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 64/95 (67%), Gaps = 15/95 (16%)
 Frame = +3

Query  45   RSQRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEA------------VKQGSAAIGLRSK  188
            R +++ +MFRNQY TD+ TWSPAG  FQVEYAMEA            VKQG AA  LRSK
Sbjct  337  RQKKISEMFRNQYHTDIATWSPAGGHFQVEYAMEAEYAMEAEYAMEAVKQGPAATDLRSK  396

Query  189  THVVLACVNKANSELSSHQKKI---FKVDDHIGVA  284
            THVV ACVNKANSELSS QKKI   F+   H  +A
Sbjct  397  THVVPACVNKANSELSSRQKKISEMFRNQYHTDIA  431


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 39/60 (65%), Gaps = 5/60 (8%)
 Frame = +3

Query  117  RLF-QVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQKKI---FKVDDHIGVA  284
            RLF  +E   EA+    AA  LRSKTHVV ACVNKANSELSS QKKI   F+   H  VA
Sbjct  142  RLFCALERKHEAL-SSLAATDLRSKTHVVPACVNKANSELSSRQKKISEMFRNQYHTDVA  200



>ref|XP_004367445.1| 20S proteasome alpha subunit F, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20420.1| 20S proteasome alpha subunit F, putative [Acanthamoeba castellanii 
str. Neff]
Length=249

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFR+QYD+D+TTWSP GRL+Q+E+AMEAVKQGSA +GLRSKTH VL  + +++ +L+S+Q
Sbjct  1    MFRSQYDSDITTWSPQGRLYQIEFAMEAVKQGSACVGLRSKTHAVLVTLKRSSGQLASYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFK+DDH+ +AIAGLT+D RVL RYM+ E +N+ Y YESP+ VGRLV+++ADK+Q  T
Sbjct  61   KKIFKIDDHMAIAIAGLTSDARVLCRYMQTEALNHKYVYESPVQVGRLVLRVADKSQKNT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR   RPYGVGLLV G D++GAHLY  CPSGNYFEY+A AIG+R+Q+A+TYLE++F  F
Sbjct  121  QRYGSRPYGVGLLVAGYDQTGAHLYETCPSGNYFEYKAQAIGARAQSARTYLEKKFPEF  179



>ref|XP_789764.2| PREDICTED: proteasome subunit alpha type-1-like [Strongylocentrotus 
purpuratus]
Length=183

 Score =   261 bits (666),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A+SELSSHQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRASSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDHIG++IAGLT+D R+LS++MR EC+N  Y+YE+PLPV RLV ++ +K+Q+ T
Sbjct  61   KKIIPIDDHIGISIAGLTSDARMLSKFMRTECLNSRYAYETPLPVSRLVSEIGNKSQINT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G DE G H++  CPS NYF+ +  AIG+RSQ+A+TYLE++ + F
Sbjct  121  QRYGRRPYGVGLLVAGYDEMGPHIFQTCPSANYFDCKCMAIGARSQSARTYLEKKIDDF  179



>gb|KDR22485.1| Proteasome subunit alpha type-1 [Zootermopsis nevadensis]
Length=277

 Score =   263 bits (673),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL+S TH VL  + +A+SELS+HQ
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKSNTHAVLIALKRASSELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +D HIG+AIAGLTAD R+LSRYMR EC+N+ YS+++ LPVGRL+  L +K Q+CT
Sbjct  61   KKIIPIDTHIGIAIAGLTADARILSRYMRTECLNHKYSHDALLPVGRLITNLGNKMQICT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A A+GSRSQ+A+TYLE+  + F+
Sbjct  121  QRYDRRPYGVGLLVSGYDDQGPHVYQTCPSANYFDCKAMAVGSRSQSARTYLEKHLDEFL  180



>ref|XP_001607375.1| PREDICTED: proteasome subunit alpha type-1-like [Nasonia vitripennis]
Length=285

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++KTH V+  + +A SELSSHQ
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKTHAVIVALKRATSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIF +D H+G+A++GLTAD R+LSRYMR EC+NY YS+++ LPV RL+  L +K Q CT
Sbjct  61   KKIFPIDKHVGIAMSGLTADARMLSRYMRTECLNYKYSHDNTLPVSRLITTLGNKMQTCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+    F+
Sbjct  121  QRYDRRPYGVGLLVAGYDDQGPHIYQTCPSANYFDCKAMAIGARSQSARTYLEKHLSEFL  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_002422679.1| proteasome subunit alpha type, putative [Pediculus humanus corporis]
 gb|EEB09941.1| proteasome subunit alpha type, putative [Pediculus humanus corporis]
Length=293

 Score =   262 bits (670),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  42   YRSQRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKA  221
            Y  + V K FRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++KTH VL  + +A
Sbjct  6    YLIENVVKTFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKTHAVLIALKRA  65

Query  222  NSELSSHQKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQL  401
            +SELS+HQKKI  +D HIG++I+GLTAD R+LSRYMR EC+N+ Y ++  LPV RL+  +
Sbjct  66   SSELSAHQKKIIPIDSHIGISISGLTADARILSRYMRTECLNHKYVHDEELPVSRLITNI  125

Query  402  ADKAQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYL  581
             +K QVCTQR  KRPYGVGLL+ G D+ G H+Y  CPS NYF+ +A AIGSRSQ+A+TYL
Sbjct  126  GNKMQVCTQRYDKRPYGVGLLIAGFDDQGPHIYQTCPSANYFDCKAMAIGSRSQSARTYL  185

Query  582  ERRFETF  602
            E+  E F
Sbjct  186  EKHLEEF  192



>ref|XP_009055927.1| hypothetical protein LOTGIDRAFT_232677 [Lottia gigantea]
 gb|ESO93223.1| hypothetical protein LOTGIDRAFT_232677 [Lottia gigantea]
Length=281

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GRL Q+EYAMEAVKQGSA +G++SKTH VLA + +A SELSSHQ
Sbjct  1    MFRNQYDNDVTVWSPQGRLHQLEYAMEAVKQGSATVGIKSKTHAVLAALKRAPSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDH+GVAIAGLTAD R LS +MR+EC+N  Y+Y SPLPV RLV  L  K+Q+ T
Sbjct  61   KKILSIDDHVGVAIAGLTADARSLSNFMRSECLNSRYAYNSPLPVSRLVSMLGSKSQILT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RP+GVGLLV G D  G H+Y  CPS NY++ +A AIG+RSQ+A+TYLER+ + F
Sbjct  121  QRYGRRPFGVGLLVAGYDSMGPHIYQTCPSANYYDCKAMAIGARSQSARTYLERKLDEF  179



>gb|EFA79106.1| 20S proteasome subunit C2 [Polysphondylium pallidum PN500]
Length=258

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RNQYD+D+TT+SP+GR+ Q+EYAMEAVKQGSAA+ L+SK + VL  + +++SEL S+Q
Sbjct  1    MYRNQYDSDITTFSPSGRIHQIEYAMEAVKQGSAAVALKSKQYAVLVSLKRSSSELGSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIF VDDHIG+AI+GLTAD RVL  YMRNEC NY Y YES + V RLV ++ADK+QV T
Sbjct  61   KKIFVVDDHIGIAISGLTADARVLCNYMRNECANYKYVYESDMRVERLVTKVADKSQVHT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLLV G D++GAH+Y  CPSGN++ Y++ +IG+RSQ+AKTYLE+ FE F 
Sbjct  121  QRYGRRPYGVGLLVAGYDQTGAHIYQTCPSGNFYSYKSISIGARSQSAKTYLEKHFEAFE  180

Query  606  G  608
            G
Sbjct  181  G  181



>ref|XP_002681735.1| 20S proteosome alpha subunit [Naegleria gruberi]
 gb|EFC48991.1| 20S proteosome alpha subunit [Naegleria gruberi]
Length=219

 Score =   258 bits (658),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKA-NSELSSH  242
            MFRNQYDTD+TTWSP GRL QVEYAMEAV+QGSAA+GL+SK  VVLA + +A ++ELSS+
Sbjct  1    MFRNQYDTDITTWSPQGRLHQVEYAMEAVQQGSAAVGLKSKDFVVLATLKRAPHAELSSY  60

Query  243  QKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVC  422
            QKK+FK+DDHIG+AIAGL ADGRVLS+YMRNEC+++ Y +E+P+PV RL  ++ADK+Q  
Sbjct  61   QKKLFKIDDHIGIAIAGLAADGRVLSKYMRNECMSHQYVFETPVPVQRLASKIADKSQKS  120

Query  423  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            TQ S  RP+GVGLLVGG DE+GAHLY  CPSGN + Y+A AIG+RSQ+AKTY E+ ++TF
Sbjct  121  TQSSSGRPFGVGLLVGGYDETGAHLYQTCPSGNLYSYKAIAIGARSQSAKTYFEKHYDTF  180



>ref|XP_008546608.1| PREDICTED: proteasome subunit alpha type-1 [Microplitis demolitor]
 gb|EZA46213.1| Proteasome subunit alpha type-1 [Microplitis demolitor]
Length=278

 Score =   260 bits (664),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++K + VL  + +A+SELS++Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKEYAVLIALKRASSELSAYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +D H+G++IAGLTAD R+LSRYMR EC+NY YS++ PLPVGRL+  L +K Q CT
Sbjct  61   KKIIPIDKHMGISIAGLTADARMLSRYMRTECLNYKYSHDDPLPVGRLIATLGNKMQTCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A AIGSRSQAA+TYLE+    F+
Sbjct  121  QRYDRRPYGVGLLVAGFDDQGPHIYQTCPSANYFDCKAMAIGSRSQAARTYLEKHLNEFL  180



>ref|XP_011256527.1| PREDICTED: proteasome subunit alpha type-1 [Camponotus floridanus]
 gb|EFN68319.1| Proteasome subunit alpha type-1 [Camponotus floridanus]
Length=277

 Score =   259 bits (663),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++KTH VL  + +A+SELS+HQ
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKTHAVLIALKRASSELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +D H+G++I+GLTAD R+LSRYMR EC+NY Y+++  LPV RL+  L +K Q CT
Sbjct  61   KKIIPIDKHMGISISGLTADARILSRYMRTECLNYKYAHDDTLPVSRLITSLGNKMQTCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLLVGG D+ G H+Y  CPS N+F+ +A AIGSRSQ+A+TYLE+    F+
Sbjct  121  QRYDRRPYGVGLLVGGYDDQGPHIYQTCPSANFFDCKAMAIGSRSQSARTYLEKHLSEFL  180



>gb|ELT94608.1| hypothetical protein CAPTEDRAFT_178575 [Capitella teleta]
Length=279

 Score =   259 bits (663),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S+TH VL  + +A SELS+HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSRTHAVLVALKRAASELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +D+H+GV+IAGLTAD R+LS+Y+R EC+N  Y+Y+SP+P+ RLV  + +K+Q+ T
Sbjct  61   KKILPIDNHVGVSIAGLTADARLLSKYLRTECLNSKYAYDSPMPISRLVSMIGNKSQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+  +TF+
Sbjct  121  QRYGRRPYGVGLLVAGYDDQGPHIYQTCPSANYFDCKAMAIGARSQSARTYLEKHLDTFL  180



>dbj|BAD08003.1| putative Proteasome subunit alpha type 1 [Oryza sativa Japonica 
Group]
 dbj|BAD10085.1| putative Proteasome subunit alpha type 1 [Oryza sativa Japonica 
Group]
Length=245

 Score =   258 bits (660),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  141  MEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQKKIFKVDDHIGVAIAGLTADGRVLS  320
            MEAVKQGSA +GLRS+TH VLA  NKA SELSSHQ+K+F+V DH GVA+AGLTADGRVLS
Sbjct  1    MEAVKQGSACVGLRSRTHAVLAAANKAASELSSHQRKVFRVADHAGVALAGLTADGRVLS  60

Query  321  RYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQRSWKRPYGVGLLVGGLDESGAHLY  500
            R++R+ECIN+++ Y++PLPV RL ++LADKAQVCTQRSWKRPYGVGLLV GLDESGAHLY
Sbjct  61   RFLRSECINHAFVYDAPLPVSRLALRLADKAQVCTQRSWKRPYGVGLLVAGLDESGAHLY  120

Query  501  YNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            YNCPSGNYFEYQAFAIGSRSQAAKT+LERRFE +
Sbjct  121  YNCPSGNYFEYQAFAIGSRSQAAKTFLERRFEGY  154



>ref|XP_011172575.1| PREDICTED: proteasome subunit alpha type-1-like isoform X2 [Solenopsis 
invicta]
Length=284

 Score =   259 bits (662),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +3

Query  63   KMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSH  242
            + FRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL+SKTH VL  + +A+SELS+H
Sbjct  6    QQFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKSKTHAVLIALKRASSELSAH  65

Query  243  QKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVC  422
            QKKI  +D H+G++I+GLTAD R+LSRYMR EC+NY Y+++  LPVGRL+  L +K Q C
Sbjct  66   QKKIIPIDKHMGISISGLTADARILSRYMRTECLNYKYAHDDTLPVGRLITSLGNKMQTC  125

Query  423  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            TQR  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+    F
Sbjct  126  TQRYDRRPYGVGLLVAGYDDQGPHIYQTCPSANYFDCKAMAIGARSQSARTYLEKHLNEF  185

Query  603  M  605
            +
Sbjct  186  L  186



>dbj|GAM21792.1| hypothetical protein SAMD00019534_049670, partial [Acytostelium 
subglobosum LB1]
Length=253

 Score =   258 bits (659),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RNQYD+D+TT+SP+GR+ Q+EYAMEAVKQGSAAI L+SK + VL  + +++SEL S+Q
Sbjct  1    MYRNQYDSDITTFSPSGRIHQIEYAMEAVKQGSAAIALKSKQYAVLISLKRSSSELGSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIF VDDHIG+AI+GLTAD RVL  YMRNEC NY Y YE+ + V RLV ++ADK+QV T
Sbjct  61   KKIFNVDDHIGIAISGLTADARVLCNYMRNECSNYKYVYEADMRVERLVTKVADKSQVHT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D++GAH++  CPSGN++ Y+A +IG+RSQ+AKTYLE+ FE F
Sbjct  121  QRYGRRPYGVGLLVAGYDQTGAHIFQTCPSGNFYSYKAISIGARSQSAKTYLEKHFEVF  179



>ref|XP_011344203.1| PREDICTED: proteasome subunit alpha type-1 [Cerapachys biroi]
 gb|EZA50936.1| Proteasome subunit alpha type-1 [Cerapachys biroi]
Length=278

 Score =   259 bits (661),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++KTH VL  + +A+SELS+HQ
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKTHAVLIALKRASSELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +D H+G++I+GLTAD R+LSRYMR EC+NY Y+++  LPV RL+  L +K Q CT
Sbjct  61   KKIIPIDKHMGISISGLTADARILSRYMRTECLNYKYAHDDTLPVSRLISSLGNKMQTCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A AIGSRSQ+A+TYLE+    F+
Sbjct  121  QRYDRRPYGVGLLVAGYDDQGPHIYQTCPSANYFDCKAMAIGSRSQSARTYLEKHLNEFL  180



>ref|XP_002370508.1| proteasome subunit alpha type 1, putative [Toxoplasma gondii 
ME49]
 gb|EPT25357.1| proteasome subunit alpha type 1, putative [Toxoplasma gondii 
ME49]
 gb|KFG58601.1| putative proteasome subunit alpha type 1 [Toxoplasma gondii RUB]
Length=247

 Score =   258 bits (658),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RN YDTD  TWSP GR+FQVEYAMEAVKQG+  +GLRS THVVL  + +A S+ + H 
Sbjct  1    MYRNLYDTDCITWSPQGRIFQVEYAMEAVKQGTCCVGLRSNTHVVLCSLKRAVSKFAGHH  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+FK+DDH+GVA++G+TAD +V+S +MRNEC ++ Y Y++P+PVGRLV+ +ADK+Q  T
Sbjct  61   QKLFKIDDHVGVAMSGITADAKVISNFMRNECFHHKYVYDAPIPVGRLVLMVADKSQANT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRS KRP+GVGLL  G D++G HL+  CPSGNYFE  A A G+RSQ++KTYLER FE F 
Sbjct  121  QRSGKRPFGVGLLAAGYDDAGPHLFETCPSGNYFESYAMAFGARSQSSKTYLERNFENFP  180

Query  606  GF  611
            G 
Sbjct  181  GL  182



>ref|XP_011172573.1| PREDICTED: proteasome subunit alpha type-1-like isoform X1 [Solenopsis 
invicta]
Length=295

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL+SKTH VL  + +A+SELS+HQK
Sbjct  19   FRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKSKTHAVLIALKRASSELSAHQK  78

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KI  +D H+G++I+GLTAD R+LSRYMR EC+NY Y+++  LPVGRL+  L +K Q CTQ
Sbjct  79   KIIPIDKHMGISISGLTADARILSRYMRTECLNYKYAHDDTLPVGRLITSLGNKMQTCTQ  138

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            R  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+    F+
Sbjct  139  RYDRRPYGVGLLVAGYDDQGPHIYQTCPSANYFDCKAMAIGARSQSARTYLEKHLNEFL  197



>gb|KDO19917.1| hypothetical protein SPRG_14825 [Saprolegnia parasitica CBS 223.65]
Length=248

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSE-LSSH  242
            MFRNQYDTDVT WSP G L Q++YAMEAVKQGSA +GLRS THVVLA + + N+E L+  
Sbjct  1    MFRNQYDTDVTVWSPQGHLHQIDYAMEAVKQGSACLGLRSSTHVVLAGIKRVNAEQLADP  60

Query  243  QKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVC  422
            QKK+F++D H+G+AIAGLTAD R L+R+MR EC+N+ + Y S LPV RLV  +ADK Q C
Sbjct  61   QKKLFEIDSHMGMAIAGLTADARSLARFMRTECLNHKFVYGSALPVARLVADVADKKQEC  120

Query  423  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            TQ   +RPYGVGLLV G+D++G HL+  CPSGNY+EY A AIG+RSQ+A+TYLE+ FETF
Sbjct  121  TQSYVRRPYGVGLLVAGVDKNGPHLFQTCPSGNYYEYNAIAIGARSQSARTYLEKHFETF  180



>ref|XP_011056444.1| PREDICTED: proteasome subunit alpha type-1 [Acromyrmex echinatior]
Length=277

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL+SKTH VL  + +A+SELS+HQ
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKSKTHAVLIALKRASSELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +D H+G++I+GLTAD R+LSRYMR EC+NY Y+++  LPV RL+  L +K Q CT
Sbjct  61   KKIIPIDKHMGISISGLTADARILSRYMRTECLNYKYAHDHALPVSRLITSLGNKMQTCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+    F+
Sbjct  121  QRYDRRPYGVGLLVAGYDDKGPHIYQTCPSANYFDCKAMAIGARSQSARTYLEKHLNEFL  180



>ref|XP_003886399.1| Proteasome subunit alpha type,related [Neospora caninum Liverpool]
 emb|CBZ56374.1| Proteasome subunit alpha type,related [Neospora caninum Liverpool]
Length=247

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RN YDTD  TWSP GR+FQVEYAMEAVKQG+  +GLRS THVVL  + ++ S+ + H 
Sbjct  1    MYRNLYDTDCITWSPQGRIFQVEYAMEAVKQGTCCVGLRSDTHVVLCSLKRSVSKFAGHH  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+FK+DDH+GVA++G+TAD +V+S +MRNEC ++ Y Y++P+PVGRLV+ +ADK+Q  T
Sbjct  61   QKLFKIDDHVGVAMSGITADAKVISNFMRNECFHHKYVYDAPIPVGRLVLMVADKSQANT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRS KRP+GVGLL  G D++G HL+  CPSGNYFE  A A G+RSQ++KTYLER FE+F 
Sbjct  121  QRSGKRPFGVGLLAAGFDDAGPHLFETCPSGNYFESYAMAFGARSQSSKTYLERNFESFP  180

Query  606  GF  611
            G 
Sbjct  181  GL  182



>gb|EPR63227.1| putative proteasome subunit alpha type 1 [Toxoplasma gondii GT1]
 gb|ESS28107.1| putative proteasome subunit alpha type 1 [Toxoplasma gondii VEG]
Length=247

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RN YDTD  TWSP GR+FQVEYAMEAVKQG+  +GLRS THVVL  + +A S+ + H 
Sbjct  1    MYRNLYDTDCITWSPQGRIFQVEYAMEAVKQGTCCVGLRSDTHVVLCSLKRAVSKFAGHH  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+FK+DDH+GVA++G+TAD +V+S +MRNEC ++ Y Y++P+PVGRLV+ +ADK+Q  T
Sbjct  61   QKLFKIDDHVGVAMSGITADAKVISNFMRNECFHHKYVYDAPIPVGRLVLMVADKSQANT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRS KRP+GVGLL  G D++G HL+  CPSGNYFE  A A G+RSQ++KTYLER FE F 
Sbjct  121  QRSGKRPFGVGLLAAGYDDAGPHLFETCPSGNYFESYAMAFGARSQSSKTYLERNFENFP  180

Query  606  GF  611
            G 
Sbjct  181  GL  182



>ref|XP_008887077.1| proteasome subunit alpha type 1, putative [Hammondia hammondi]
 gb|KEP62237.1| proteasome subunit alpha type 1, putative [Hammondia hammondi]
Length=247

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RN YDTD  TWSP GR+FQVEYAMEAVKQG+  +GLRS THVVL  + +A S+ + H 
Sbjct  1    MYRNLYDTDCITWSPQGRIFQVEYAMEAVKQGTCCVGLRSDTHVVLCSLKRAVSKFAGHH  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K+FK+DDH+GVA++G+TAD +V+S +MRNEC ++ Y Y++P+PVGRLV+ +ADK+Q  T
Sbjct  61   QKLFKIDDHVGVAMSGITADAKVISNFMRNECFHHKYVYDAPIPVGRLVLMVADKSQANT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QRS KRP+GVGLL  G D++G HL+  CPSGNYFE  A A G+RSQ++KTYLER FE F 
Sbjct  121  QRSGKRPFGVGLLAAGYDDAGPHLFETCPSGNYFESYAMAFGARSQSSKTYLERNFENFP  180

Query  606  GF  611
            G 
Sbjct  181  GL  182



>ref|XP_008607531.1| 20S proteasome subunit alpha 6 [Saprolegnia diclina VS20]
 gb|EQC38707.1| 20S proteasome subunit alpha 6 [Saprolegnia diclina VS20]
Length=248

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSE-LSSH  242
            MFRNQYDTDVT WSP G L Q++YAMEAVKQGSA +GLRS THVVLA + + N+E L+  
Sbjct  1    MFRNQYDTDVTVWSPQGHLHQIDYAMEAVKQGSACLGLRSATHVVLAGIKRVNAEQLADP  60

Query  243  QKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVC  422
            QKK+F++D H+G+AIAGLTAD R L+R+MR EC+N+ + Y S LPV RLV  +ADK Q C
Sbjct  61   QKKLFEIDSHMGMAIAGLTADARSLARFMRTECLNHKFVYGSALPVARLVADVADKKQEC  120

Query  423  TQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            TQ   +RPYGVGLLV G+D++G HL+  CPSGNY+EY A AIG+RSQ+A+TYLE+ FETF
Sbjct  121  TQSYVRRPYGVGLLVAGVDKNGPHLFQTCPSGNYYEYNAIAIGARSQSARTYLEKHFETF  180



>ref|XP_004357665.1| 20S proteasome subunit C2 [Dictyostelium fasciculatum]
 gb|EGG19394.1| 20S proteasome subunit C2 [Dictyostelium fasciculatum]
Length=250

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RNQYD+D+TT+SP+GR+ Q+EYAMEAVKQGSAA+ L+SK + VL  + +++SEL S+Q
Sbjct  1    MYRNQYDSDITTFSPSGRIHQIEYAMEAVKQGSAAVALKSKKYAVLVSLKRSSSELGSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+F VDDHIG+AI+GLTAD RVL  YMRNEC NY Y YES + V RL+ ++ADK+QV T
Sbjct  61   KKLFVVDDHIGIAISGLTADARVLCNYMRNECSNYKYIYESDMRVERLITKVADKSQVHT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D++GAH+Y  CPSGNY+ Y+A +IG+RSQ+AKTYLE+ F++F
Sbjct  121  QRYGRRPYGVGLLVAGYDQTGAHVYQTCPSGNYYSYKAISIGARSQSAKTYLEKYFDSF  179



>ref|XP_006616169.1| PREDICTED: proteasome subunit alpha type-1-like isoform X1 [Apis 
dorsata]
 ref|XP_006616170.1| PREDICTED: proteasome subunit alpha type-1-like isoform X2 [Apis 
dorsata]
 ref|XP_006616171.1| PREDICTED: proteasome subunit alpha type-1-like isoform X3 [Apis 
dorsata]
Length=275

 Score =   257 bits (657),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++KTH VL  + +A+SELS+HQ
Sbjct  1    MFRNQYDSDVTIWSPQGRLHQVEYAMEAVKLGSATVGLKNKTHAVLIALKRASSELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIF +D H+G++I+GLTAD R+LSRYMR EC+NY YS++  LPV RL+  L +K Q CT
Sbjct  61   KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  KRPYGVGLL+ G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+     +
Sbjct  121  QRYDKRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  180

Query  606  G  608
             
Sbjct  181  S  181



>ref|XP_966973.1| PREDICTED: proteasome subunit alpha type-1 [Tribolium castaneum]
 gb|EEZ97876.1| hypothetical protein TcasGA2_TC000258 [Tribolium castaneum]
Length=277

 Score =   257 bits (657),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAV  GSA +GL+SKTH VL  + +A+SELS++Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVNLGSATVGLKSKTHAVLIALKRASSELSAYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDHIG+ I+GLTAD R+LSRYMR EC+NY YS+++ LP+ RL+ QL +K Q+CT
Sbjct  61   KKIINIDDHIGITISGLTADARILSRYMRTECLNYKYSHDTHLPLNRLISQLGNKMQLCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D+ GAH+Y  CPS NY++ +A +IG+RSQ+A+TYLE+  E  
Sbjct  121  QRYDRRPYGVGLLVAGYDDQGAHIYQTCPSANYYDCKAMSIGARSQSARTYLEKHLEEL  179



>ref|XP_003283237.1| proteasome subunit alpha type 1 [Dictyostelium purpureum]
 gb|EGC40301.1| proteasome subunit alpha type 1 [Dictyostelium purpureum]
Length=248

 Score =   256 bits (653),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RNQYD+D+TT+SP+GR+ QVEYAMEAVKQG AA+ L+SK + VL  + +++SEL S+Q
Sbjct  1    MYRNQYDSDITTFSPSGRIHQVEYAMEAVKQGGAAVALKSKQYAVLVSLKRSSSELGSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIF VDDH+G+AI+GLTAD R+L  YMRNEC NY+Y YE+ + V RLV ++ADK QV T
Sbjct  61   KKIFVVDDHVGIAISGLTADARMLCNYMRNECANYNYVYENQMRVERLVTKVADKHQVHT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D+ GAH+Y  CPSGN+++Y++ +IGSRSQ+AKTYLE+ FE+F
Sbjct  121  QRYGRRPYGVGLLVAGFDQLGAHIYQTCPSGNFYDYKSISIGSRSQSAKTYLEKHFESF  179



>ref|XP_006571536.1| PREDICTED: proteasome subunit alpha type-1-like [Apis mellifera]
Length=276

 Score =   257 bits (656),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++KTH VL  + +A+SELS+HQ
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKTHAVLIALKRASSELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIF +D H+G++I+GLTAD R+LSRYMR EC+NY YS++  LPV RL+  L +K Q CT
Sbjct  61   KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+     +
Sbjct  121  QRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  180

Query  606  G  608
             
Sbjct  181  S  181



>ref|XP_011137774.1| PREDICTED: proteasome subunit alpha type-1 [Harpegnathos saltator]
Length=279

 Score =   256 bits (655),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL+++TH VL  + +A+SELS++Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNQTHAVLIALKRASSELSAYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +D H+G++I+GLTAD R+LSRYMR EC+NY YS++  LP+GRL+  L +K Q CT
Sbjct  61   KKIIPIDKHMGISISGLTADARILSRYMRTECLNYKYSHDDTLPIGRLIASLGNKMQTCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+    F+
Sbjct  121  QRYDRRPYGVGLLVAGYDDQGPHIYQTCPSANYFDCKAMAIGARSQSARTYLEKHLNEFL  180



>ref|XP_003695504.1| PREDICTED: proteasome subunit alpha type-1-like [Apis florea]
Length=277

 Score =   256 bits (654),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++KTH VL  + +A+SELS+HQ
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKTHAVLIALKRASSELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIF +D H+G++I+GLTAD R+LSRYMR EC+NY YS++  LPV RL+  L +K Q CT
Sbjct  61   KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+     +
Sbjct  121  QRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  180

Query  606  G  608
             
Sbjct  181  S  181



>gb|EGI64149.1| Proteasome subunit alpha type-1 [Acromyrmex echinatior]
Length=276

 Score =   256 bits (654),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL+SKTH VL  + +A+SELS+HQK
Sbjct  1    FRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKSKTHAVLIALKRASSELSAHQK  60

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KI  +D H+G++I+GLTAD R+LSRYMR EC+NY Y+++  LPV RL+  L +K Q CTQ
Sbjct  61   KIIPIDKHMGISISGLTADARILSRYMRTECLNYKYAHDHALPVSRLITSLGNKMQTCTQ  120

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            R  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+    F+
Sbjct  121  RYDRRPYGVGLLVAGYDDKGPHIYQTCPSANYFDCKAMAIGARSQSARTYLEKHLNEFL  179



>ref|XP_004922650.1| PREDICTED: proteasome subunit alpha type-1-like [Bombyx mori]
Length=276

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA IGL++K + VL  + +A SELS++Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATIGLKNKDYAVLIALKRAVSELSAYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +D+HIG++I+GLTAD R+LSRYMR EC+N+ YS+++P+PVGRL+  + +K Q+CT
Sbjct  61   KKIIPIDEHIGISISGLTADARMLSRYMRTECLNHRYSHDAPMPVGRLISSVGNKMQICT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  KRP GVGLLV G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+   TFM
Sbjct  121  QRYDKRPLGVGLLVAGYDDQGPHIYQTCPSANYFDCRAMAIGARSQSARTYLEKHLNTFM  180



>ref|XP_008475286.1| PREDICTED: proteasome subunit alpha type-1-like [Diaphorina citri]
Length=277

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVKQGSA +GL++KTH V+  + +A SEL++HQ
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKQGSATVGLKNKTHAVIIALKRAASELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDH+G++ AGLTAD R+L+R+MR EC+NY Y+++  LPV RL+  + +K QVCT
Sbjct  61   KKIIVIDDHMGLSFAGLTADARILARFMRMECLNYKYAHKDTLPVFRLISIVGNKMQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  KRPYGVGLLV G D++G H+Y  CPS NY++ +A AIGSRSQ+A+TYLE+R   F
Sbjct  121  QRYDKRPYGVGLLVAGYDDAGPHIYQTCPSSNYYDVKAMAIGSRSQSARTYLEKRLADF  179



>ref|XP_011439711.1| PREDICTED: proteasome subunit alpha type-1-like [Crassostrea 
gigas]
Length=280

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SK+H +L  + +A+SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKSHAILVALKRASSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDHIGV+IAGLTAD R+LS +MR+EC+N  Y+Y+SPLPV RLV  + +K+Q+ T
Sbjct  61   KKIIPIDDHIGVSIAGLTADARLLSNFMRSECLNSRYAYDSPLPVSRLVSAVGNKSQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RP+GVGLLV G D+ G H+Y  CPS NY++ +A AIG+RSQ+A+TY+E+  + F+
Sbjct  121  QRYGRRPFGVGLLVAGYDDQGPHIYQTCPSANYYDCKAMAIGARSQSARTYVEKHLDKFL  180



>ref|XP_011311364.1| PREDICTED: proteasome subunit alpha type-1 [Fopius arisanus]
Length=278

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++KTH VL  + +A+SELS++Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKTHAVLIALKRASSELSAYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +D H+G++IAGLTAD R+LSRYMR EC+NY YS++  LPV RL+  L +K Q CT
Sbjct  61   KKIIPIDKHMGISIAGLTADARMLSRYMRTECLNYKYSHDDVLPVSRLIATLGNKMQTCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A AIG+RSQ A+TYLE+    F
Sbjct  121  QRYDRRPYGVGLLVAGFDDQGPHIYQTCPSANYFDCKAMAIGARSQGARTYLEKHLNEF  179



>gb|KFM81604.1| Proteasome subunit alpha type-1, partial [Stegodyphus mimosarum]
Length=280

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GRL QVEYAMEAVKQGSA +GL++ TH VL  + +A+SELS+HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRLHQVEYAMEAVKQGSATVGLKNSTHSVLVALKRASSELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +D+H G+AIAGLTAD R+LS+YMR EC+   +S  +PLP+ RLV +L +K QVCT
Sbjct  61   KKIIPIDNHCGIAIAGLTADARLLSKYMRTECLTNRFSRNAPLPINRLVSRLGNKMQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+   TF
Sbjct  121  QRYDRRPYGVGLLVAGFDDLGPHIYQTCPSANYFDCKAMAIGARSQSARTYLEKYLNTF  179



>ref|XP_003392942.1| PREDICTED: proteasome subunit alpha type-1-like [Bombus terrestris]
Length=277

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++K+H VL  + +A+SELS+HQ
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKSHAVLIALKRASSELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIF +D H+G++I+GLTAD R+LSRYMR EC+NY YS++  LPV RL+  L +K Q CT
Sbjct  61   KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+     +
Sbjct  121  QRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  180



>ref|XP_005707022.1| 20S proteasome subunit alpha 6 [Galdieria sulphuraria]
 gb|EME30502.1| 20S proteasome subunit alpha 6 [Galdieria sulphuraria]
Length=252

 Score =   254 bits (648),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTT+SP GRL Q+EYA EAVKQGSA +G+R+K + VLA + +  S+L+S Q
Sbjct  1    MFRNQYDTDVTTFSPQGRLHQIEYAQEAVKQGSAVVGVRNKNYAVLATLKRTTSDLASTQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+FK+DDH+G+AIAGLTAD R+LS+YMR EC+NY Y YE  +P+ RLV+++ADK Q+ T
Sbjct  61   KKLFKIDDHVGMAIAGLTADARLLSKYMRTECLNYKYVYECAMPLSRLVLRVADKHQIAT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  KRP+GVGLL+ G D+ G HLY   PSG Y+EYQA +IG+R+Q+A+TYLE+ FET 
Sbjct  121  QRVSKRPFGVGLLIIGYDQQGPHLYETSPSGEYWEYQAMSIGARAQSARTYLEKVFETL  179



>ref|XP_001663312.1| AAEL013089-PA [Aedes aegypti]
 gb|EAT34701.1| AAEL013089-PA [Aedes aegypti]
Length=253

 Score =   253 bits (647),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++K + VL  + +A+SELSS+Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKDYAVLIALKRASSELSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDH+G++IAG+TAD R+LSRYMR EC+NY YSY+   PVGRL+  + +K QVCT
Sbjct  61   KKIISIDDHLGISIAGITADARILSRYMRQECLNYKYSYDDNYPVGRLIANVGNKMQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D+ G H+Y  CPS N+F+ +A +IGSRSQ+A+TYLE+    F
Sbjct  121  QRYDRRPYGVGLLVAGYDDQGPHIYQTCPSANFFDCKAMSIGSRSQSARTYLEKHLNEF  179



>ref|XP_640037.1| 20S proteasome subunit C2 [Dictyostelium discoideum AX4]
 sp|Q27562.1|PSA1_DICDI RecName: Full=Proteasome subunit alpha type-1; AltName: Full=Proteasome 
subunit C2 [Dictyostelium discoideum]
 gb|AAB03506.1| PrtC [Dictyostelium discoideum]
 gb|EAL66041.1| 20S proteasome subunit C2 [Dictyostelium discoideum AX4]
Length=248

 Score =   253 bits (646),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RNQYD+D+TT+SP+GR+ Q+EYAMEAVKQG AA+ L+SK   VL  + +++SEL S+Q
Sbjct  1    MYRNQYDSDITTFSPSGRIHQIEYAMEAVKQGGAAVALKSKQFAVLVSLKRSSSELGSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIF VDDH+G+AI+GLTAD R+L  YMRNEC NY+Y YES + V RLV ++ADK QV T
Sbjct  61   KKIFVVDDHVGIAISGLTADARMLCNYMRNECSNYNYVYESQMRVERLVTKVADKHQVHT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D+ GAH+Y  CPSGN+++Y++ +IGSRSQ+AKTYLE+ FE+F
Sbjct  121  QRYGRRPYGVGLLVAGYDQLGAHIYQTCPSGNFYDYKSISIGSRSQSAKTYLEKHFESF  179



>ref|XP_003489898.1| PREDICTED: proteasome subunit alpha type-1-like [Bombus impatiens]
Length=278

 Score =   254 bits (648),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++KTH VL  + +A+SELS+HQK
Sbjct  3    FRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKTHAVLIALKRASSELSAHQK  62

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KIF +D H+G++I+GLTAD R+LSRYMR EC+NY YS++  LPV RL+  L +K Q CTQ
Sbjct  63   KIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCTQ  122

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            R  +RPYGVGLL+ G D+ G H+Y  CPS NYF+ +A AIG+RSQ+A+TYLE+     +
Sbjct  123  RYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  181



>ref|XP_001650228.1| AAEL015007-PA [Aedes aegypti]
 gb|EAT32763.1| AAEL015007-PA [Aedes aegypti]
Length=275

 Score =   254 bits (648),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++K + VL  + +A+SELSS+Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKDYAVLIALKRASSELSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDH+G++IAG+TAD R+LSRYMR EC+NY YSY+   PVGRL+  + +K QVCT
Sbjct  61   KKIISIDDHLGISIAGITADARILSRYMRQECLNYKYSYDDNYPVGRLIANVGNKMQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D+ G H+Y  CPS N+F+ +A +IGSRSQ+A+TYLE+    F
Sbjct  121  QRYDRRPYGVGLLVAGYDDQGPHIYQTCPSANFFDCKAMSIGSRSQSARTYLEKHLNEF  179



>gb|EFX71454.1| hypothetical protein DAPPUDRAFT_308807 [Daphnia pulex]
Length=285

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ QVEYAMEAVKQGSA IGL+SKTH  +  + +A SELS++Q
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQVEYAMEAVKQGSATIGLKSKTHAAIVALKRATSELSAYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +D H+G+ IAGLTAD R LSRYMR EC+N+ YS++ PLPV RL+  L +K QVCT
Sbjct  61   KKIIPIDTHMGMTIAGLTADARFLSRYMRTECLNHRYSHDEPLPVSRLIGNLGNKLQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLLV G D  G H+Y  CPS  YF+ +A AIG+RSQ+A+TYLE+    FM
Sbjct  121  QRYDRRPYGVGLLVAGYDSKGPHIYQTCPSATYFDCKAMAIGARSQSARTYLEKHLNEFM  180



>ref|XP_011498365.1| PREDICTED: proteasome subunit alpha type-1 [Ceratosolen solmsi 
marchali]
Length=285

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++KTH V+  + +A SELSSHQ
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKMGSATVGLKNKTHAVIVALKRAASELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIF +D H+G A++GLTAD R+LSRYMR EC+NY YS+++ LPV RL+  + +K Q CT
Sbjct  61   KKIFPIDIHVGFAMSGLTADARMLSRYMRTECLNYKYSHDNTLPVSRLITTVGNKMQSCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D+ G H+Y  CPS NY++ +A AIG+RSQ+A+TYLE+    F
Sbjct  121  QRYDRRPYGVGLLVAGYDDQGPHIYQTCPSANYYDCKAMAIGARSQSARTYLEKHLTEF  179



>ref|XP_001842520.1| proteasome subunit alpha type 1 [Culex quinquefasciatus]
 gb|EDS45006.1| proteasome subunit alpha type 1 [Culex quinquefasciatus]
Length=282

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++K + VL  + +A+SELSS+Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKEYAVLIALKRASSELSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDH+G++IAG+TAD R+LSRYMR EC+NY YSY+   PVGRL+  + +K QVCT
Sbjct  61   KKIISIDDHLGISIAGITADARILSRYMRQECLNYKYSYDDNYPVGRLIANVGNKMQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D+ G H+Y  CPS N+F+ +A +IGSRSQ+A+TYLE+    F
Sbjct  121  QRYDRRPYGVGLLVAGYDDQGPHIYQTCPSANFFDCKAMSIGSRSQSARTYLEKHLAQF  179



>dbj|BAM18671.1| proteasome 35kD subunit [Papilio xuthus]
Length=274

 Score =   252 bits (644),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL+SK   VL  + +A SELS++Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKSKQFAVLIALKRAVSELSAYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDHIG++I+GLTAD R+LSR+MR EC+NY YS+++ +PVGRL+  + +K Q+CT
Sbjct  61   KKIIPIDDHIGISISGLTADARMLSRFMRTECLNYRYSHDAQMPVGRLIALVGNKMQICT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  KRP GVGLLV G D+ G H+Y  CPS N+F+ +A AIG+RSQ+A+TYLE+   TFM
Sbjct  121  QRYDKRPLGVGLLVAGYDDQGPHIYQTCPSANFFDCRAMAIGARSQSARTYLEKHLNTFM  180



>gb|ACF82642.1| unknown [Zea mays]
Length=238

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +3

Query  177  LRSKTHVVLACVNKANSELSSHQKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSY  356
             RS TH VLA VNK  SELSS+Q+K+F+V DH GVA+AGLTADGRVLSR++RNECIN+S+
Sbjct  2    FRSSTHAVLAAVNKPASELSSYQRKVFRVADHAGVALAGLTADGRVLSRFLRNECINHSF  61

Query  357  SYESPLPVGRLVVQLADKAQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQ  536
             YE+PLPV RL ++LADKAQVCTQRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQ
Sbjct  62   VYEAPLPVSRLALKLADKAQVCTQRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQ  121

Query  537  AFAIGSRSQAAKTYLERRFETF  602
            AFAIGSRSQAAKT+LERRF+ +
Sbjct  122  AFAIGSRSQAAKTFLERRFQGY  143



>ref|XP_008485407.1| PREDICTED: proteasome subunit alpha type-1-like, partial [Diaphorina 
citri]
Length=232

 Score =   250 bits (639),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD+DVT WSP GRL QVEYAMEAVKQGSA +GL++KTH V+  + +A SEL++HQK
Sbjct  26   FRNQYDSDVTVWSPQGRLHQVEYAMEAVKQGSATVGLKNKTHAVIIALKRAASELAAHQK  85

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KI  +DDH+G++ AGLTAD R+L+R+MR EC+NY Y+++  LPV RL+  + +K QVCTQ
Sbjct  86   KIIVIDDHMGLSFAGLTADARILARFMRMECLNYKYAHKDTLPVFRLISIVGNKMQVCTQ  145

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            R  KRPYGVGLLV G D++G H+Y  CPS NY++ +A AIGSRSQ+A+TYLE+R   F
Sbjct  146  RYDKRPYGVGLLVAGYDDAGPHIYQTCPSSNYYDVKAMAIGSRSQSARTYLEKRLADF  203



>ref|XP_002141867.1| proteasome subunit alpha type 1 [Cryptosporidium muris RN66]
 gb|EEA07518.1| proteasome subunit alpha type 1, putative [Cryptosporidium muris 
RN66]
Length=261

 Score =   251 bits (641),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RNQYDTDV TWSP GR+FQ+EYAMEAVKQG+A IG R+   VVLAC+ +  S+L+  Q
Sbjct  1    MYRNQYDTDVVTWSPQGRVFQIEYAMEAVKQGTAVIGARNNDIVVLACIKRNISKLAGFQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK++K+DDHIG A++G+TAD +VL  Y+R EC+N+S++++SP+P+ RLV  +  K+Q+CT
Sbjct  61   KKLYKIDDHIGAAMSGITADAKVLCSYLRYECLNHSFTFDSPMPLSRLVSNMGLKSQICT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RP+GVGLL+ G D+ G HLY  CPSGNYFEY A A+GSR QA KTYLER FE F
Sbjct  121  QEYGRRPFGVGLLIAGYDQDGPHLYETCPSGNYFEYYAMALGSRCQAGKTYLERHFEEF  179



>ref|XP_666272.1| proteasome A type subunit [Cryptosporidium hominis TU502]
Length=259

 Score =   251 bits (640),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RNQYDTDV TWSP GR+FQ+EYAMEAVKQG+A +G R+   VVLAC+ ++ S+L+ +Q
Sbjct  1    MYRNQYDTDVVTWSPQGRVFQIEYAMEAVKQGTAVVGARNNEIVVLACIKRSTSKLAGYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK++K+D+HIGVA++G+TAD +V+  Y+R+EC+NYS++Y+SP+P+  LV +L  K+QV T
Sbjct  61   KKLYKIDNHIGVAVSGITADAKVICNYLRSECLNYSFTYDSPMPLNTLVNKLVLKSQVNT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RP+GVGLL+ G DESG HL+  CPSGN FEY + AIGSRSQA+KTYLE+ F+ F
Sbjct  121  QEYGRRPFGVGLLLAGFDESGPHLFETCPSGNCFEYYSIAIGSRSQASKTYLEKHFKEF  179



>ref|XP_009026631.1| hypothetical protein HELRODRAFT_151021, partial [Helobdella robusta]
 gb|ESN95225.1| hypothetical protein HELRODRAFT_151021, partial [Helobdella robusta]
Length=232

 Score =   249 bits (637),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S  + VL  + +A SELS+HQK
Sbjct  1    FRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSDDYAVLVALKRAPSELSAHQK  60

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KI  +DDH+G++IAGLTAD R+LS+YMR EC N  Y+Y++P+PV RLV  +  K+QV TQ
Sbjct  61   KILPIDDHVGISIAGLTADARLLSKYMRTECYNSRYAYDTPMPVSRLVAMIGTKSQVPTQ  120

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            +  +RP+GVGLL+ G DE G+H+Y  CPS NYFE +A AIG+RSQ+A+TYLER  + F
Sbjct  121  KYGRRPFGVGLLIAGYDEKGSHIYQTCPSANYFECKAMAIGARSQSARTYLERHLDEF  178



>ref|XP_003606314.1| Proteasome subunit alpha type [Medicago truncatula]
Length=326

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 142/184 (77%), Gaps = 7/184 (4%)
 Frame = +3

Query  63   KMFRNQYDTDVTTWSPAGRLFQVEYAM-EAVKQGSAAIGLRSKTHVVLACVNKANSELSS  239
            +MFRN   T++ TWSP     +   A  EA KQGSAAI LRSKTHVVLACVNKANSEL S
Sbjct  82   EMFRNLCHTNLNTWSPVKYPIEALKAKYEAFKQGSAAISLRSKTHVVLACVNKANSELYS  141

Query  240  HQKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQV  419
            HQ KI KVD+HIGVAIAG    G VLS YMR ECINY+Y+Y+S LPV RLVVQL +KAQV
Sbjct  142  HQMKILKVDNHIGVAIAG---HGCVLSWYMRYECINYNYTYKSVLPVDRLVVQLTNKAQV  198

Query  420  CTQRSWKRPYGVGLLVG---GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERR  590
            CTQRSWKRPY  GLLV    GLD+  AHLYYNCPSGNYFE+QAFAIGSRS  AKTYLER+
Sbjct  199  CTQRSWKRPYDAGLLVAGLDGLDKPLAHLYYNCPSGNYFEHQAFAIGSRSLPAKTYLERK  258

Query  591  FETF  602
               F
Sbjct  259  VNNF  262


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = +3

Query  63   KMFRNQYDTDVTTWSPAGRLFQ-VEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSS  239
            +MFRN   T++ TWSP     + ++  +EAVKQ SAA+ LRSKT VV A VNKA  +LSS
Sbjct  16   EMFRNLCHTNLKTWSPVKYPIEALKAEIEAVKQRSAAMSLRSKTRVVPARVNKAKYQLSS  75

Query  240  HQKK  251
             +++
Sbjct  76   LEEE  79



>gb|AAC23597.1| proteasome A type subunit [Cryptosporidium parvum]
Length=259

 Score =   249 bits (637),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RNQYDTDV TWSP GR+FQ+EYAMEAVKQG+A +G R+   VVLAC+ ++ S L+ +Q
Sbjct  1    MYRNQYDTDVVTWSPQGRVFQIEYAMEAVKQGTAVVGARNDEIVVLACIKRSTSRLAGYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK++K+D+HIGVA++G+TAD +V+  Y+R+EC+NYS++Y+SP+P+  LV +L  K+QV T
Sbjct  61   KKLYKIDNHIGVAVSGITADAKVICNYLRSECLNYSFTYDSPIPLNTLVNRLVLKSQVNT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RP+GVGLL+ G DESG HL+  CPSGN FEY + AIGSRSQA+KTYLE+ F+ F
Sbjct  121  QEYGRRPFGVGLLLAGFDESGPHLFETCPSGNCFEYYSIAIGSRSQASKTYLEKHFKEF  179



>ref|XP_626412.1| proteasome subunit alpha type 1, NTN hydrolase [Cryptosporidium 
parvum Iowa II]
 gb|EAK88913.1| proteasome subunit alpha type 1, NTN hydrolase [Cryptosporidium 
parvum Iowa II]
Length=288

 Score =   250 bits (638),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            M+RNQYDTDV TWSP GR+FQ+EYAMEAVKQG+A +G R+   VVLAC+ ++ S L+ +Q
Sbjct  30   MYRNQYDTDVVTWSPQGRVFQIEYAMEAVKQGTAVVGARNDEIVVLACIKRSTSRLAGYQ  89

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK++K+D+HIGVA++G+TAD +V+  Y+R+EC+NYS++Y+SP+P+  LV +L  K+QV T
Sbjct  90   KKLYKIDNHIGVAVSGITADAKVICNYLRSECLNYSFTYDSPIPLNTLVNRLVLKSQVNT  149

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RP+GVGLL+ G DESG HL+  CPSGN FEY + AIGSRSQA+KTYLE+ F+ F
Sbjct  150  QEYGRRPFGVGLLLAGFDESGPHLFETCPSGNCFEYYSIAIGSRSQASKTYLEKHFKEF  208



>ref|XP_003703829.1| PREDICTED: proteasome subunit alpha type-1-like [Megachile rotundata]
Length=288

 Score =   249 bits (637),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++KTH VL  + +A+SELS+HQK
Sbjct  13   FRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKTHAVLIALKRASSELSAHQK  72

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            K+F +D H+G++I+GLTAD R+LSRYMR EC+NY YS++  LPV RL+  L +K Q  TQ
Sbjct  73   KMFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDVLPVSRLLASLGNKLQTSTQ  132

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            R  KRPYGVGLL+ G D+ G H+Y  CPS NYF+ +A AIGSRSQ+A+TYL++     +
Sbjct  133  RYDKRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGSRSQSARTYLDKHLNELL  191



>ref|XP_004168681.1| PREDICTED: proteasome subunit alpha type-1-B-like [Cucumis sativus]
Length=133

 Score =   244 bits (622),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRS THVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSNTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFKVDDHIGVAI+GLTADGRVLSRYMR+ECINYSY+YESPLPVGRLVVQLADKAQVC 
Sbjct  61   KKIFKVDDHIGVAISGLTADGRVLSRYMRSECINYSYTYESPLPVGRLVVQLADKAQVCV  120

Query  426  QR  431
            ++
Sbjct  121  RK  122



>gb|AES88511.2| 20S proteasome subunit alpha type 1 [Medicago truncatula]
Length=341

 Score =   251 bits (641),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 142/184 (77%), Gaps = 7/184 (4%)
 Frame = +3

Query  63   KMFRNQYDTDVTTWSPAGRLFQVEYAM-EAVKQGSAAIGLRSKTHVVLACVNKANSELSS  239
            +MFRN   T++ TWSP     +   A  EA KQGSAAI LRSKTHVVLACVNKANSEL S
Sbjct  82   EMFRNLCHTNLNTWSPVKYPIEALKAKYEAFKQGSAAISLRSKTHVVLACVNKANSELYS  141

Query  240  HQKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQV  419
            HQ KI KVD+HIGVAIAG    G VLS YMR ECINY+Y+Y+S LPV RLVVQL +KAQV
Sbjct  142  HQMKILKVDNHIGVAIAG---HGCVLSWYMRYECINYNYTYKSVLPVDRLVVQLTNKAQV  198

Query  420  CTQRSWKRPYGVGLLVG---GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERR  590
            CTQRSWKRPY  GLLV    GLD+  AHLYYNCPSGNYFE+QAFAIGSRS  AKTYLER+
Sbjct  199  CTQRSWKRPYDAGLLVAGLDGLDKPLAHLYYNCPSGNYFEHQAFAIGSRSLPAKTYLERK  258

Query  591  FETF  602
               F
Sbjct  259  VNNF  262


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = +3

Query  63   KMFRNQYDTDVTTWSPAGRLFQ-VEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSS  239
            +MFRN   T++ TWSP     + ++  +EAVKQ SAA+ LRSKT VV A VNKA  +LSS
Sbjct  16   EMFRNLCHTNLKTWSPVKYPIEALKAEIEAVKQRSAAMSLRSKTRVVPARVNKAKYQLSS  75

Query  240  HQKK  251
             +++
Sbjct  76   LEEE  79



>emb|CCA25390.1| proteasome subunit alpha putative [Albugo laibachii Nc14]
 emb|CCA25463.1| proteasome subunit alpha putative [Albugo laibachii Nc14]
Length=254

 Score =   248 bits (633),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVT WSP G L QV+YAMEAVKQGS  +GL S  +VVL  V + N +L+ HQ
Sbjct  1    MFRNQYDTDVTVWSPQGHLHQVDYAMEAVKQGSVCLGLTSNEYVVLCGVKRQNDKLAQHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K++K+DD++G+ +AGL AD R L+RYMR EC+N+ + Y S +P+GRLV  +ADK Q CT
Sbjct  61   RKLYKIDDYMGIGMAGLHADARTLARYMRTECLNHKFVYGSQIPIGRLVTDVADKKQECT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RPYGVGLLV G D+ G HLY  CPSGN++EY+A AIGSRSQ+A+TYLE+ ++TF
Sbjct  121  QSYVRRPYGVGLLVAGADKKGVHLYQTCPSGNFYEYKAIAIGSRSQSARTYLEKHYQTF  179



>ref|XP_009519261.1| hypothetical protein PHYSODRAFT_541580 [Phytophthora sojae]
 gb|EGZ23973.1| hypothetical protein PHYSODRAFT_541580 [Phytophthora sojae]
Length=253

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVT WSP G L Q++YAMEAVKQGSA +GL S    VL  + + + EL+ HQ
Sbjct  1    MFRNQYDTDVTVWSPQGHLHQIDYAMEAVKQGSACLGLTSSKFAVLCGIKRQSLELAEHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+FK+DDH+G+AI+GLTAD R L+R+MR E +N+ + Y S + VGRLV  +ADK Q CT
Sbjct  61   KKVFKIDDHMGIAISGLTADARTLARFMRTESLNHKFVYGSAITVGRLVSDVADKKQECT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RPYGVGLLV G+D+ G HLY  CPSGNY+EY+  AIG+RSQ+A+TYLE+ FE+F
Sbjct  121  QSYIRRPYGVGLLVAGVDKKGVHLYQTCPSGNYYEYKGIAIGARSQSARTYLEKHFESF  179



>emb|CBN79978.1| 20S proteasome subunit alpha type 1 [Ectocarpus siliculosus]
Length=263

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVT WSP GRL QVEYAMEAVKQG A++GLRS +HVVLA + +A +E+S+ Q
Sbjct  1    MFRNQYDTDVTVWSPQGRLHQVEYAMEAVKQGGASLGLRSGSHVVLAALKRAPNEMSAPQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKIFK+D ++GVAIAGLTAD R L++YMR EC+N+ Y Y + +   RLV+ LAD  Q  T
Sbjct  61   KKIFKLDSNMGVAIAGLTADARSLAKYMRTECLNHKYVYGTTMQASRLVLDLADMHQRTT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RPYGVG+LV   D++G HL+  CPSGNYFEY A AIG+RSQ+AKTYLE+ FE F
Sbjct  121  QSYVRRPYGVGMLVAAHDQTGPHLFQTCPSGNYFEYVAMAIGARSQSAKTYLEKHFEDF  179



>gb|AEE61485.1| unknown [Dendroctonus ponderosae]
 gb|ENN75538.1| hypothetical protein YQE_07881, partial [Dendroctonus ponderosae]
 gb|ERL92985.1| hypothetical protein D910_10288 [Dendroctonus ponderosae]
Length=281

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAV  GSA +GL+S +H VL  + +A+SELS++Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVNLGSATVGLKSNSHAVLIALKRASSELSAYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDHIG+ I+GLTAD R+L+RYMR EC+N+ Y++++ LP+ RL+  L +K Q+CT
Sbjct  61   KKIINIDDHIGITISGLTADARILTRYMRAECLNHKYTHDTYLPLNRLISTLGNKMQICT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLLV G DE G+H+Y  CPS NY++ +A +IG+RSQ+A+TYLE+  +  +
Sbjct  121  QRYDRRPYGVGLLVAGFDEKGSHIYQTCPSANYYDCKAMSIGARSQSARTYLEKHLDQLV  180

Query  606  GF  611
              
Sbjct  181  NI  182



>ref|XP_004711673.1| PREDICTED: proteasome subunit alpha type-1 [Echinops telfairi]
Length=316

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 146/196 (74%), Gaps = 1/196 (1%)
 Frame = +3

Query  18   SWNEAGRDYRSQRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHV  197
            SW  +   +R Q  C+ FRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH 
Sbjct  39   SWAASWAAFRRQGPCR-FRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHA  97

Query  198  VLACVNKANSELSSHQKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLP  377
            VL  + +A SEL++HQKKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLP
Sbjct  98   VLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLP  157

Query  378  VGRLVVQLADKAQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSR  557
            V RLV  +  K Q+ TQR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+R
Sbjct  158  VSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGAR  217

Query  558  SQAAKTYLERRFETFM  605
            SQ+A+TYLERR   FM
Sbjct  218  SQSARTYLERRMSEFM  233



>ref|XP_011004997.1| PREDICTED: proteasome subunit alpha type-1-B-like [Populus euphratica]
Length=141

 Score =   243 bits (621),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ
Sbjct  1    MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVC  422
            KKIFKVDDHIGVAIAGLTADGRVLSRYMR ECINYS++YESPLPVGRLVVQLADKAQVC
Sbjct  61   KKIFKVDDHIGVAIAGLTADGRVLSRYMRTECINYSFNYESPLPVGRLVVQLADKAQVC  119



>ref|XP_004090717.1| PREDICTED: proteasome subunit alpha type-1-like [Nomascus leucogenys]
Length=183

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|NP_001090002.1| proteasome (prosome, macropain) subunit, alpha type, 1 [Xenopus 
laevis]
 gb|AAH92105.1| MGC115143 protein [Xenopus laevis]
Length=261

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+H+G++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV Q+  K Q+ T
Sbjct  61   KKILNVDNHVGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSQIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    F+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMSEFL  180



>ref|XP_007121548.1| PREDICTED: proteasome subunit alpha type-1 isoform X2 [Physeter 
catodon]
Length=226

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|XP_319444.3| AGAP010253-PA [Anopheles gambiae str. PEST]
 gb|EAA13963.4| AGAP010253-PA [Anopheles gambiae str. PEST]
Length=275

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GRL QVEYAMEAVK GSA +GL++K   VL  + +A+SELSS+Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKDFAVLIALKRASSELSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDH+G++ AG+TAD R+LSRY+R EC+NY Y+Y++  PVGRL+  L +K QVCT
Sbjct  61   KKIISIDDHLGLSFAGITADARILSRYLRQECLNYKYAYDAFYPVGRLISNLGNKMQVCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLLV G D+ G H+Y  CPS N+F+ +A +IGSRSQ+A+TYLE+   TF
Sbjct  121  QRYDRRPYGVGLLVIGYDDQGPHIYQTCPSANFFDCKAMSIGSRSQSARTYLEKHLATF  179



>gb|AAH84394.1| Unknown (protein for MGC:86195) [Xenopus laevis]
Length=261

 Score =   246 bits (629),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+H+G++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV Q+  K Q+ T
Sbjct  61   KKILNVDNHVGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSQIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    F+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFL  180



>ref|XP_002901731.1| proteasome subunit alpha, putative [Phytophthora infestans T30-4]
 gb|EEY57121.1| proteasome subunit alpha, putative [Phytophthora infestans T30-4]
Length=253

 Score =   246 bits (629),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVT WSP G L Q++YAMEAVKQGSA +GL S    VL  + + + EL+ HQ
Sbjct  1    MFRNQYDTDVTVWSPQGHLHQIDYAMEAVKQGSACLGLTSSKFAVLCAIKRQSLELAEHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+FK+D+H+G+AI+GLTAD R L+R+MR E +N+ + Y S + VGRLV  +ADK Q CT
Sbjct  61   KKVFKIDEHMGIAISGLTADARTLARFMRTESLNHKFVYGSSITVGRLVSDVADKKQECT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RPYGVGLLV G+D+ G HLY  CPSGNY+EY+  AIG+RSQ+A+TYLE+ FE+F
Sbjct  121  QSYIRRPYGVGLLVAGVDKKGVHLYQTCPSGNYYEYKGIAIGARSQSARTYLEKHFESF  179



>ref|XP_003387223.1| PREDICTED: proteasome subunit alpha type-1-like [Amphimedon queenslandica]
Length=282

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DV TWSP GRL Q+EYAMEAVKQGSA +GL+SKTHV+L  + ++ S+LSS+Q
Sbjct  1    MFRNQYDNDVATWSPQGRLHQIEYAMEAVKQGSATVGLKSKTHVILVALKRSTSDLSSYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI+ VDDH+GV+IAGLTADGR+L ++MR EC+N  Y + S LPV RLV  + +K Q CT
Sbjct  61   KKIYPVDDHVGVSIAGLTADGRLLCKFMRTECLNSRYVFNSALPVSRLVSSVGNKMQYCT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RPYGVG+L+ G D  G HLY  CPS +Y++ +  AIG+RSQ+A+TYLER+ ++F
Sbjct  121  QFYGRRPYGVGMLIAGYDLQGPHLYQTCPSSDYYDCKCMAIGARSQSARTYLERKLDSF  179



>gb|ACI67379.1| Proteasome subunit alpha type-1 [Salmo salar]
Length=262

 Score =   246 bits (629),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S+TH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSRTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLP  RLV  +  K Q+ T
Sbjct  61   KKILHVDEHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPASRLVTLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER  ETF+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMETFL  180



>gb|ACO11000.1| Proteasome subunit alpha type-1 [Caligus rogercresseyi]
Length=262

 Score =   246 bits (629),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S+TH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSRTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLP  RLV  +  K Q+ T
Sbjct  61   KKILHVDEHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPASRLVTLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER  ETF+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMETFL  180



>ref|XP_001628693.1| predicted protein [Nematostella vectensis]
 gb|EDO36630.1| predicted protein, partial [Nematostella vectensis]
Length=232

 Score =   245 bits (626),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA + L+SKTH V+  + +A SELS+HQK
Sbjct  1    FRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVALKSKTHAVIVALKRAPSELSAHQK  60

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KI  +D H+GV+IAGLTAD R+LS++MRNEC+N  Y+Y++ LP+ RLV  + DK Q+ TQ
Sbjct  61   KILPIDTHVGVSIAGLTADARLLSKFMRNECLNSKYAYDTMLPITRLVSSVGDKMQIPTQ  120

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            R  +RPYGVGLLV G D+ G H++  CPS NYF+ +A AIG+RSQ+A+TYLE+  + F
Sbjct  121  RYGRRPYGVGLLVVGYDDMGPHIFQTCPSANYFDCKAMAIGARSQSARTYLEKYLDAF  178



>ref|XP_005099514.1| PREDICTED: proteasome subunit alpha type-1-like isoform X2 [Aplysia 
californica]
Length=280

 Score =   247 bits (630),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH +L  + +A SELS+HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQLEYAMEAVKQGSACVGLKSKTHAILVALKRAPSELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDH+ V+IAGLTAD R+L  +MRNEC+N  + +  PLPV RLV  +  K+Q+ T
Sbjct  61   KKILPIDDHVAVSIAGLTADARLLCNFMRNECLNSRWGWNKPLPVSRLVSMIGSKSQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RP+GVGLLV G D  G H+Y  CPS NY++ +A AIG+RSQ+A+TYLE+  + F+
Sbjct  121  QRYGRRPFGVGLLVAGYDSQGPHIYQTCPSANYYDCKAMAIGARSQSARTYLEKHLDVFL  180



>ref|XP_004409693.1| PREDICTED: proteasome subunit alpha type-1-like [Odobenus rosmarus 
divergens]
Length=263

 Score =   246 bits (628),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV  LV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSHLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+Y+A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDYRAMSIGARSQSARTYLERHMSGFM  180



>ref|XP_008891774.1| hypothetical protein PPTG_02446 [Phytophthora parasitica INRA-310]
 gb|ETI50050.1| hypothetical protein F443_06329 [Phytophthora parasitica P1569]
 gb|ETK89937.1| hypothetical protein L915_06203 [Phytophthora parasitica]
 gb|ETL43335.1| hypothetical protein L916_06141 [Phytophthora parasitica]
 gb|ETL96527.1| hypothetical protein L917_06019 [Phytophthora parasitica]
 gb|ETM49683.1| hypothetical protein L914_06139 [Phytophthora parasitica]
 gb|ETN22528.1| hypothetical protein PPTG_02446 [Phytophthora parasitica INRA-310]
 gb|ETO78794.1| hypothetical protein F444_06392 [Phytophthora parasitica P1976]
 gb|ETP19818.1| hypothetical protein F441_06337 [Phytophthora parasitica CJ01A1]
 gb|ETP47775.1| hypothetical protein F442_06372 [Phytophthora parasitica P10297]
Length=253

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYDTDVT WSP G L Q++YAMEAVKQGSA +GL S    VL  + + + EL+ HQ
Sbjct  1    MFRNQYDTDVTVWSPQGHLHQIDYAMEAVKQGSACLGLTSNKFAVLCGIKRQSLELAEHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+FK+D+H+G+AI+GLTAD R L+R+MR E +N+ + Y S + VGRLV  +ADK Q CT
Sbjct  61   KKVFKIDEHMGIAISGLTADARTLARFMRTESLNHKFVYGSSITVGRLVSDVADKKQECT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RPYGVGLLV G+D+ G HLY  CPSGNY+EY+  AIG+RSQ+A+TYLE+ FE+F
Sbjct  121  QSYIRRPYGVGLLVAGVDKKGVHLYQTCPSGNYYEYKGIAIGARSQSARTYLEKHFESF  179



>ref|XP_005099513.1| PREDICTED: proteasome subunit alpha type-1-like isoform X1 [Aplysia 
californica]
Length=292

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH +L  + +A SELS+HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQLEYAMEAVKQGSACVGLKSKTHAILVALKRAPSELSAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  +DDH+ V+IAGLTAD R+L  +MRNEC+N  + +  PLPV RLV  +  K+Q+ T
Sbjct  61   KKILPIDDHVAVSIAGLTADARLLCNFMRNECLNSRWGWNKPLPVSRLVSMIGSKSQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RP+GVGLLV G D  G H+Y  CPS NY++ +A AIG+RSQ+A+TYLE+  + F+
Sbjct  121  QRYGRRPFGVGLLVAGYDSQGPHIYQTCPSANYYDCKAMAIGARSQSARTYLEKHLDVFL  180



>ref|NP_001124812.1| proteasome subunit alpha type-1 [Pongo abelii]
 sp|Q5REN2.1|PSA1_PONAB RecName: Full=Proteasome subunit alpha type-1 [Pongo abelii]
 emb|CAH89775.1| hypothetical protein [Pongo abelii]
Length=263

 Score =   246 bits (627),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>tpg|DAA34467.1| TPA_exp: proteasome alpha type 1 [Amblyomma variegatum]
Length=238

 Score =   245 bits (625),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  84   DTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQKKIFKV  263
            D DVT WSP GRL QVEYAMEAVKQGSA IGL+S TH VL  + +A+SELS+HQKKI  +
Sbjct  1    DNDVTVWSPQGRLHQVEYAMEAVKQGSATIGLKSNTHAVLLALKRASSELSAHQKKIIPI  60

Query  264  DDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQRSWKR  443
            D+H GV+IAGLTAD R+LS++MR EC+N  Y++++PLP+ RLV  L +K QVCTQR  +R
Sbjct  61   DNHCGVSIAGLTADARLLSKFMRTECLNNRYAHDTPLPISRLVTLLGNKMQVCTQRYDRR  120

Query  444  PYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            PYGVGLLV G D+ GAH+Y  CPS N+F+ +A AIG+RSQ+A+TYLE+  + F
Sbjct  121  PYGVGLLVAGYDDMGAHIYQTCPSANFFDCKAMAIGARSQSARTYLEKHLDEF  173



>ref|XP_001504993.1| PREDICTED: proteasome subunit alpha type-1 isoform 1 [Equus caballus]
 ref|XP_008506750.1| PREDICTED: proteasome subunit alpha type-1 [Equus przewalskii]
Length=263

 Score =   246 bits (627),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|XP_003225371.1| PREDICTED: proteasome subunit alpha type-1 [Anolis carolinensis]
Length=261

 Score =   246 bits (627),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILYVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLERR   F
Sbjct  121  QRYGRRPYGVGLLIAGFDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERRMTEF  179



>ref|XP_006978682.1| PREDICTED: proteasome subunit alpha type-1 [Peromyscus maniculatus 
bairdii]
Length=263

 Score =   246 bits (627),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|NP_036095.1| proteasome subunit alpha type-1 [Mus musculus]
 sp|Q9R1P4.1|PSA1_MOUSE RecName: Full=Proteasome subunit alpha type-1; AltName: Full=Macropain 
subunit C2; AltName: Full=Multicatalytic endopeptidase 
complex subunit C2; AltName: Full=Proteasome component 
C2; AltName: Full=Proteasome nu chain [Mus musculus]
 pdb|3UNB|E Chain E, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|S Chain S, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|GG Chain g, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|UU Chain u, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|E Chain E, Mouse Constitutive 20s Proteasome
 pdb|3UNE|S Chain S, Mouse Constitutive 20s Proteasome
 pdb|3UNE|GG Chain g, Mouse Constitutive 20s Proteasome
 pdb|3UNE|UU Chain u, Mouse Constitutive 20s Proteasome
 pdb|3UNF|E Chain E, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNF|S Chain S, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNH|E Chain E, Mouse 20s Immunoproteasome
 pdb|3UNH|S Chain S, Mouse 20s Immunoproteasome
 gb|AAD50533.1|AF060088_1 proteasome subunit C2 [Mus musculus]
 emb|CAB95966.1| 20S proteasome subunit C2 [Mus musculus]
 emb|CAB95969.1| 20S proteasome subunit C2 [Mus musculus]
 gb|AAH05762.1| Proteasome (prosome, macropain) subunit, alpha type 1 [Mus musculus]
 dbj|BAE36831.1| unnamed protein product [Mus musculus]
 dbj|BAE39736.1| unnamed protein product [Mus musculus]
 dbj|BAE23220.1| unnamed protein product [Mus musculus]
 gb|EDL17061.1| proteasome (prosome, macropain) subunit, alpha type 1, isoform 
CRA_a [Mus musculus]
Length=263

 Score =   246 bits (627),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|XP_003781174.1| PREDICTED: proteasome subunit alpha type-1 [Otolemur garnettii]
Length=263

 Score =   246 bits (627),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|XP_004279205.1| PREDICTED: proteasome subunit alpha type-1 [Orcinus orca]
 ref|XP_004321869.1| PREDICTED: proteasome subunit alpha type-1 [Tursiops truncatus]
 ref|XP_007121547.1| PREDICTED: proteasome subunit alpha type-1 isoform X1 [Physeter 
catodon]
 ref|XP_007460277.1| PREDICTED: proteasome subunit alpha type-1 [Lipotes vexillifer]
Length=263

 Score =   246 bits (627),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|NP_001279970.1| proteasome (prosome, macropain) subunit, alpha type, 1 [Callorhinchus 
milii]
 gb|AFM86097.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
 gb|AFM86669.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
 gb|AFM86702.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
 gb|AFM87622.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
 gb|AFM88021.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
 gb|AFM88186.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
 gb|AFM88703.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
 gb|AFM89195.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
 gb|AFM90614.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
Length=261

 Score =   246 bits (627),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+  VD+H+G++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV Q+  K QV T
Sbjct  61   KKVLHVDNHVGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSQIGSKTQVPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER+ + F
Sbjct  121  QRYGRRPYGVGLLIAGYDDIGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERQMDHF  179



>gb|AFM85610.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
Length=261

 Score =   246 bits (627),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+  VD+H+G++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV Q+  K QV T
Sbjct  61   KKVLHVDNHVGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSQIGSKTQVPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER+ + F
Sbjct  121  QRYGRRPYGVGLLIAGYDDIGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERQMDHF  179



>ref|XP_003506454.1| PREDICTED: proteasome subunit alpha type-1 [Cricetulus griseus]
 ref|XP_005351086.1| PREDICTED: proteasome subunit alpha type-1 [Microtus ochrogaster]
 ref|XP_007622885.1| PREDICTED: proteasome subunit alpha type-1 [Cricetulus griseus]
 gb|EGV99312.1| Proteasome subunit alpha type-1 [Cricetulus griseus]
Length=263

 Score =   246 bits (627),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>emb|CCI41834.1| unnamed protein product [Albugo candida]
Length=254

 Score =   245 bits (626),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRN YDTDVT WSP G L QV+YAMEAVKQGS  +GL S  +VVL  + + N +L+ HQ
Sbjct  1    MFRNSYDTDVTVWSPQGHLHQVDYAMEAVKQGSVCLGLTSNDYVVLCGIKRQNDKLAQHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            +K++K+D+++G+ +AGL AD R L+RYMR EC+N+ + Y S +P+GRLV  +ADK Q CT
Sbjct  61   RKLYKIDEYMGIGMAGLHADARTLARYMRTECLNHKFVYGSQIPIGRLVTDVADKKQECT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RPYGVGLLV G D+ G HLY  CPSGNY+EY+A AIGSRSQ+A+TYLE+ F TF
Sbjct  121  QSYVRRPYGVGLLVAGADKKGVHLYQTCPSGNYYEYKAIAIGSRSQSARTYLEKHFPTF  179



>ref|XP_008851742.1| PREDICTED: proteasome subunit alpha type-1 [Nannospalax galili]
Length=263

 Score =   246 bits (627),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|XP_007521203.1| PREDICTED: proteasome subunit alpha type-1 [Erinaceus europaeus]
Length=263

 Score =   246 bits (627),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|NP_001030387.1| proteasome subunit alpha type-1 [Bos taurus]
 ref|XP_004016181.1| PREDICTED: proteasome subunit alpha type-1 [Ovis aries]
 ref|XP_005689649.1| PREDICTED: proteasome subunit alpha type-1 [Capra hircus]
 ref|XP_005887611.1| PREDICTED: proteasome subunit alpha type-1 isoform X2 [Bos mutus]
 ref|XP_006054502.1| PREDICTED: proteasome subunit alpha type-1 [Bubalus bubalis]
 ref|XP_010828875.1| PREDICTED: proteasome subunit alpha type-1 [Bison bison bison]
 sp|Q3T0X5.1|PSA1_BOVIN RecName: Full=Proteasome subunit alpha type-1 [Bos taurus]
 gb|AAI02217.1| Proteasome (prosome, macropain) subunit, alpha type, 1 [Bos taurus]
 tpg|DAA22227.1| TPA: proteasome subunit alpha type-1 [Bos taurus]
Length=263

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|NP_002777.1| proteasome subunit alpha type-1 isoform 2 [Homo sapiens]
 ref|NP_001247950.1| proteasome subunit alpha type-1 [Macaca mulatta]
 ref|XP_002708872.1| PREDICTED: proteasome subunit alpha type-1 [Oryctolagus cuniculus]
 ref|XP_002755033.1| PREDICTED: proteasome subunit alpha type-1 isoform X1 [Callithrix 
jacchus]
 ref|XP_003123013.1| PREDICTED: proteasome subunit alpha type-1 [Sus scrofa]
 ref|XP_508298.3| PREDICTED: proteasome subunit alpha type-1 isoform X1 [Pan troglodytes]
 ref|XP_003818239.1| PREDICTED: proteasome subunit alpha type-1 isoform X1 [Pan paniscus]
 ref|XP_004683082.1| PREDICTED: proteasome subunit alpha type-1 [Condylura cristata]
 ref|XP_004900323.1| PREDICTED: proteasome subunit alpha type-1 [Heterocephalus glaber]
 ref|XP_004851526.1| PREDICTED: proteasome subunit alpha type-1 [Heterocephalus glaber]
 ref|XP_003465807.2| PREDICTED: proteasome subunit alpha type-1 [Cavia porcellus]
 ref|XP_005326833.1| PREDICTED: proteasome subunit alpha type-1 [Ictidomys tridecemlineatus]
 ref|XP_005380389.1| PREDICTED: proteasome subunit alpha type-1 [Chinchilla lanigera]
 ref|XP_006089640.1| PREDICTED: proteasome subunit alpha type-1 [Myotis lucifugus]
 ref|XP_006191887.1| PREDICTED: proteasome subunit alpha type-1 [Camelus ferus]
 ref|XP_006209401.1| PREDICTED: proteasome subunit alpha type-1 [Vicugna pacos]
 ref|XP_006773255.1| PREDICTED: proteasome subunit alpha type-1 [Myotis davidii]
 ref|XP_006905725.1| PREDICTED: proteasome subunit alpha type-1 [Pteropus alecto]
 ref|XP_008004277.1| PREDICTED: proteasome subunit alpha type-1 isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_008066126.1| PREDICTED: proteasome subunit alpha type-1 [Tarsius syrichta]
 ref|XP_009184789.1| PREDICTED: proteasome subunit alpha type-1 isoform X2 [Papio 
anubis]
 ref|XP_010386680.1| PREDICTED: proteasome subunit alpha type-1 [Rhinopithecus roxellana]
 ref|XP_010613521.1| PREDICTED: proteasome subunit alpha type-1 [Fukomys damarensis]
 ref|XP_010963136.1| PREDICTED: proteasome subunit alpha type-1 [Camelus bactrianus]
 ref|XP_010975547.1| PREDICTED: proteasome subunit alpha type-1 [Camelus dromedarius]
 ref|XP_011372477.1| PREDICTED: proteasome subunit alpha type-1 [Pteropus vampyrus]
 sp|P25786.1|PSA1_HUMAN RecName: Full=Proteasome subunit alpha type-1; AltName: Full=30 
kDa prosomal protein; Short=PROS-30; AltName: Full=Macropain 
subunit C2; AltName: Full=Multicatalytic endopeptidase complex 
subunit C2; AltName: Full=Proteasome component C2; AltName: 
Full=Proteasome nu chain [Homo sapiens]
 pdb|1IRU|F Chain F, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|T Chain T, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 dbj|BAA00656.1| proteasome subunit C2 [Homo sapiens]
 emb|CAA43961.1| macropaine subunit nu [Homo sapiens]
 gb|AAH02577.1| Proteasome (prosome, macropain) subunit, alpha type, 1 [Homo 
sapiens]
 gb|AAH08472.1| Proteasome (prosome, macropain) subunit, alpha type, 1 [Homo 
sapiens]
 gb|AAH15105.1| Proteasome (prosome, macropain) subunit, alpha type, 1 [Homo 
sapiens]
 gb|AAH15356.1| Proteasome (prosome, macropain) subunit, alpha type, 1 [Homo 
sapiens]
 gb|AAH09576.1| Proteasome (prosome, macropain) subunit, alpha type, 1 [Homo 
sapiens]
 gb|AAH22372.1| Proteasome (prosome, macropain) subunit, alpha type, 1 [Homo 
sapiens]
 gb|EAW68479.1| proteasome (prosome, macropain) subunit, alpha type, 1, isoform 
CRA_d [Homo sapiens]
 gb|ABM85586.1| proteasome (prosome, macropain) subunit, alpha type, 1 [synthetic 
construct]
 dbj|BAF83454.1| unnamed protein product [Homo sapiens]
 gb|AIC49500.1| PSMA1, partial [synthetic construct]
Length=263

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|XP_004613637.1| PREDICTED: proteasome subunit alpha type-1 [Sorex araneus]
 ref|XP_006142591.1| PREDICTED: proteasome subunit alpha type-1 [Tupaia chinensis]
Length=263

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|XP_004418519.1| PREDICTED: proteasome subunit alpha type-1 isoform 1 [Ceratotherium 
simum simum]
Length=263

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>ref|XP_010590515.1| PREDICTED: proteasome subunit alpha type-1 [Loxodonta africana]
Length=263

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>gb|AFM86854.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
Length=261

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+  VD+H+G++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV Q+  K QV T
Sbjct  61   KKVLHVDNHVGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSQIGSKTQVPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER+ + F
Sbjct  121  QRYGRRPYGVGLLIAGYDDIGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERQMDHF  179



>emb|CDQ77284.1| unnamed protein product [Oncorhynchus mykiss]
Length=269

 Score =   246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = +3

Query  57   VCKMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELS  236
            V K FRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S+TH VL  + +A SEL+
Sbjct  5    VTKRFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSRTHAVLVALKRAQSELA  64

Query  237  SHQKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQ  416
            +HQKKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLP  RLV  +  K Q
Sbjct  65   AHQKKILHVDEHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPASRLVTLIGSKTQ  124

Query  417  VCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFE  596
            + TQR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER  +
Sbjct  125  IPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMD  184

Query  597  TFM  605
            TF+
Sbjct  185  TFL  187



>ref|NP_058974.1| proteasome subunit alpha type-1 [Rattus norvegicus]
 sp|P18420.2|PSA1_RAT RecName: Full=Proteasome subunit alpha type-1; AltName: Full=Macropain 
subunit C2; AltName: Full=Multicatalytic endopeptidase 
complex subunit C2; AltName: Full=Proteasome component 
C2; AltName: Full=Proteasome nu chain [Rattus norvegicus]
 gb|AAA41943.1| proteasome C2 subunit [Rattus norvegicus]
 dbj|BAA14312.1| proteasome subunit C2 [Rattus norvegicus]
 gb|AAH62233.1| Proteasome (prosome, macropain) subunit, alpha type 1 [Rattus 
norvegicus]
 gb|EDM17781.1| proteasome (prosome, macropain) subunit, alpha type 1, isoform 
CRA_d [Rattus norvegicus]
Length=263

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHVFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>dbj|BAD42872.1| 20S proteasome alpha6 subunit [Xenopus laevis]
Length=261

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+H+G++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV Q+  K Q+ T
Sbjct  61   KKILNVDNHVGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSQIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+R Q+A+TYLER    F+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARPQSARTYLERHMSEFL  180



>emb|CAJ81554.1| proteasome (prosome macropain) subunit alpha type 1 [Xenopus 
(Silurana) tropicalis]
Length=261

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SK+H VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKSHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+H+G++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV Q+  K Q+ T
Sbjct  61   KKILNVDNHVGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSQIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    F+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFL  180



>ref|XP_002923350.1| PREDICTED: proteasome subunit alpha type-1 [Ailuropoda melanoleuca]
 ref|XP_004415629.1| PREDICTED: proteasome subunit alpha type-1 [Odobenus rosmarus 
divergens]
 ref|XP_004752083.1| PREDICTED: proteasome subunit alpha type-1 [Mustela putorius 
furo]
 ref|XP_004800556.1| PREDICTED: proteasome subunit alpha type-1 [Mustela putorius 
furo]
 ref|XP_007083306.1| PREDICTED: proteasome subunit alpha type-1 [Panthera tigris altaica]
 ref|XP_004001646.2| PREDICTED: proteasome subunit alpha type-1 [Felis catus]
Length=263

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSGFM  180



>gb|ACH70727.1| proteasome (prosome, macropain) subunit alpha type 1 [Salmo salar]
 gb|ACI67932.1| Proteasome subunit alpha type-1 [Salmo salar]
Length=262

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S++H VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSRSHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDSHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVTLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER  +TF+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMDTFL  180



>gb|ACO08743.1| Proteasome subunit alpha type 1 [Oncorhynchus mykiss]
Length=262

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S+TH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSRTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLP  RLV  +  K Q+ T
Sbjct  61   KKILHVDEHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPASRLVTLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER  +TF+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMDTFL  180



>ref|XP_005309653.1| PREDICTED: proteasome subunit alpha type-1 isoform X1 [Chrysemys 
picta bellii]
Length=261

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILYVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLERR   F+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERRMTEFV  180



>ref|XP_005885948.1| PREDICTED: LOW QUALITY PROTEIN: proteasome (prosome, macropain) 
subunit, alpha type, 1 [Myotis brandtii]
Length=263

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLP+ RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDXPLPLSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>gb|AFM87180.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
Length=261

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            K++  VD+H+G++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV Q+  K QV T
Sbjct  61   KRVLHVDNHVGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSQIGSKTQVPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER+ + F
Sbjct  121  QRYGRRPYGVGLLIAGYDDIGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERQMDHF  179



>ref|XP_007174951.1| PREDICTED: proteasome subunit alpha type-1 [Balaenoptera acutorostrata 
scammoni]
Length=263

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLP+ RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPLSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>gb|ACI67883.1| Proteasome subunit alpha type-1 [Salmo salar]
 gb|ACN10106.1| Proteasome subunit alpha type-1 [Salmo salar]
 gb|ACN12455.1| Proteasome subunit alpha type-1 [Salmo salar]
 gb|ACO08165.1| Proteasome subunit alpha type 1 [Oncorhynchus mykiss]
Length=262

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S TH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSGTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDEHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVTLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER   TF+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMNTFL  180



>gb|ESA05083.1| hypothetical protein GLOINDRAFT_336022 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX74285.1| proteasome core particle subunit alpha 6 [Rhizophagus irregularis 
DAOM 197198w]
Length=253

 Score =   244 bits (622),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD D++TWSP GR+ Q+EYA+EAVKQGSAA+GLRS TH +L  + +++ EL+S+Q
Sbjct  1    MFRNQYDNDISTWSPQGRIHQIEYALEAVKQGSAAVGLRSNTHAILLALKRSSGELASYQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+ ++DDH+GVAIAGLT+D RVLS +MR E +     ++ PLP+ R+V  + DKAQV T
Sbjct  61   KKLIRIDDHLGVAIAGLTSDARVLSNFMRTEAMKSKMIFDRPLPIFRIVSAIGDKAQVNT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            Q   +RPYGVGLLV G DE+G HLY   PSGN+FEY A +IG+RSQ+AKTYLE+ +E+F
Sbjct  121  QNYGRRPYGVGLLVAGYDETGPHLYECAPSGNFFEYYAMSIGARSQSAKTYLEKYYESF  179



>gb|ETE67788.1| Proteasome subunit alpha type-1, partial [Ophiophagus hannah]
Length=314

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 145/196 (74%), Gaps = 2/196 (1%)
 Frame = +3

Query  15   LSWNEAGRDYRSQRVCKMFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTH  194
            L W+ AG   R+  +  MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH
Sbjct  60   LFWSSAGAAVRT--LPAMFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTH  117

Query  195  VVLACVNKANSELSSHQKKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPL  374
             VL  + +A SEL++HQKKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PL
Sbjct  118  AVLVALKRAQSELAAHQKKILYVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPL  177

Query  375  PVGRLVVQLADKAQVCTQRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGS  554
            PV RLV  +  K Q+ TQR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+
Sbjct  178  PVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGA  237

Query  555  RSQAAKTYLERRFETF  602
            RSQ+A+TYLER    F
Sbjct  238  RSQSARTYLERHMTEF  253



>ref|XP_005991016.1| PREDICTED: proteasome subunit alpha type-1-like [Latimeria chalumnae]
Length=274

 Score =   244 bits (623),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD+DVT WSP GR+ Q+EYAMEAVKQGSA +G++SKTHVVL  + +A S+L++HQ
Sbjct  1    MFRNQYDSDVTVWSPQGRIHQIEYAMEAVKQGSATVGVKSKTHVVLVALKRAQSKLTAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+ +VDDHIG++IAGLTAD ++L  +MR EC+   + + +PLP+ RLV  +  K QV T
Sbjct  61   KKVLQVDDHIGISIAGLTADAQLLCHFMRQECLESKFVFSTPLPISRLVGMVGSKLQVPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER  587
            QR  +RPYGVGLLV G DE G HL+  CPSGN+++ +A AIG+RSQ+A+TYLER
Sbjct  121  QRYGRRPYGVGLLVAGYDEQGPHLFQTCPSGNFYKCKAMAIGARSQSARTYLER  174



>emb|CDQ71348.1| unnamed protein product [Oncorhynchus mykiss]
Length=304

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S++H VL  + +A SEL++HQ
Sbjct  43   MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSRSHAVLVALKRAQSELAAHQ  102

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  103  KKILHVDSHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVTLIGSKTQIPT  162

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER  +TF+
Sbjct  163  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMDTFL  222



>gb|AFM87582.1| proteasome (prosome macropain) subunit alpha type 1 [Callorhinchus 
milii]
Length=261

 Score =   244 bits (622),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVK+GSA +GL+SKTH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKRGSATVGLKSKTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KK+  VD+H+G++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV Q+  K QV T
Sbjct  61   KKVLHVDNHVGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSQIGSKTQVPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER+ + F
Sbjct  121  QRYGRRPYGVGLLIAGYDDIGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERQMDHF  179



>ref|NP_001290578.1| proteasome (prosome, macropain) subunit, alpha type, 1 [Esox 
lucius]
 gb|ACO13203.1| Proteasome subunit alpha type-1 [Esox lucius]
Length=262

 Score =   244 bits (622),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQY  DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S+TH VL  + +A SEL++HQ
Sbjct  1    MFRNQYGNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSRTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDEHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVTLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER  +TF+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMDTFL  180



>gb|ACO07890.1| Proteasome subunit alpha type 1 [Oncorhynchus mykiss]
 gb|ACO07957.1| Proteasome subunit alpha type 1 [Oncorhynchus mykiss]
Length=262

 Score =   244 bits (622),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S +H VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSHSHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDSHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVTLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER  +TF+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMDTFL  180



>ref|NP_001271999.1| proteasome subunit alpha type-1 [Macaca fascicularis]
 sp|Q4R3H2.1|PSA1_MACFA RecName: Full=Proteasome subunit alpha type-1 [Macaca fascicularis]
 dbj|BAE02345.1| unnamed protein product [Macaca fascicularis]
Length=263

 Score =   244 bits (622),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++H+
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHR  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  61   KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>emb|CDQ87916.1| unnamed protein product, partial [Oncorhynchus mykiss]
Length=285

 Score =   244 bits (623),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S +H VL  + +A SEL++HQ
Sbjct  24   MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSHSHAVLVALKRAQSELAAHQ  83

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ T
Sbjct  84   KKILHVDSHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVTLIGSKTQIPT  143

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER  +TF+
Sbjct  144  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMDTFL  203



>ref|NP_683877.1| proteasome subunit alpha type-1 isoform 1 [Homo sapiens]
 ref|XP_005578609.1| PREDICTED: proteasome subunit alpha type-1 isoform X1 [Macaca 
fascicularis]
 ref|XP_009184788.1| PREDICTED: proteasome subunit alpha type-1 isoform X1 [Papio 
anubis]
 ref|XP_009244830.1| PREDICTED: proteasome subunit alpha type-1 isoform X1 [Pongo 
abelii]
 gb|EAW68478.1| proteasome (prosome, macropain) subunit, alpha type, 1, isoform 
CRA_c [Homo sapiens]
 dbj|BAG73595.1| proteasome (prosome, macropain) subunit alpha type 1 [synthetic 
construct]
Length=269

 Score =   243 bits (621),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 137/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQK
Sbjct  8    FRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQK  67

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ TQ
Sbjct  68   KILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQ  127

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            R  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  128  RYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  186



>ref|XP_005989712.1| PREDICTED: proteasome subunit alpha type-1 isoform X2 [Latimeria 
chalumnae]
Length=262

 Score =   243 bits (621),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S TH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSTTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + +E PLPV RLV  +  K Q+ T
Sbjct  61   KKILYVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFERPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER  + F+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMDKFL  180



>ref|XP_001521804.1| PREDICTED: proteasome subunit alpha type-1, partial [Ornithorhynchus 
anatinus]
Length=262

 Score =   243 bits (621),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQK
Sbjct  1    FRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQK  60

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ TQ
Sbjct  61   KILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQ  120

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETF  602
            R  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLERR   F
Sbjct  121  RYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERRMSEF  178



>ref|XP_005887610.1| PREDICTED: proteasome subunit alpha type-1 isoform X1 [Bos mutus]
Length=269

 Score =   243 bits (621),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 137/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQK
Sbjct  8    FRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQK  67

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ TQ
Sbjct  68   KILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQ  127

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            R  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  128  RYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  186



>ref|XP_005989711.1| PREDICTED: proteasome subunit alpha type-1 isoform X1 [Latimeria 
chalumnae]
Length=261

 Score =   243 bits (620),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  66   MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ  245
            MFRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+S TH VL  + +A SEL++HQ
Sbjct  1    MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSTTHAVLVALKRAQSELAAHQ  60

Query  246  KKIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCT  425
            KKI  VD+HIG++IAGLTAD R+L  +MR EC++  + +E PLPV RLV  +  K Q+ T
Sbjct  61   KKILYVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFERPLPVSRLVSLIGSKTQIPT  120

Query  426  QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            QR  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER  + F+
Sbjct  121  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCKAMSIGARSQSARTYLERHMDKFL  180



>gb|EHB12903.1| Proteasome subunit alpha type-1, partial [Heterocephalus glaber]
Length=263

 Score =   243 bits (620),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 137/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQK
Sbjct  2    FRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQK  61

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ TQ
Sbjct  62   KILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQ  121

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            R  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  122  RYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  180



>gb|EHH56426.1| hypothetical protein EGM_05833, partial [Macaca fascicularis]
Length=262

 Score =   243 bits (620),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 137/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQK
Sbjct  1    FRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQK  60

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ TQ
Sbjct  61   KILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQ  120

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            R  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  RYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  179



>gb|EHH23082.1| hypothetical protein EGK_06468, partial [Macaca mulatta]
Length=262

 Score =   243 bits (620),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 137/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  69   FRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQK  248
            FRNQYD DVT WSP GR+ Q+EYAMEAVKQGSA +GL+SKTH VL  + +A SEL++HQK
Sbjct  1    FRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQK  60

Query  249  KIFKVDDHIGVAIAGLTADGRVLSRYMRNECINYSYSYESPLPVGRLVVQLADKAQVCTQ  428
            KI  VD+HIG++IAGLTAD R+L  +MR EC++  + ++ PLPV RLV  +  K Q+ TQ
Sbjct  61   KILHVDNHIGISIAGLTADARLLCNFMRKECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQ  120

Query  429  RSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFETFM  605
            R  +RPYGVGLL+ G D+ G H++  CPS NYF+ +A +IG+RSQ+A+TYLER    FM
Sbjct  121  RYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM  179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660