BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G12

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI35464.3|  unnamed protein product                                112   4e-27   Vitis vinifera
gb|ADD51186.1|  tumor-related protein                                   112   4e-27   Vitis cinerea var. helleri x Vitis riparia
ref|XP_002266430.1|  PREDICTED: miraculin                               111   5e-27   Vitis vinifera
emb|CAN75396.1|  hypothetical protein VITISV_028636                     111   6e-27   Vitis vinifera
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg                111   7e-27   Erythranthe guttata [common monkey flower]
emb|CAN81015.1|  hypothetical protein VITISV_025776                     109   2e-26   Vitis vinifera
emb|CAN65022.1|  hypothetical protein VITISV_027379                     108   7e-26   Vitis vinifera
ref|XP_002270111.1|  PREDICTED: miraculin                               108   1e-25   Vitis vinifera
ref|XP_011035401.1|  PREDICTED: miraculin-like                          107   2e-25   Populus euphratica
gb|AEK26933.1|  Kunitz-type trypsin inhibitor B2                        107   3e-25   Populus nigra [black poplar]
ref|XP_011072079.1|  PREDICTED: miraculin                               107   3e-25   Sesamum indicum [beniseed]
gb|ACS92509.1|  Kunitz-type protease inhibitor KPI-D2.3                 107   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_002305032.2|  trypsin protein inhibitor 3                        107   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009627067.1|  PREDICTED: miraculin                               105   2e-24   Nicotiana tomentosiformis
gb|ADK62529.1|  miraculin-like protein                                  104   2e-24   Nicotiana benthamiana
ref|XP_009792285.1|  PREDICTED: miraculin                               104   3e-24   Nicotiana sylvestris
ref|XP_010663911.1|  PREDICTED: miraculin-like                          103   6e-24   Vitis vinifera
gb|AAC49969.1|  tumor-related protein                                   103   8e-24   Nicotiana tabacum [American tobacco]
ref|XP_004234331.1|  PREDICTED: miraculin                               102   1e-23   
gb|AAQ96377.1|  miraculin-like protein                                  102   3e-23   Solanum palustre
ref|XP_006351548.1|  PREDICTED: miraculin-like                        99.8    2e-22   Solanum tuberosum [potatoes]
ref|XP_006351546.1|  PREDICTED: miraculin-like                        98.2    6e-22   Solanum tuberosum [potatoes]
gb|KJB75158.1|  hypothetical protein B456_012G027700                  98.2    6e-22   Gossypium raimondii
ref|XP_002265965.1|  PREDICTED: miraculin                             98.2    6e-22   Vitis vinifera
gb|KJB75157.1|  hypothetical protein B456_012G027600                  98.2    7e-22   Gossypium raimondii
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...  97.8    7e-22   Theobroma cacao [chocolate]
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg           97.8    2e-21   
gb|KHN24496.1|  Miraculin                                             96.7    2e-21   Glycine soja [wild soybean]
ref|NP_001237597.1|  uncharacterized protein LOC100527288 precursor   96.7    3e-21   Glycine max [soybeans]
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg           96.3    3e-21   Citrus clementina [clementine]
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           95.9    5e-21   Citrus clementina [clementine]
ref|XP_002266302.2|  PREDICTED: miraculin-like                        94.7    5e-21   Vitis vinifera
gb|AFL91231.1|  Kunitz-like protease inhibitor                        94.4    1e-20   Helianthus annuus
ref|XP_006493430.1|  PREDICTED: miraculin-like                        94.7    1e-20   Citrus sinensis [apfelsine]
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg           94.7    1e-20   Prunus persica
ref|XP_003534083.1|  PREDICTED: miraculin-like                        94.7    1e-20   Glycine max [soybeans]
ref|XP_006495064.1|  PREDICTED: miraculin-like                        94.7    1e-20   
ref|XP_007152537.1|  hypothetical protein PHAVU_004G138500g           94.4    1e-20   Phaseolus vulgaris [French bean]
gb|AFL91226.1|  Kunitz-like protease inhibitor                        94.0    2e-20   Helianthus annuus
ref|XP_008238584.1|  PREDICTED: miraculin-like                        94.4    2e-20   Prunus mume [ume]
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg           94.4    2e-20   Citrus clementina [clementine]
ref|XP_006495063.1|  PREDICTED: miraculin-like                        94.4    2e-20   Citrus sinensis [apfelsine]
ref|XP_006495061.1|  PREDICTED: miraculin-like                        94.4    2e-20   
ref|XP_006493433.1|  PREDICTED: miraculin-like                        94.4    2e-20   
gb|ACS92516.1|  Kunitz-type protease inhibitor KPI-D12                94.0    2e-20   Populus trichocarpa x Populus deltoides
ref|XP_007029360.1|  Kunitz family trypsin and protease inhibitor...  93.6    3e-20   
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg           94.0    3e-20   
gb|AFL91227.1|  Kunitz-like protease inhibitor                        93.2    3e-20   Helianthus annuus
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg           93.2    4e-20   Citrus clementina [clementine]
gb|AFK39812.1|  unknown                                               93.2    5e-20   Lotus japonicus
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg           93.2    5e-20   Citrus clementina [clementine]
gb|AFL91233.1|  Kunitz-like protease inhibitor                        92.4    6e-20   Helianthus annuus
ref|XP_006493432.1|  PREDICTED: miraculin-like                        94.4    6e-20   
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           92.4    8e-20   Citrus clementina [clementine]
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg           92.0    1e-19   Citrus clementina [clementine]
ref|XP_004137639.1|  PREDICTED: miraculin-like                        92.0    1e-19   Cucumis sativus [cucumbers]
ref|XP_007210537.1|  hypothetical protein PRUPE_ppa011653mg           91.7    1e-19   
ref|XP_010279465.1|  PREDICTED: miraculin-like                        91.7    2e-19   Nelumbo nucifera [Indian lotus]
emb|CBI35471.3|  unnamed protein product                              96.3    2e-19   Vitis vinifera
ref|XP_008437082.1|  PREDICTED: miraculin                             91.3    2e-19   Cucumis melo [Oriental melon]
ref|XP_006372633.1|  hypothetical protein POPTR_0017s03430g           91.3    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009401850.1|  PREDICTED: miraculin-like                        90.9    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO98557.1|  unnamed protein product                              90.9    4e-19   Coffea canephora [robusta coffee]
ref|XP_006372654.1|  hypothetical protein POPTR_0017s03600g           90.1    6e-19   
gb|AFL91228.1|  Kunitz-like protease inhibitor                        89.4    7e-19   Helianthus annuus
ref|XP_006372632.1|  hypothetical protein POPTR_0017s03420g           89.7    9e-19   
emb|CDO98558.1|  unnamed protein product                              89.7    1e-18   Coffea canephora [robusta coffee]
ref|XP_003534079.1|  PREDICTED: miraculin-like                        89.4    1e-18   Glycine max [soybeans]
ref|XP_011046091.1|  PREDICTED: miraculin-like                        89.4    1e-18   Populus euphratica
gb|KHM99741.1|  Miraculin                                             89.0    1e-18   Glycine soja [wild soybean]
gb|KHM99743.1|  Miraculin                                             89.0    2e-18   Glycine soja [wild soybean]
dbj|BAA82840.1|  miraculin homologue                                  87.4    2e-18   Youngia japonica
ref|XP_010537532.1|  PREDICTED: miraculin                             89.0    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_003534080.1|  PREDICTED: miraculin-like                        88.6    2e-18   Glycine max [soybeans]
ref|XP_003534101.1|  PREDICTED: 21 kDa seed protein-like              89.0    2e-18   Glycine max [soybeans]
ref|XP_003620169.1|  Kunitz-type trypsin inhibitor alpha chain        89.0    2e-18   Medicago truncatula
gb|AFL91232.1|  Kunitz-like protease inhibitor                        87.8    2e-18   Helianthus annuus
emb|CAN63617.1|  hypothetical protein VITISV_041430                   88.6    3e-18   Vitis vinifera
ref|XP_006347379.1|  PREDICTED: miraculin-like                        88.2    3e-18   Solanum tuberosum [potatoes]
ref|NP_001237312.1|  uncharacterized protein LOC100527782 precursor   87.8    4e-18   Glycine max [soybeans]
ref|XP_004137534.1|  PREDICTED: miraculin-like                        87.8    4e-18   Cucumis sativus [cucumbers]
emb|CDP22082.1|  unnamed protein product                              87.8    5e-18   Coffea canephora [robusta coffee]
dbj|BAA82843.1|  miraculin homologue                                  86.7    5e-18   Solanum melongena [aubergine]
emb|CDP21540.1|  unnamed protein product                              87.8    5e-18   Coffea canephora [robusta coffee]
ref|XP_004299457.1|  PREDICTED: miraculin-like                        87.8    6e-18   Fragaria vesca subsp. vesca
emb|CDP21544.1|  unnamed protein product                              87.4    6e-18   Coffea canephora [robusta coffee]
emb|CDP16462.1|  unnamed protein product                              87.4    8e-18   Coffea canephora [robusta coffee]
ref|XP_003534078.1|  PREDICTED: miraculin-like                        87.0    9e-18   Glycine max [soybeans]
ref|XP_010918417.1|  PREDICTED: miraculin-like                        87.0    9e-18   
gb|KHM99738.1|  Miraculin                                             86.7    9e-18   Glycine soja [wild soybean]
gb|AEK26936.1|  Kunitz-type trypsin inhibitor B3                      87.0    1e-17   Populus nigra [black poplar]
ref|XP_008437058.1|  PREDICTED: miraculin-like                        87.0    1e-17   Cucumis melo [Oriental melon]
gb|ADW95389.1|  Kunitz-type trypsin inhibitor                         87.0    1e-17   Populus nigra [black poplar]
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...  87.0    1e-17   Synsepalum dulcificum [miracle fruit]
ref|XP_010683193.1|  PREDICTED: miraculin-like                        86.7    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008437071.1|  PREDICTED: miraculin-like                        86.7    1e-17   Cucumis melo [Oriental melon]
emb|CDP21024.1|  unnamed protein product                              86.3    2e-17   Coffea canephora [robusta coffee]
ref|XP_006372631.1|  trypsin protein inhibitor 3                      85.5    3e-17   
gb|AFK41478.1|  unknown                                               85.5    3e-17   Medicago truncatula
ref|XP_003620188.1|  Miraculin                                        85.5    3e-17   Medicago truncatula
ref|XP_010101167.1|  hypothetical protein L484_005403                 85.1    4e-17   Morus notabilis
ref|XP_009777240.1|  PREDICTED: miraculin-like                        85.1    4e-17   Nicotiana sylvestris
gb|KHN24493.1|  Miraculin                                             84.3    7e-17   Glycine soja [wild soybean]
gb|AHJ25677.1|  Kunitz-type trypsin inhibitor                         84.7    8e-17   Curcuma longa
ref|XP_009608866.1|  PREDICTED: miraculin-like                        84.3    8e-17   Nicotiana tomentosiformis
gb|KHM99744.1|  Miraculin                                             83.2    2e-16   Glycine soja [wild soybean]
ref|XP_008778295.1|  PREDICTED: miraculin                             82.8    2e-16   Phoenix dactylifera
emb|CDO98554.1|  unnamed protein product                              82.8    3e-16   Coffea canephora [robusta coffee]
emb|CDP20822.1|  unnamed protein product                              82.8    3e-16   Coffea canephora [robusta coffee]
gb|AFL91229.1|  Kunitz-like protease inhibitor                        82.0    3e-16   Helianthus annuus
ref|XP_003620172.1|  21 kDa seed protein                              82.0    5e-16   Medicago truncatula
gb|ACF74332.1|  Kunitz trypsin inhibitor 4                            82.0    5e-16   Arachis hypogaea [goober]
ref|XP_010476950.1|  PREDICTED: miraculin-like                        81.6    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_011046090.1|  PREDICTED: miraculin-like                        81.6    7e-16   Populus euphratica
ref|XP_010041215.1|  PREDICTED: miraculin-like                        81.6    8e-16   Eucalyptus grandis [rose gum]
ref|XP_003548288.1|  PREDICTED: miraculin-like                        81.6    8e-16   Glycine max [soybeans]
ref|NP_001241106.1|  uncharacterized protein LOC100790688 precursor   81.6    9e-16   Glycine max [soybeans]
ref|XP_010042449.1|  PREDICTED: miraculin-like                        81.6    1e-15   
gb|AFL91234.1|  Kunitz-like protease inhibitor                        80.5    1e-15   Helianthus annuus
ref|XP_010037029.1|  PREDICTED: miraculin-like                        81.6    1e-15   
ref|XP_010683194.1|  PREDICTED: miraculin-like                        80.9    1e-15   
gb|KCW48670.1|  hypothetical protein EUGRSUZ_K02326                   80.9    2e-15   Eucalyptus grandis [rose gum]
ref|NP_001238098.1|  uncharacterized protein LOC100306134 precursor   80.9    2e-15   Glycine max [soybeans]
ref|XP_009803614.1|  PREDICTED: miraculin-like                        80.1    3e-15   Nicotiana sylvestris
ref|XP_009615974.1|  PREDICTED: miraculin-like                        80.1    3e-15   Nicotiana tomentosiformis
gb|AFK33359.1|  unknown                                               79.7    3e-15   Medicago truncatula
emb|CDP20533.1|  unnamed protein product                              79.7    4e-15   Coffea canephora [robusta coffee]
emb|CDP21543.1|  unnamed protein product                              79.7    4e-15   Coffea canephora [robusta coffee]
ref|XP_004301214.1|  PREDICTED: miraculin-like                        79.7    4e-15   Fragaria vesca subsp. vesca
ref|XP_004235409.1|  PREDICTED: miraculin-like                        79.3    5e-15   Solanum lycopersicum
ref|XP_009793041.1|  PREDICTED: miraculin-like                        79.3    5e-15   Nicotiana sylvestris
gb|ACL12055.1|  Kunitz trypsin inhibitor                              79.0    6e-15   Nicotiana tabacum [American tobacco]
gb|ADW95380.1|  Kunitz-type trypsin inhibitor                         78.6    9e-15   Populus nigra [black poplar]
ref|XP_002305034.2|  hypothetical protein POPTR_0004s06610g           78.6    1e-14   
ref|XP_004515059.1|  PREDICTED: miraculin-like                        78.6    1e-14   Cicer arietinum [garbanzo]
emb|CDY19181.1|  BnaC05g13820D                                        78.2    1e-14   Brassica napus [oilseed rape]
ref|XP_009149240.1|  PREDICTED: miraculin                             78.2    1e-14   Brassica rapa
ref|XP_006353931.1|  PREDICTED: miraculin-like                        78.2    1e-14   Solanum tuberosum [potatoes]
gb|AEK26927.1|  Kunitz-type trypsin inhibitor B4                      77.8    2e-14   Populus nigra [black poplar]
gb|AFL91230.1|  Kunitz-like protease inhibitor                        76.6    2e-14   Helianthus annuus
emb|CDX83886.1|  BnaC08g17590D                                        77.0    3e-14   
emb|CDP21779.1|  unnamed protein product                              77.4    3e-14   Coffea canephora [robusta coffee]
gb|ABX76297.1|  stigma expressed protein                              77.4    3e-14   Nicotiana alata [flowering tobacco]
emb|CDY26209.1|  BnaA06g12080D                                        77.0    3e-14   Brassica napus [oilseed rape]
ref|XP_009782173.1|  PREDICTED: miraculin-like                        77.4    3e-14   Nicotiana sylvestris
ref|XP_010459406.1|  PREDICTED: miraculin-like                        77.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|NP_173228.1|  kunitz family trypsin and protease inhibitor pr...  76.6    4e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KHM99735.1|  Miraculin                                             75.5    6e-14   Glycine soja [wild soybean]
ref|XP_009614755.1|  PREDICTED: miraculin-like                        76.3    6e-14   Nicotiana tomentosiformis
emb|CDX96746.1|  BnaA08g22890D                                        76.3    6e-14   
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor   76.3    7e-14   Glycine max [soybeans]
emb|CDP19136.1|  unnamed protein product                              75.9    8e-14   Coffea canephora [robusta coffee]
gb|KFK42293.1|  hypothetical protein AALP_AA2G237000                  75.9    8e-14   Arabis alpina [alpine rockcress]
ref|XP_011035408.1|  PREDICTED: miraculin-like                        75.9    9e-14   Populus euphratica
emb|CDO98552.1|  unnamed protein product                              75.9    9e-14   Coffea canephora [robusta coffee]
emb|CDO98555.1|  unnamed protein product                              75.9    1e-13   Coffea canephora [robusta coffee]
emb|CDP18338.1|  unnamed protein product                              75.5    1e-13   Coffea canephora [robusta coffee]
ref|XP_010498164.1|  PREDICTED: miraculin-like                        75.1    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010683192.1|  PREDICTED: miraculin-like                        75.1    2e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|ACO40154.1|  kunitz trypsin inhibitor 4                            74.7    2e-13   Populus balsamifera [balsam poplar]
emb|CAI77767.1|  kunitz trypsin inhibitor                             74.7    2e-13   Populus tremula [European aspen]
ref|XP_009110379.1|  PREDICTED: miraculin-like                        74.7    2e-13   Brassica rapa
ref|XP_003534100.1|  PREDICTED: miraculin-like                        74.7    2e-13   Glycine max [soybeans]
emb|CAI77771.1|  kunitz trypsin inhibitor                             74.7    2e-13   Populus tremula [European aspen]
ref|XP_002890252.1|  trypsin and protease inhibitor family protein    74.3    2e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_009782174.1|  PREDICTED: miraculin-like                        74.7    2e-13   Nicotiana sylvestris
gb|KFK42292.1|  hypothetical protein AALP_AA2G236900                  74.3    3e-13   Arabis alpina [alpine rockcress]
ref|XP_010683390.1|  PREDICTED: miraculin-like                        74.3    3e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|ACO40082.1|  kunitz trypsin inhibitor 4                            73.9    3e-13   Populus balsamifera [balsam poplar]
gb|ACO40073.1|  kunitz trypsin inhibitor 4                            73.9    3e-13   Populus balsamifera [balsam poplar]
emb|CAI77774.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
emb|CAI77775.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
emb|CAI77765.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
emb|CAI77768.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
emb|CAI77783.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
emb|CAI77764.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
emb|CAI77793.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
emb|CAI77770.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
emb|CAI77786.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
emb|CAI77769.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
gb|ACO40104.1|  kunitz trypsin inhibitor 4                            73.6    4e-13   Populus balsamifera [balsam poplar]
emb|CAI77777.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
emb|CAI77773.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
emb|CAI77782.1|  kunitz trypsin inhibitor                             73.9    4e-13   Populus tremula [European aspen]
ref|XP_002305033.1|  trypsin protein inhibitor 3                      73.9    5e-13   Populus trichocarpa [western balsam poplar]
gb|AEK26926.1|  Kunitz-type trypsin inhibitor B1                      73.9    5e-13   Populus nigra [black poplar]
gb|ACO40086.1|  kunitz trypsin inhibitor 4                            73.2    6e-13   Populus balsamifera [balsam poplar]
gb|ACO40077.1|  kunitz trypsin inhibitor 4                            73.2    6e-13   Populus balsamifera [balsam poplar]
emb|CAI77766.1|  kunitz trypsin inhibitor                             73.6    7e-13   Populus tremula [European aspen]
gb|ACO40080.1|  kunitz trypsin inhibitor 4                            72.8    8e-13   Populus balsamifera [balsam poplar]
ref|XP_010540187.1|  PREDICTED: bark lectin isoform 2-like            72.8    1e-12   Tarenaya hassleriana [spider flower]
emb|CAI77798.1|  kunitz trypsin inhibitor                             72.8    1e-12   Populus tremula [European aspen]
ref|XP_006304577.1|  hypothetical protein CARUB_v10011616mg           72.8    1e-12   Capsella rubella
emb|CDP21726.1|  unnamed protein product                              72.8    1e-12   Coffea canephora [robusta coffee]
ref|XP_004515058.1|  PREDICTED: miraculin-like                        72.4    1e-12   Cicer arietinum [garbanzo]
gb|ACO40133.1|  kunitz trypsin inhibitor 4                            72.4    1e-12   Populus balsamifera [balsam poplar]
emb|CAI77785.1|  kunitz trypsin inhibitor                             72.8    1e-12   Populus tremula [European aspen]
gb|AAQ84217.1|  Kunitz trypsin inhibitor 4                            72.4    1e-12   Populus trichocarpa x Populus deltoides
gb|KHM99732.1|  Miraculin                                             72.4    1e-12   Glycine soja [wild soybean]
gb|ACO40153.1|  kunitz trypsin inhibitor 4                            72.0    1e-12   Populus balsamifera [balsam poplar]
gb|ACO40093.1|  kunitz trypsin inhibitor 4                            72.0    1e-12   Populus balsamifera [balsam poplar]
gb|ACO40119.1|  kunitz trypsin inhibitor 4                            72.0    2e-12   Populus balsamifera [balsam poplar]
gb|ACO40144.1|  kunitz trypsin inhibitor 4                            72.0    2e-12   Populus balsamifera [balsam poplar]
emb|CDO98560.1|  unnamed protein product                              72.0    2e-12   Coffea canephora [robusta coffee]
gb|ACO40074.1|  kunitz trypsin inhibitor 4                            72.0    2e-12   Populus balsamifera [balsam poplar]
ref|XP_006347377.1|  PREDICTED: miraculin-like                        72.0    2e-12   Solanum tuberosum [potatoes]
emb|CAI77772.1|  kunitz trypsin inhibitor                             72.0    2e-12   Populus tremula [European aspen]
ref|XP_003620187.1|  Miraculin                                        72.0    2e-12   Medicago truncatula
gb|ACO40084.1|  kunitz trypsin inhibitor 4                            71.6    2e-12   Populus balsamifera [balsam poplar]
dbj|BAA82842.1|  miraculin homologue                                  70.9    2e-12   Taraxacum officinale [dandelion]
emb|CAI77790.1|  kunitz trypsin inhibitor                             71.6    2e-12   Populus tremula [European aspen]
emb|CAI77795.1|  kunitz trypsin inhibitor                             71.6    2e-12   Populus tremula [European aspen]
emb|CAI77803.1|  kunitz trypsin inhibitor                             71.6    3e-12   Populus tremula [European aspen]
gb|ACO40078.1|  kunitz trypsin inhibitor 4                            71.2    3e-12   Populus balsamifera [balsam poplar]
gb|ACO40145.1|  kunitz trypsin inhibitor 4                            71.2    3e-12   Populus balsamifera [balsam poplar]
ref|XP_006477858.1|  PREDICTED: 21 kDa seed protein-like isoform X1   71.6    3e-12   Citrus sinensis [apfelsine]
gb|ABK96521.1|  unknown                                               71.6    3e-12   Populus trichocarpa x Populus deltoides
gb|ACS92519.1|  Kunitz-type protease inhibitor KPI-D8                 71.2    3e-12   Populus trichocarpa x Populus nigra
gb|ACO40100.1|  kunitz trypsin inhibitor 4                            71.2    3e-12   Populus balsamifera [balsam poplar]
gb|AFK34345.1|  unknown                                               71.2    3e-12   Medicago truncatula
ref|XP_003622420.1|  Endopeptidase inhibitor                          70.9    4e-12   Medicago truncatula
emb|CAI77800.1|  kunitz trypsin inhibitor                             70.9    4e-12   Populus tremula [European aspen]
gb|ACS92500.1|  Kunitz-type protease inhibitor KPI-D9                 70.9    4e-12   Populus trichocarpa x Populus nigra
gb|ABX76298.1|  sexual organ expressed protein                        71.2    4e-12   Nicotiana alata [flowering tobacco]
ref|XP_010279489.1|  PREDICTED: miraculin-like                        70.9    4e-12   Nelumbo nucifera [Indian lotus]
ref|XP_011035403.1|  PREDICTED: 21 kDa seed protein-like              70.9    4e-12   Populus euphratica
ref|XP_009614754.1|  PREDICTED: miraculin-like                        71.2    4e-12   
gb|ACS37303.1|  trypsin inhibitor                                     70.9    5e-12   Bergera koenigii [curry leaf]
ref|XP_009406658.1|  PREDICTED: miraculin-like                        70.9    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004241480.1|  PREDICTED: miraculin-like                        70.9    5e-12   Solanum lycopersicum
ref|XP_003548289.1|  PREDICTED: miraculin-like                        70.5    5e-12   Glycine max [soybeans]
ref|XP_010279488.1|  PREDICTED: miraculin-like                        70.9    5e-12   Nelumbo nucifera [Indian lotus]
ref|XP_003620174.1|  Pathogen-inducible trypsin-inhibitor-like pr...  70.5    7e-12   Medicago truncatula
emb|CDP19138.1|  unnamed protein product                              70.5    7e-12   Coffea canephora [robusta coffee]
gb|ACO40081.1|  kunitz trypsin inhibitor 4                            70.1    8e-12   Populus balsamifera [balsam poplar]
ref|XP_006441460.1|  hypothetical protein CICLE_v10024584mg           69.7    8e-12   
ref|XP_003620175.1|  Pathogen-inducible trypsin-inhibitor-like pr...  70.1    8e-12   Medicago truncatula
ref|XP_011035402.1|  PREDICTED: 21 kDa seed protein-like              69.7    1e-11   Populus euphratica
ref|XP_006442410.1|  hypothetical protein CICLE_v10022211mg           69.3    1e-11   Citrus clementina [clementine]
ref|XP_004242148.1|  PREDICTED: miraculin-like                        69.3    1e-11   Solanum lycopersicum
ref|XP_002309884.2|  hypothetical protein POPTR_0007s03650g           69.3    1e-11   
gb|KDO44067.1|  hypothetical protein CISIN_1g031474mg                 68.9    1e-11   Citrus sinensis [apfelsine]
ref|XP_006477857.1|  PREDICTED: 21 kDa seed protein-like              68.9    2e-11   Citrus sinensis [apfelsine]
ref|XP_010683195.1|  PREDICTED: miraculin-like                        68.9    2e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006347378.1|  PREDICTED: miraculin-like                        68.6    2e-11   Solanum tuberosum [potatoes]
pdb|3IIR|A  Chain A, Crystal Structure Of Miraculin Like Protein ...  68.2    4e-11   Bergera koenigii [curry leaf]
ref|XP_003534082.1|  PREDICTED: miraculin-like                        68.2    4e-11   Glycine max [soybeans]
gb|ABK01288.1|  miraculin-like protein                                68.2    4e-11   Coffea arabica [arabica coffee]
ref|XP_006347376.1|  PREDICTED: miraculin-like                        67.8    4e-11   Solanum tuberosum [potatoes]
ref|XP_010249125.1|  PREDICTED: miraculin-like                        67.8    6e-11   Nelumbo nucifera [Indian lotus]
gb|KHM99742.1|  Miraculin                                             67.0    6e-11   Glycine soja [wild soybean]
ref|XP_006477860.1|  PREDICTED: 21 kDa seed protein-like              67.4    7e-11   Citrus sinensis [apfelsine]
gb|AEK26923.1|  Kunitz-type trypsin inhibitor C7                      67.0    8e-11   Populus nigra [black poplar]
ref|XP_003620185.1|  21 kDa seed protein                              67.0    9e-11   Medicago truncatula
ref|XP_006441436.1|  hypothetical protein CICLE_v10023581mg           67.0    9e-11   
ref|XP_006847953.1|  hypothetical protein AMTR_s00029p00141480        67.0    1e-10   
ref|XP_006371005.1|  truncated Kunitz trypsin inhibitor family pr...  66.6    1e-10   Populus trichocarpa [western balsam poplar]
gb|ADW95385.1|  Kunitz-type trypsin inhibitor                         66.6    1e-10   Populus nigra [black poplar]
ref|XP_011012012.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  66.2    2e-10   Populus euphratica
gb|AFK41530.1|  unknown                                               66.2    2e-10   Lotus japonicus
ref|XP_006353919.1|  PREDICTED: miraculin-like                        66.6    2e-10   Solanum tuberosum [potatoes]
gb|AEK31192.1|  miraculin-like protein 1                              65.9    2e-10   Citrus maxima [buntan]
gb|AEK31191.1|  miraculin-like protein 1                              65.9    2e-10   Citrus aurantiifolia [lime]
ref|XP_009601782.1|  PREDICTED: miraculin-like                        66.2    2e-10   Nicotiana tomentosiformis
gb|AEK31190.1|  miraculin-like protein 1                              65.5    2e-10   Citrus limonia [Canton lemon]
ref|XP_011023016.1|  PREDICTED: endogenous alpha-amylase/subtilis...  65.9    3e-10   Populus euphratica
gb|AEK26932.1|  Kunitz-type trypsin inhibitor C6                      65.9    3e-10   Populus nigra [black poplar]
prf||1922206A  trypsin inhibitor:ISOTYPE=a                            65.5    3e-10
ref|XP_009782172.1|  PREDICTED: miraculin-like                        66.2    3e-10   Nicotiana sylvestris
ref|XP_006442412.1|  hypothetical protein CICLE_v10023557mg           65.5    3e-10   
ref|XP_010537526.1|  PREDICTED: bark lectin isoform 1-like            65.5    3e-10   Tarenaya hassleriana [spider flower]
ref|XP_006478228.1|  PREDICTED: uncharacterized protein LOC102606959  67.8    3e-10   
ref|XP_010428237.1|  PREDICTED: miraculin-like                        65.1    5e-10   Camelina sativa [gold-of-pleasure]
gb|ABG47463.1|  vegetative storage protein                            65.1    5e-10   Litchi chinensis [litchi]
ref|XP_010536414.1|  PREDICTED: miraculin-like                        65.1    5e-10   Tarenaya hassleriana [spider flower]
dbj|BAA82841.1|  miraculin homologue                                  63.9    5e-10   Youngia japonica
ref|XP_003534081.1|  PREDICTED: miraculin-like                        64.7    6e-10   Glycine max [soybeans]
ref|XP_011023019.1|  PREDICTED: endogenous alpha-amylase/subtilis...  64.7    6e-10   Populus euphratica
ref|XP_004241479.1|  PREDICTED: miraculin-like                        64.7    6e-10   Solanum lycopersicum
ref|XP_006347486.1|  PREDICTED: miraculin-like                        63.5    8e-10   
ref|XP_009789071.1|  PREDICTED: cysteine protease inhibitor 8-like    64.7    8e-10   
ref|XP_010416116.1|  PREDICTED: miraculin-like                        64.3    9e-10   
gb|KHM99737.1|  Miraculin                                             64.3    9e-10   
ref|XP_009614753.1|  PREDICTED: miraculin-like                        64.7    9e-10   
gb|ADW95376.1|  Kunitz-type trypsin inhibitor                         64.3    9e-10   
gb|AAF15901.1|AF208020_1  putative proteinase inhibitor               64.7    9e-10   
ref|XP_004237191.1|  PREDICTED: miraculin-like                        64.3    1e-09   
ref|XP_006302823.1|  hypothetical protein CARUB_v10020954mg           63.9    1e-09   
emb|CBJ94886.1|  kunitz trypsin inhibitor                             62.4    1e-09   
prf||1922206B  trypsin inhibitor:ISOTYPE=b                            63.5    1e-09
ref|XP_006416660.1|  hypothetical protein EUTSA_v10008818mg           63.5    2e-09   
ref|XP_002888923.1|  trypsin and protease inhibitor family protein    63.5    2e-09   
ref|XP_009758946.1|  PREDICTED: miraculin-like                        63.5    2e-09   
ref|XP_009105980.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  63.2    2e-09   
emb|CDX72971.1|  BnaC06g34190D                                        63.2    2e-09   
ref|XP_002309881.2|  hypothetical protein POPTR_0007s03620g           62.8    3e-09   
emb|CAZ64526.1|  Kunitz trypsin inhibitor                             62.4    3e-09   
gb|ACS92520.1|  Kunitz-type protease inhibitor KPI-F9                 62.8    3e-09   
ref|XP_004235412.1|  PREDICTED: miraculin-like                        63.2    3e-09   
ref|XP_009344613.1|  PREDICTED: miraculin-like                        62.8    3e-09   
ref|XP_010471385.1|  PREDICTED: trypsin inhibitor BvTI-like           62.4    3e-09   
ref|XP_011092684.1|  PREDICTED: miraculin-like                        62.4    4e-09   
ref|XP_010673342.1|  PREDICTED: miraculin-like                        62.4    4e-09   
ref|XP_010673346.1|  PREDICTED: miraculin-like                        62.0    5e-09   
ref|XP_009344614.1|  PREDICTED: miraculin-like                        61.6    6e-09   
ref|XP_002525871.1|  Alpha-amylase/subtilisin inhibitor precursor...  61.6    6e-09   
pdb|3S8J|A  Chain A, Crystal Structure Of A Papaya Latex Serine P...  61.6    7e-09   
emb|CDX72972.1|  BnaC06g34200D                                        61.6    7e-09   
ref|XP_006448699.1|  hypothetical protein CICLE_v10016767mg           61.2    8e-09   
gb|KDO46146.1|  hypothetical protein CISIN_1g047893mg                 60.5    9e-09   
ref|XP_009105981.1|  PREDICTED: 21 kDa seed protein-like              61.2    1e-08   
ref|XP_006478135.1|  PREDICTED: miraculin-like                        61.6    1e-08   
gb|KDO40852.1|  hypothetical protein CISIN_1g046118mg                 61.2    1e-08   
ref|XP_010540186.1|  PREDICTED: bark lectin isoform 2-like            61.2    1e-08   
emb|CDY11118.1|  BnaC06g23700D                                        60.8    1e-08   
ref|XP_010540047.1|  PREDICTED: bark lectin isoform 2-like            60.8    1e-08   
ref|XP_006441469.1|  hypothetical protein CICLE_v10024002mg           60.8    1e-08   
sp|P83594.1|IFXA_BAUUN  RecName: Full=Factor Xa inhibitor BuXI        60.1    2e-08   
gb|AAG38518.1|AF283533_1  miraculin-like protein 2                    60.8    2e-08   
emb|CBJ94870.1|  kunitz trypsin inhibitor                             58.9    2e-08   
gb|KHM99740.1|  Miraculin                                             59.7    2e-08   
ref|XP_002525872.1|  Miraculin precursor, putative                    60.1    2e-08   
ref|XP_006383817.1|  truncated Kunitz trypsin inhibitor family pr...  60.1    2e-08   
emb|CDQ51987.1|  alpha amylase/subtilisin inhibitor                   60.1    2e-08   
gb|KFK42291.1|  hypothetical protein AALP_AA2G236700                  60.1    2e-08   
ref|XP_006441461.1|  hypothetical protein CICLE_v10022001mg           60.5    2e-08   
gb|KJB73815.1|  hypothetical protein B456_011G254500                  60.1    3e-08   
ref|XP_006468645.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  59.7    3e-08   
gb|AEK26922.1|  Kunitz-type trypsin inhibitor C1                      59.3    3e-08   
gb|KDO77364.1|  hypothetical protein CISIN_1g0437192mg                59.3    4e-08   
ref|XP_006441431.1|  hypothetical protein CICLE_v10023623mg           58.5    4e-08   
gb|AAL85637.1|  trypsin inhibitor                                     58.9    4e-08   
gb|AAL85640.1|  trypsin inhibitor                                     58.9    4e-08   
ref|XP_004139192.1|  PREDICTED: miraculin-like                        59.3    4e-08   
gb|AAL85661.1|  trypsin inhibitor                                     58.5    5e-08   
ref|XP_009630289.1|  PREDICTED: miraculin-like                        59.7    5e-08   
gb|KFK31885.1|  hypothetical protein AALP_AA6G171300                  58.9    5e-08   
gb|ACJ51124.1|  talisin                                               58.9    5e-08   
gb|KGN60879.1|  hypothetical protein Csa_2G021500                     58.9    5e-08   
ref|XP_006360663.1|  PREDICTED: miraculin-like                        59.3    5e-08   
gb|ACS92521.1|  Kunitz-type protease inhibitor KPI-F4                 58.5    7e-08   
ref|XP_010416131.1|  PREDICTED: bark lectin isoform 2-like isofor...  58.9    7e-08   
gb|AEK26931.1|  Kunitz-type trypsin inhibitor C5                      58.5    8e-08   
sp|P80691.1|LSPI_CARPA  RecName: Full=Latex serine proteinase inh...  58.2    8e-08   
gb|KDP27287.1|  hypothetical protein JCGZ_21018                       58.2    8e-08   
emb|CBJ94877.1|  kunitz trypsin inhibitor                             57.8    9e-08   
ref|XP_010416130.1|  PREDICTED: bark lectin isoform 2-like isofor...  58.9    9e-08   
gb|AEK31197.1|  miraculin-like protein 2                              57.8    1e-07   
gb|AIS71915.1|  hypothetical protein                                  58.5    1e-07   
gb|AAL85659.1|  trypsin inhibitor                                     57.8    1e-07   
gb|AAV41234.1|  putative 21 kDa trypsin inhibitor                     58.5    1e-07   
ref|XP_002525873.1|  Miraculin precursor, putative                    57.8    1e-07   
ref|XP_002300199.1|  truncated Kunitz trypsin inhibitor family pr...  57.8    1e-07   
gb|AAL85660.1|  trypsin inhibitor                                     57.4    1e-07   
gb|AAL85655.1|  trypsin inhibitor                                     57.4    1e-07   
ref|XP_011012013.1|  PREDICTED: endogenous alpha-amylase/subtilis...  57.4    2e-07   
emb|CBK52316.1|  Nb cell deth marker                                  57.8    2e-07   
ref|XP_011046376.1|  PREDICTED: miraculin-like                        57.4    2e-07   
gb|AAV41233.1|  putative 21 kDa trypsin inhibitor                     57.8    2e-07   
ref|XP_007036750.1|  21 kDa seed protein                              57.8    2e-07   
emb|CAC19831.1|  hypothetical protein                                 57.4    2e-07   
ref|XP_007036746.1|  21 kDa seed protein                              57.8    2e-07   
gb|KDP27288.1|  hypothetical protein JCGZ_21019                       57.0    2e-07   
gb|AAL85642.1|  trypsin inhibitor                                     56.6    2e-07   
sp|P32733.1|ID5A_PROJU  RecName: Full=Kunitz-type trypsin inhibit...  56.2    2e-07   
gb|KDP46945.1|  hypothetical protein JCGZ_07962                       56.6    3e-07   
ref|XP_010428253.1|  PREDICTED: bark lectin isoform 2 isoform X2      57.4    3e-07   
ref|XP_010428252.1|  PREDICTED: bark lectin isoform 2 isoform X1      57.4    3e-07   
ref|XP_003532233.1|  PREDICTED: kunitz-type trypsin inhibitor KTI...  56.6    4e-07   
gb|AAL85648.1|  trypsin inhibitor                                     55.8    4e-07   
ref|XP_006441465.1|  hypothetical protein CICLE_v10022129mg           57.0    4e-07   
ref|NP_001233769.1|  uncharacterized protein LOC544001 precursor      57.0    4e-07   
ref|XP_007152529.1|  hypothetical protein PHAVU_004G138000g           56.2    4e-07   
gb|AAK84063.1|AF401200_1  trypsin inhibitor                           55.8    5e-07   
ref|NP_565062.1|  Kunitz family trypsin and protease inhibitor pr...  56.6    5e-07   
sp|P16347.1|IAAS_WHEAT  RecName: Full=Endogenous alpha-amylase/su...  55.8    6e-07   
ref|XP_010471390.1|  PREDICTED: bark lectin isoform 2-like            56.6    6e-07   
gb|ACU19069.1|  unknown                                               56.2    6e-07   
sp|P09941.1|ID5A_ADEPA  RecName: Full=Trypsin inhibitor DE5 alpha...  55.1    6e-07   
ref|XP_002265535.2|  PREDICTED: alpha-amylase/subtilisin inhibito...  55.8    7e-07   
ref|XP_011045717.1|  PREDICTED: miraculin-like                        55.8    7e-07   
gb|KJB73814.1|  hypothetical protein B456_011G254400                  56.2    7e-07   
gb|AEK31196.1|  miraculin-like protein 2                              55.5    7e-07   
ref|XP_004167447.1|  PREDICTED: miraculin-like                        54.3    8e-07   
gb|AEK31198.1|  miraculin-like protein 2                              55.5    8e-07   
gb|AAL85656.1|  trypsin inhibitor                                     55.1    8e-07   
dbj|BAA05474.1|  tumor-related protein                                54.7    8e-07   
prf||1208243A  trypsin isoinhibitor DE5                               55.5    8e-07
ref|XP_006478132.1|  PREDICTED: 21 kDa seed protein-like              55.8    1e-06   
ref|XP_010539163.1|  PREDICTED: bark lectin isoform 1-like            55.5    1e-06   
gb|AAL85644.1|  trypsin inhibitor                                     54.7    1e-06   
gb|AEK31201.1|  miraculin-like protein 2                              55.1    1e-06   
gb|KDP27281.1|  hypothetical protein JCGZ_21012                       54.7    1e-06   
ref|XP_007212054.1|  hypothetical protein PRUPE_ppa011448mg           55.5    1e-06   
ref|XP_006441467.1|  hypothetical protein CICLE_v10022124mg           55.5    1e-06   
ref|XP_010428240.1|  PREDICTED: trypsin inhibitor BvTI-like           55.5    1e-06   
gb|AAL85657.1|  trypsin inhibitor                                     54.3    1e-06   
gb|AFR54471.1|  miraculin-like protein 2                              55.5    1e-06   
sp|P83036.2|ITRY_LEULE  RecName: Full=Trypsin inhibitor; Short=LT...  54.7    1e-06   
ref|XP_006353918.1|  PREDICTED: miraculin-like                        54.7    2e-06   
dbj|BAA03724.1|  25kD storage protein                                 55.1    2e-06   
gb|AAS75739.1|  thermoinhibition-associated THB-6 protein             53.5    2e-06   
gb|KJB73820.1|  hypothetical protein B456_011G254900                  55.1    2e-06   
emb|CDY59714.1|  BnaC02g46470D                                        55.1    2e-06   
ref|XP_011023018.1|  PREDICTED: miraculin-like                        54.7    2e-06   
ref|XP_004295679.2|  PREDICTED: miraculin-like                        54.7    2e-06   
gb|KHN01853.1|  Kunitz-type trypsin inhibitor KTI1                    54.3    2e-06   
gb|AAL85643.1|  trypsin inhibitor                                     53.5    3e-06   
pdb|2IWT|B  Chain B, Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfid...  54.3    3e-06   
ref|XP_002888920.1|  hypothetical protein ARALYDRAFT_476458           54.3    3e-06   
ref|XP_006653614.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  54.3    3e-06   
ref|XP_008226352.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  54.3    3e-06   
ref|XP_010416122.1|  PREDICTED: trypsin inhibitor BvTI-like           54.3    3e-06   
ref|XP_004294173.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  54.3    3e-06   
ref|XP_010428249.1|  PREDICTED: trypsin inhibitor BvTI-like           54.3    3e-06   
ref|XP_006441440.1|  hypothetical protein CICLE_v10022156mg           54.3    4e-06   
gb|AAL85645.1|  trypsin inhibitor                                     53.1    4e-06   
ref|XP_010098224.1|  Alpha-amylase/subtilisin inhibitor               53.9    4e-06   
sp|P86451.1|ITRY_ENTCO  RecName: Full=Trypsin inhibitor; Short=Ec...  53.1    4e-06   
gb|AAF15902.1|AF208022_1  biotic cell death-associated protein        54.3    5e-06   
gb|KDO40321.1|  hypothetical protein CISIN_1g028238mg                 53.9    5e-06   
ref|XP_007152428.1|  hypothetical protein PHAVU_004G129500g           53.9    5e-06   
pdb|4J2K|A  Chain A, Crystal Structure Of A Plant Trypsin Inhibit...  53.1    5e-06   
gb|KHN13525.1|  Trypsin inhibitor A                                   53.9    5e-06   
sp|P07596.2|IAAS_HORVU  RecName: Full=Alpha-amylase/subtilisin in...  53.5    5e-06   
ref|NP_001236355.1|  uncharacterized protein LOC100500579 precursor   53.5    5e-06   
gb|AAB23101.1|  bifunctional subtilisin/alpha-amylase inhibitor, ...  53.1    5e-06   
prf||1802409A  albumin                                                53.9    5e-06
dbj|BAE79511.1|  miraculin-like protein 2                             53.9    6e-06   
ref|XP_007036743.1|  21 kDa seed protein                              53.5    6e-06   
pdb|1AVA|C  Chain C, Amy2BASI PROTEIN-Protein Complex From Barley...  53.1    6e-06   
prf||1210227A  amylase subtilisin inhibitor alpha                     53.1    6e-06
gb|KHN01860.1|  Trypsin inhibitor A                                   53.5    6e-06   
gb|AEK31202.1|  miraculin-like protein 2                              52.8    6e-06   
gb|AAG52121.1|AC010556_3  putative trypsin inhibitor; 19671-20297     53.5    6e-06   
gb|AAK96757.1|  putative trypsin inhibitor                            53.5    7e-06   
ref|XP_006478136.1|  PREDICTED: 21 kDa seed protein-like              53.5    7e-06   
ref|XP_009775241.1|  PREDICTED: latex serine proteinase inhibitor...  53.5    7e-06   
gb|AFR78144.1|  Isa                                                   53.1    7e-06   
ref|XP_003551520.1|  PREDICTED: trypsin inhibitor A-like              53.5    7e-06   
gb|AAN15685.1|  putative trypsin inhibitor                            53.5    7e-06   
ref|NP_001236935.1|  uncharacterized protein LOC100305549 precursor   53.1    7e-06   
gb|AAL85653.1|  trypsin inhibitor                                     52.4    7e-06   
emb|CAA78305.1|  bifunctional alpha-amylase/subtilisin inhibitor      53.1    8e-06   
sp|P25272.1|KTI1_SOYBN  RecName: Full=Kunitz-type trypsin inhibit...  53.1    8e-06   
ref|XP_010253721.1|  PREDICTED: miraculin-like                        53.5    8e-06   
ref|XP_007036748.1|  21 kDa seed protein, putative                    53.5    8e-06   
ref|NP_565061.1|  kunitz trypsin inhibitor 1                          53.1    8e-06   
ref|NP_001237705.1|  uncharacterized protein LOC100305855 precursor   53.1    8e-06   
gb|AEO27900.1|  miraculin-like protein 2                              52.4    8e-06   
gb|AAL85650.1|  trypsin inhibitor                                     52.4    8e-06   
ref|XP_010428238.1|  PREDICTED: trypsin inhibitor BvTI-like           53.1    8e-06   
ref|XP_010537661.1|  PREDICTED: miraculin-like                        52.0    8e-06   
ref|XP_006360306.1|  PREDICTED: miraculin-like                        53.1    9e-06   
gb|AAL85652.1|  trypsin inhibitor                                     52.0    1e-05   
gb|AAL85651.1|  trypsin inhibitor                                     52.0    1e-05   
gb|AEK31199.1|  miraculin-like protein 2                              52.4    1e-05   
sp|P84881.1|IELK1_BAURF  RecName: Full=Kunitz-type elastase inhib...  52.0    1e-05   
gb|AAL85654.1|  trypsin inhibitor                                     52.0    1e-05   
gb|AEO27901.1|  miraculin-like protein 2                              52.0    1e-05   
ref|NP_001238352.1|  uncharacterized protein LOC100306662 precursor   52.8    1e-05   
dbj|BAA03723.1|  25kD storage protein                                 52.8    1e-05   
gb|KFK41765.1|  hypothetical protein AALP_AA2G169300                  52.8    1e-05   
ref|XP_003603351.1|  Trypsin protein inhibitor                        52.8    1e-05   
gb|AEO27899.1|  miraculin-like protein                                52.0    1e-05   
ref|XP_006465039.1|  PREDICTED: 21 kDa seed protein-like              52.4    1e-05   
ref|XP_009105993.1|  PREDICTED: latex serine proteinase inhibitor...  52.8    2e-05   
ref|XP_002448209.1|  hypothetical protein SORBIDRAFT_06g023160        52.8    2e-05   
gb|KHN10906.1|  Trypsin inhibitor A                                   52.0    2e-05   
ref|XP_006432185.1|  hypothetical protein CICLE_v10002395mg           52.4    2e-05   
gb|KJB73816.1|  hypothetical protein B456_011G254600                  52.4    2e-05   
gb|AFK42385.1|  unknown                                               52.0    2e-05   
ref|XP_006390569.1|  hypothetical protein EUTSA_v10019129mg           52.4    2e-05   
ref|XP_003620184.1|  Pathogen-inducible trypsin-inhibitor-like pr...  52.0    2e-05   
emb|CAA56115.1|  trypsin/chymotrypsin inhibitor                       52.0    2e-05   
ref|XP_010098222.1|  hypothetical protein L484_010984                 52.0    2e-05   
gb|ACS49839.1|  trypsin inhibitor 26 kDa isoform                      52.4    2e-05   
gb|KHN10907.1|  Kunitz-type trypsin inhibitor KTI1                    52.4    2e-05   
sp|O82711.1|PIP22_PEA  RecName: Full=Kunitz-type trypsin inhibito...  52.0    2e-05   
ref|NP_001236724.1|  uncharacterized protein LOC100527742 precursor   52.4    2e-05   
gb|KHN01864.1|  Trypsin inhibitor A                                   52.0    2e-05   
gb|KHN10912.1|  Kunitz-type trypsin inhibitor KTI1                    52.4    2e-05   
ref|XP_010098221.1|  Alpha-amylase/subtilisin inhibitor               51.6    2e-05   
sp|P81366.1|IDE3_ERYVA  RecName: Full=Trypsin inhibitor DE-3; Alt...  51.2    3e-05   
sp|P68171.1|IDE3_ERYLA  RecName: Full=Trypsin inhibitor DE-3          50.8    3e-05   
gb|KDO42306.1|  hypothetical protein CISIN_1g047198mg                 49.7    3e-05   
sp|Q41015.2|PIP21_PEA  RecName: Full=Kunitz-type trypsin inhibito...  51.6    3e-05   
sp|P09943.1|IDE3_ERYCA  RecName: Full=Trypsin inhibitor DE-3          50.8    3e-05   
ref|XP_009608941.1|  PREDICTED: serine protease inhibitor 4-like      50.4    3e-05   
ref|NP_001236538.1|  uncharacterized protein LOC100500338 precursor   51.6    3e-05   
gb|AAB26177.1|  Kunitz-type trypsin inhibitor A chain, ACTI-A         50.1    4e-05   
ref|XP_010041216.1|  PREDICTED: miraculin-like                        50.8    4e-05   
gb|AFK45293.1|  unknown                                               51.6    4e-05   
gb|AGW24883.1|  alpha-amylase inhibitor                               51.2    4e-05   
gb|KDO37008.1|  hypothetical protein CISIN_1g038462mg                 50.1    4e-05   
gb|ACU15724.1|  unknown                                               51.2    4e-05   
ref|XP_003532234.1|  PREDICTED: uncharacterized LOC100500599          51.2    5e-05   
gb|AAV41231.1|  putative 21 kDa trypsin inhibitor                     51.2    5e-05   
gb|AFK34475.1|  unknown                                               51.2    5e-05   
ref|NP_001053363.1|  Os04g0526600                                     50.8    5e-05   



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 87/134 (65%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLDT+GK ++SGV YY++PV   +GGGL LASTG ETCP  VVQ   +V+ G 
Sbjct  46   AESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNETCPLDVVQEQQEVSNGL  105

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             ++F PV P KG +R  TD N+ FS S T C +ST+W++ +D  +    ++V +GG +GN
Sbjct  106  PLTFTPVNPKKGVIRVSTDHNIKFSAS-TICVQSTLWKLEYDESSGQ--RFVTTGGVEGN  162

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  163  PGRETLDNWFKIEK  176



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 87/134 (65%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLDT+GK ++SGV YY++PV   +GGGL LASTG ETCP  VVQ   +V+ G 
Sbjct  24   AESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNETCPLDVVQEQQEVSNGL  83

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             ++F PV P KG +R  TD N+ FS S T C +ST+W++ +D  +    ++V +GG +GN
Sbjct  84   PLTFTPVNPKKGVIRVSTDHNIKFSAS-TICVQSTLWKLEYDESSGQ--RFVTTGGVEGN  140

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  141  PGRETLDNWFKIEK  154



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 87/134 (65%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLDT+GK ++SGV YY++PV   +GGGL LASTG ETCP  VVQ   +V+ G 
Sbjct  24   AESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNETCPLDVVQEQQEVSNGL  83

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             ++F PV P KG +R  TD N+ FS S T C +ST+W++ +D  +    ++V +GG +GN
Sbjct  84   PLTFTPVNPKKGVIRVSTDHNIKFSAS-TICVQSTLWKLEYDESSGQ--RFVTTGGVEGN  140

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  141  PGRETLDNWFKIEK  154



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score =   111 bits (278),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 87/134 (65%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLDT+GK ++SGV YY++PV   +GGGL LASTG ETCP  VVQ   +V+ G 
Sbjct  24   AESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNETCPLDVVQEQQEVSNGL  83

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             ++F PV P KG +R  TD N+ FS S T C +ST+W++ +D  +    ++V +GG +GN
Sbjct  84   PLTFTPVNPKKGVIRVSTDHNIKFSAS-TICVQSTLWKLEYDESSGQ--RFVTTGGVEGN  140

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  141  PGRETLDNWFKIEK  154



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score =   111 bits (278),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 85/133 (64%), Gaps = 5/133 (4%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AG  281
             AA+ PP VLD  GK +++GV YY++PV   +GGGL LASTG  TCP SVVQ   ++  G
Sbjct  25   SAAEAPPPVLDISGKELRAGVNYYILPVIRGRGGGLSLASTGNNTCPLSVVQEQSELKKG  84

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              ++F PV P KG VR  TD N+ FS S T C +STVW++ +D        +V +GG +G
Sbjct  85   LPLTFHPVDPKKGVVRLSTDHNIKFSAS-TICVQSTVWRLDNDESTGK--YFVNTGGVEG  141

Query  459  NPGSSTARSWFMI  497
            NPGS +  +WF I
Sbjct  142  NPGSGSISNWFKI  154



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 86/134 (64%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLDT+GK ++SGV YY++PV   +GGGL LASTG E CP  VVQ   +V+ G 
Sbjct  24   AESSPDPVLDTEGKQLRSGVDYYILPVIRGRGGGLTLASTGNENCPLDVVQEQHEVSNGL  83

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             ++F PV P KG +R  TD N+ FS S T C +ST+W++ +D  +    ++V +GG +GN
Sbjct  84   PLTFTPVNPKKGVIRVSTDHNIKFSAS-TICVQSTLWKLEYDESSGQ--RFVTTGGVEGN  140

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  141  PGXETLDNWFKIEK  154



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 86/134 (64%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLDT+GK ++SGV YY++PV   +GGGL LASTG E+CP  VVQ   +V+ G 
Sbjct  24   AESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNESCPLDVVQEQQEVSNGL  83

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             ++F PV P KG +R  TD N+ FS S T C +ST+W++ +D  +     +V +GG +GN
Sbjct  84   PLTFTPVNPKKGVIRVSTDHNIKFSAS-TICVQSTLWKLEYDESSGQ--WFVTTGGVEGN  140

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  141  PGRETLDNWFKIEK  154



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 85/134 (63%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLDT+GK + SGV YY++PV   +GGGL LASTG E CP  VVQ   +V+ G 
Sbjct  24   AESSPDPVLDTEGKQLWSGVDYYILPVIRGRGGGLTLASTGNENCPLDVVQEQHEVSNGL  83

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             ++F PV P KG +R  TD N+ FS S T C +ST+W++ +D  +    ++V +GG +GN
Sbjct  84   PLTFTPVNPKKGVIRVSTDHNIKFSAS-TICVQSTLWKLEYDESSGQ--RFVTTGGVEGN  140

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  141  PGHETLDNWFKIEK  154



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFP  302
            AVLDTDG+ +++G +YY++PV   +GGGL +ASTG E CP  VVQ   +++ G  ++F P
Sbjct  32   AVLDTDGEKLRAGTEYYILPVFRGRGGGLTMASTGDEACPLDVVQDPLEISKGLPLTFTP  91

Query  303  VKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTA  479
            V P KG +R  TDLN+ FS S   C +STVW+I     N ++  +V +GG +GNPG  T 
Sbjct  92   VNPKKGVIRVSTDLNIKFSASSI-CVQSTVWKI-QKSVNSEIQWFVTTGGVEGNPGIETI  149

Query  480  RSWFMILK  503
             +WF I K
Sbjct  150  TNWFKIEK  157



>gb|AEK26933.1| Kunitz-type trypsin inhibitor B2 [Populus nigra]
Length=215

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFP  302
            AVLDTDG+ +++G +YY++PV   +GGGL +AST  ETCP  VVQ   +++ G  ++F P
Sbjct  32   AVLDTDGEKLRAGTEYYILPVFRGRGGGLTMASTRDETCPLDVVQDPLEISKGLPLTFTP  91

Query  303  VKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTA  479
            V P KG +R  TDLN+ FS S   C +STVW+I     N ++  +V +GG +GNPG  T 
Sbjct  92   VNPKKGVIRVSTDLNIKFSASSI-CVQSTVWKI-QKSVNSEIQWFVTTGGVEGNPGIETI  149

Query  480  RSWFMILK  503
             +WF I K
Sbjct  150  TNWFKIEK  157



>ref|XP_011072079.1| PREDICTED: miraculin [Sesamum indicum]
Length=206

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 85/135 (63%), Gaps = 10/135 (7%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA++P  VLDTD   V++GV YY++PV   +GGGL LASTG ETCP  VVQ   +V  G 
Sbjct  25   AAEEPAPVLDTDRNLVRAGVDYYILPVIRGRGGGLTLASTGNETCPLDVVQEQLEVRNGL  84

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQ---YVLSGGD  452
             ++F PV P KG VR  TD N+ FSG+ T C +STVW++    +N D      ++ +GG 
Sbjct  85   PLTFRPVNPKKGVVRVSTDQNIKFSGA-TICVQSTVWKL----DNYDASTGKYFITTGGV  139

Query  453  KGNPGSSTARSWFMI  497
            +G PG  T  +WF I
Sbjct  140  EGKPGRETISNWFKI  154



>gb|ACS92509.1| Kunitz-type protease inhibitor KPI-D2.3 [Populus trichocarpa]
 gb|ACS92510.1| Kunitz-type protease inhibitor KPI-D2 [Populus trichocarpa x 
Populus deltoides]
Length=215

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFP  302
            AVLDTDG+ +++G +YY++PV   +GGGL +AST  ETCP  VVQ   +++ G  ++F P
Sbjct  32   AVLDTDGEKLRAGTEYYILPVFRGRGGGLTMASTRDETCPLDVVQDPLEISKGLPLTFTP  91

Query  303  VKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTA  479
            V P KG +R  TDLN+ FS S   C +STVW+I     N ++  +V +GG +GNPG  T 
Sbjct  92   VNPKKGVIRVSTDLNIKFSASSI-CVQSTVWKI-QKSVNSEIQWFVTTGGVEGNPGIETI  149

Query  480  RSWFMILK  503
             +WF I K
Sbjct  150  TNWFKIEK  157



>ref|XP_002305032.2| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92483.1| Kunitz-type protease inhibitor KPI-D2.2 [Populus trichocarpa]
 gb|ADW95386.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|EEE85543.2| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=215

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFP  302
            AVLDTDG+ +++G +YY++PV   +GGGL +AST  ETCP  VVQ   +++ G  ++F P
Sbjct  32   AVLDTDGEKLRAGTEYYILPVFRGRGGGLTMASTRDETCPLDVVQDPLEISKGLPLTFTP  91

Query  303  VKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTA  479
            V P KG +R  TDLN+ FS S   C +STVW+I     N ++  +V +GG +GNPG  T 
Sbjct  92   VNPKKGVIRVSTDLNIKFSASSI-CVQSTVWKI-QKSVNSEIQWFVTTGGVEGNPGIETI  149

Query  480  RSWFMILK  503
             +WF I K
Sbjct  150  TNWFKIEK  157



>ref|XP_009627067.1| PREDICTED: miraculin [Nicotiana tomentosiformis]
Length=205

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 86/135 (64%), Gaps = 5/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCP-KSVVQVAPKVA-G  281
            AA+ PPAV+D  GK +++GV YY++PV   +GGGL L STG E+CP  +VVQ   ++  G
Sbjct  24   AAEAPPAVIDIAGKKLRTGVDYYILPVVRGRGGGLTLDSTGNESCPLDAVVQEHHEIKNG  83

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              ++F PV P KG +R  TDLN+ FS +   C ++T+W++  D +      ++  GG++G
Sbjct  84   LPLTFTPVNPKKGVIRESTDLNIKFSAASI-CVQTTLWKL-DDFDEATGKYFITIGGNEG  141

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  142  NPGRETISNWFKIDK  156



>gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana]
Length=205

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 86/135 (64%), Gaps = 5/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCP-KSVVQVAPKV-AG  281
            AA+ PPAV+D  GK +++G+ YY++PV   +GGGL L STG E+CP  +VVQ   ++  G
Sbjct  24   AAEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGGLTLDSTGNESCPLDAVVQEQKEINNG  83

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              ++F PV P KG +R  TDLN+ FS +   C ++T+W++  D +      ++  GG++G
Sbjct  84   FPLTFTPVNPKKGVIRESTDLNIKFSAASI-CVQTTLWKL-DDFDETTGKYFITIGGNEG  141

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  142  NPGRETISNWFKIEK  156



>ref|XP_009792285.1| PREDICTED: miraculin [Nicotiana sylvestris]
Length=210

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 86/135 (64%), Gaps = 5/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCP-KSVVQVAPKVA-G  281
            AA+ PPAV+D  GK +++G+ YY++PV   +GGGL L STG E+CP  +VVQ   ++  G
Sbjct  24   AAEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGGLTLDSTGNESCPLDAVVQEQQEIKNG  83

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              ++F PV P KG +R  TDLN+ FS +   C ++T+W++  D +      ++  GG++G
Sbjct  84   LPLTFTPVNPKKGVIRESTDLNIKFSAASI-CVQTTLWKL-DDFDETTGKYFITIGGNEG  141

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  142  NPGRETISNWFKIEK  156



>ref|XP_010663911.1| PREDICTED: miraculin-like [Vitis vinifera]
Length=209

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 85/135 (63%), Gaps = 6/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPV-QPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            A   P  VLD +GK ++S V  Y++PV + + GGGL LASTGKETCP  VVQ   +V+ G
Sbjct  29   AEAAPDPVLDIEGKKLRSEVDCYILPVIRRRGGGGLTLASTGKETCPLDVVQEQHEVSNG  88

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              + F PV P KG +R  TD N+ FS + T C +STVW++ +D  +    Q+V +GG +G
Sbjct  89   LPLMFIPVNPKKGVIRVSTDHNIEFSAA-TICIQSTVWKLEYDESSGQ--QFVTTGGVEG  145

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  146  NPGRGTLSNWFKIEK  160



>gb|AAC49969.1| tumor-related protein [Nicotiana tabacum]
Length=210

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 86/135 (64%), Gaps = 5/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCP-KSVVQVAPKVA-G  281
            +A+ PPAV+D  GK +++G+ YY++PV   +GGGL L STG E+CP  +VVQ   ++  G
Sbjct  24   SAEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGGLTLDSTGNESCPLDAVVQEQQEIKNG  83

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              ++F PV P KG +R  TDLN+ FS +   C ++T+W++  D +      ++  GG++G
Sbjct  84   LPLTFTPVNPKKGVIRESTDLNIKFSAASI-CVQTTLWKL-DDFDETTGKYFITIGGNEG  141

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  142  NPGRETISNWFKIEK  156



>ref|XP_004234331.1| PREDICTED: miraculin [Solanum lycopersicum]
 gb|AAC63057.1| Lemir [Solanum lycopersicum]
Length=205

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 85/136 (63%), Gaps = 7/136 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCP-KSVVQVAPKV-AG  281
            AA+ PP V+D DGK +++GV YY++PV   +GGGL + S G + CP  +VVQ   ++  G
Sbjct  24   AAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGDKMCPLDAVVQEHNEIDQG  83

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLS-GGDK  455
              ++F PV P KG +R  TDLN++FS +   C ++T W++    E     QY ++ GGD+
Sbjct  84   LPLTFTPVDPKKGVIRESTDLNIIFSANSI-CVQTTQWKLDDFDETTG--QYFITLGGDQ  140

Query  456  GNPGSSTARSWFMILK  503
            GNPG  T  +WF I K
Sbjct  141  GNPGVETISNWFKIEK  156



>gb|AAQ96377.1| miraculin-like protein [Solanum palustre]
Length=209

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 85/136 (63%), Gaps = 7/136 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCP-KSVVQVAPKV-AG  281
            AA+ PP V+D DGK +++GV YY++PV   +GGGL + S G + CP  +VVQ   ++  G
Sbjct  28   AAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGDKICPLDAVVQEHQEIDQG  87

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLS-GGDK  455
              ++F PV P KG +R  TDLN++FS +   C ++T W++    E     QY ++ GG++
Sbjct  88   LPLTFTPVNPKKGVIRESTDLNIIFSANSI-CVQTTQWKLDDFDETTG--QYFITLGGNQ  144

Query  456  GNPGSSTARSWFMILK  503
            GNPG  T  +WF I K
Sbjct  145  GNPGRETISNWFKIEK  160



>ref|XP_006351548.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=208

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 80/139 (58%), Gaps = 11/139 (8%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGD  284
            EA   P +VLDT GK ++    Y VVPV+   GG L LA  G + CP   + + P++  D
Sbjct  25   EATSAPNSVLDTTGKMIRVESDYMVVPVRKDLGGDLGLAFIGTQVCP---LGIGPRLNND  81

Query  285  ---SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQ-ESTVWQIAH-DPENVDVVQYVLSG  446
               S++FFPV   KG +R   DLNV F+ + T CQ  S VW++ H +P+  D    + +G
Sbjct  82   SGLSINFFPVNSKKGVIRESIDLNVEFTETYTICQHHSNVWRLDHYNPQKED--HMITNG  139

Query  447  GDKGNPGSSTARSWFMILK  503
            G KGNPG  T  +WF I+K
Sbjct  140  GVKGNPGRDTISNWFKIVK  158



>ref|XP_006351546.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=205

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 83/136 (61%), Gaps = 7/136 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCP-KSVVQVAPKV-AG  281
            AA+ PP V+D DGK +++GV YY++PV   +GGGL + S G + CP  +VVQ   ++  G
Sbjct  24   AAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGDKICPLDAVVQEHHEIDQG  83

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLS-GGDK  455
              ++F PV P KG +R  TDLN++FS +   C ++T W++    E     QY ++ GG +
Sbjct  84   LPLTFTPVNPKKGVIRESTDLNIIFSANSI-CVQTTQWKLDDFDETTG--QYFITLGGTQ  140

Query  456  GNPGSSTARSWFMILK  503
            GNPG  T  +W  I K
Sbjct  141  GNPGRETVSNWIKIEK  156



>gb|KJB75158.1| hypothetical protein B456_012G027700 [Gossypium raimondii]
Length=198

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 7/128 (5%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFPV  305
            VLD  G+ +++G+ YY++PV   +GGGL LASTG ETCP  VVQ   +V+ G  ++F PV
Sbjct  26   VLDISGQELRTGIDYYILPVIRGRGGGLTLASTGNETCPLDVVQEQQEVSNGLPLTFSPV  85

Query  306  K-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVL-SGGDKGNPGSSTA  479
               +G VR  TDLN+ FS +   C ++T+W +  D     V +YV+ +GG +GNPG  T 
Sbjct  86   NVTQGVVRVSTDLNIKFSAASI-CVQTTLWTLRFDES---VQKYVVTTGGVEGNPGRETL  141

Query  480  RSWFMILK  503
             +WF I K
Sbjct  142  SNWFKIQK  149



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 82/134 (61%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLD +GK ++SGV YY++PV   +GGGL +AS   +TCP  VVQ   +V+ G 
Sbjct  25   AEAAPDPVLDIEGKQLRSGVDYYILPVIRGRGGGLTVASVRNKTCPLDVVQDKLEVSHGL  84

Query  285  SVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             ++F PV PK   +R  TD N+ FS + T C +STVW++ +D       +++ +GG +GN
Sbjct  85   PLTFTPVNPKQDVIRVSTDHNIKFSAA-TICAQSTVWKLEYDESTGQ--RFITTGGVEGN  141

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  142  PGRGTLSNWFKIEK  155



>gb|KJB75157.1| hypothetical protein B456_012G027600 [Gossypium raimondii]
Length=198

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 82/131 (63%), Gaps = 6/131 (5%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSF  296
            P  VLD  GK +++G  YY++PV   +GGGL LASTG ETCP  VVQ   +V+ G  V+F
Sbjct  21   PDPVLDISGKMLRTGNDYYILPVFRGRGGGLTLASTGNETCPLHVVQEQLEVSNGLPVTF  80

Query  297  FPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVL-SGGDKGNPGS  470
             P    KG +R  TD N+ FS + T C +STVW++A+  ++    Q+ L SGG +GNPG 
Sbjct  81   SPFNIKKGVIRVSTDHNIKFSAA-TICVQSTVWKLANFDDSTR--QWFLTSGGVEGNPGR  137

Query  471  STARSWFMILK  503
             T  +WF I K
Sbjct  138  QTIDNWFKIEK  148



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 79/125 (63%), Gaps = 5/125 (4%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFPV  305
            VLD  G+ +++G  YY++PV    GGGL LASTG ETCP  VVQ   +V+ G  ++F PV
Sbjct  26   VLDISGEELRTGTDYYILPVIRGGGGGLTLASTGNETCPLDVVQEQLEVSNGLPLTFSPV  85

Query  306  K-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTAR  482
               KG VR  TDLN+ FS + T C +STVW++ +D     +V  V +GG +GNPG  T  
Sbjct  86   NITKGVVRVSTDLNIKFSAA-TICVQSTVWKLDNDEATQKMV--VTTGGVEGNPGIETLS  142

Query  483  SWFMI  497
            +WF I
Sbjct  143  NWFKI  147



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 11/134 (8%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVS  293
            P  VLD  GK +++G KYY++PV   +GGGL LA  +  +TCP  VVQ       G  V+
Sbjct  72   PDPVLDIAGKQLRTGSKYYILPVTKGRGGGLTLAGRSNNKTCPLDVVQEQHSFKNGLPVT  131

Query  294  FFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV--QYVL-SGGDKGN  461
            F PV P KG VR  TDLN+ F  + T C +STVW++    +N D V  Q++L +GG +GN
Sbjct  132  FSPVNPKKGVVRESTDLNIKFDAA-TSCAQSTVWKL----DNFDAVLGQWLLTTGGVEGN  186

Query  462  PGSSTARSWFMILK  503
            PG  T R+WF I K
Sbjct  187  PGPRTMRNWFKIEK  200



>gb|KHN24496.1| Miraculin [Glycine soja]
Length=204

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 82/134 (61%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA  P AVLDT G+ +++GVKYY++PV   +GGGL ++S+G  TCP  VVQ   +V+ G 
Sbjct  25   AAAAPEAVLDTSGQKLRTGVKYYILPVFRGKGGGLTVSSSGNNTCPLFVVQEKLEVSKGT  84

Query  285  SVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             V+F P   K G +   TDLN+   G  T C +  VW++    + +  V ++ +GG +GN
Sbjct  85   PVTFTPYNAKSGVILTSTDLNIKSYGKTTTCDKPPVWKLL---KVLTGVWFLSTGGVEGN  141

Query  462  PGSSTARSWFMILK  503
            PG +T  +WF I K
Sbjct  142  PGVNTVVNWFKIEK  155



>ref|NP_001237597.1| uncharacterized protein LOC100527288 precursor [Glycine max]
 gb|ACU16359.1| unknown [Glycine max]
Length=204

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 82/134 (61%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA  P AVLDT G+ +++GVKYY++PV   +GGGL ++S+G  TCP  VVQ   +V+ G 
Sbjct  25   AAAAPEAVLDTSGQKLRTGVKYYILPVFRGKGGGLTVSSSGNNTCPLFVVQEKLEVSKGT  84

Query  285  SVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             V+F P   K G +   TDLN+   G  T C +  VW++    + +  V ++ +GG +GN
Sbjct  85   PVTFTPYNAKSGVILTSTDLNIKSYGKTTTCDKPPVWKLL---KVLTGVWFLSTGGVEGN  141

Query  462  PGSSTARSWFMILK  503
            PG +T  +WF I K
Sbjct  142  PGVNTVVNWFKIEK  155



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 79/134 (59%), Gaps = 11/134 (8%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVS  293
            P  VLD  GK +++G KYY++PV   QGGGL LA  +  +TCP  VVQ    +  G  V+
Sbjct  29   PDPVLDIAGKQLRAGSKYYILPVTKGQGGGLTLAGRSNNKTCPLDVVQEQHSLRNGFPVT  88

Query  294  FFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV---QYVLSGGDKGN  461
            F PV P KG VR  TDLN+ F  + T C +STVW++    +N D       V +GG +GN
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAA-TSCAQSTVWKL----DNFDAALGQWLVTTGGVEGN  143

Query  462  PGSSTARSWFMILK  503
            PG  T R+WF I K
Sbjct  144  PGPRTMRNWFKIEK  157



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 79/135 (59%), Gaps = 11/135 (8%)
 Frame = +3

Query  117  KPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTG-KETCPKSVVQVAPKVA-GDSV  290
            +P  VLD  GK +++G KYY++PV   +GGGL LA  G  +TCP  VVQ       G  V
Sbjct  28   QPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRGNNKTCPLDVVQEQHSFKNGLPV  87

Query  291  SFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV---QYVLSGGDKG  458
            +F PV P KG VR  TDLN+ F  + T C +STVW++    +N D       V +GG +G
Sbjct  88   TFSPVNPKKGVVRESTDLNIKFDAA-TSCAQSTVWKL----DNFDAAFGQWLVTTGGVEG  142

Query  459  NPGSSTARSWFMILK  503
            NPG  T R+WF I K
Sbjct  143  NPGPRTMRNWFKIEK  157



>ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera]
Length=162

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (65%), Gaps = 5/116 (4%)
 Frame = +3

Query  162  GVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFPVKP-KGAVRNGT  335
            GV YY++PV   +GGGL LASTG ETCP  VVQ   +V+ G  ++F PV P KG +R  T
Sbjct  1    GVDYYILPVFRGRGGGLTLASTGNETCPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVST  60

Query  336  DLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTARSWFMILK  503
            D N+ FS S T C +ST+W++ +D  +    ++V +GG +GNPG  T  +WF I K
Sbjct  61   DHNIKFSAS-TICVQSTLWKLEYDESSGQ--RFVTTGGVEGNPGRETLDNWFKIEK  113



>gb|AFL91231.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 76/131 (58%), Gaps = 9/131 (7%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSF  296
            P AV D DG  V+SG +YY++PV   +GGG+ LA T  E+CP  VVQ   ++  G  ++F
Sbjct  1    PDAVRDIDGNLVRSGTEYYILPVFRGRGGGVTLAPTRNESCPLDVVQEGFELDDGLPLTF  60

Query  297  FPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG-GDKGNPGS  470
             PV P KG +R  TDLN++FS S   C +S VW +          Q ++SG G  GNPG 
Sbjct  61   TPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWMLEEYEG-----QRIISGRGTAGNPGG  114

Query  471  STARSWFMILK  503
             T  +WF I K
Sbjct  115  ETISNWFKIEK  125



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 82/135 (61%), Gaps = 11/135 (8%)
 Frame = +3

Query  117  KPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSV  290
            +P  VLD  GK +++G KYY++PV   +GGGL LA  +  +TCP  VVQ       G  V
Sbjct  28   QPDPVLDISGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKTCPVDVVQEQHSFRNGLPV  87

Query  291  SFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV--QYVL-SGGDKG  458
            +F PV P KG VR  TDLN+ F  + T C +STVW++    +N D    Q+V+ +GG +G
Sbjct  88   TFSPVNPKKGVVRESTDLNIKFDAA-TSCAQSTVWKL----DNFDAAFGQWVVTTGGVEG  142

Query  459  NPGSSTARSWFMILK  503
            NPG  T R+WF I K
Sbjct  143  NPGPRTMRNWFKIEK  157



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 79/135 (59%), Gaps = 5/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKET-CPKSVVQVAPKVA-G  281
            A   P  VLD  G  +Q+GV YY++PV   +GGGL LAST  +T CP  VVQ   +V+ G
Sbjct  27   ADAAPSPVLDITGNKLQTGVDYYILPVIRGRGGGLTLASTSNKTSCPLDVVQEQNEVSNG  86

Query  282  DSVSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              + F PV   KG VR  TDLN+ FS + T C +STVW++    E      +V SGG +G
Sbjct  87   LPLKFSPVNVTKGVVRVSTDLNIKFSAT-TICVQSTVWKLGKFDEQTG-QWFVTSGGVEG  144

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  145  NPGRQTTSNWFKIEK  159



>ref|XP_003534083.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 81/147 (55%), Gaps = 21/147 (14%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQ----------GGGLDLASTGKETCPKSVV  257
            A   P  V+DT GK +++G+ YY+VP  P            GGGL LAS G E+CP  VV
Sbjct  23   ADASPEQVVDTSGKKLRAGLSYYIVPAVPLTRCGRYERCMGGGGLSLASIG-ESCPLDVV  81

Query  258  QVAPKVAGDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQE-STVWQIAHDPENVDVVQ  431
             V P+  G  + F PV P KG VR  TDLN++FS   T C E S VW++ H     DV +
Sbjct  82   -VVPRSHGLPLQFSPVDPKKGVVRVSTDLNIMFSTDHTSCAEYSPVWKLDH----FDVSK  136

Query  432  ---YVLSGGDKGNPGSSTARSWFMILK  503
               +V +GG  GNP   T R+WF I K
Sbjct  137  GKWFVSTGGSMGNPSWETIRNWFKIEK  163



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 79/135 (59%), Gaps = 11/135 (8%)
 Frame = +3

Query  117  KPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSV  290
            +P  VLD  GK +++G KYY++PV   +GGGL LA  +  +TCP  VVQ       G  V
Sbjct  28   QPDPVLDISGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKTCPVDVVQEQHSFKNGFPV  87

Query  291  SFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV---QYVLSGGDKG  458
            +F PV P KG VR  TDLN+ F  + T C +STVW++    +N D       V +GG +G
Sbjct  88   TFSPVNPKKGVVRESTDLNIKFDAA-TSCAQSTVWKL----DNFDAAFGQWLVTTGGVEG  142

Query  459  NPGSSTARSWFMILK  503
            NPG  T R+WF I K
Sbjct  143  NPGPRTMRNWFKIEK  157



>ref|XP_007152537.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
 gb|ESW24531.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
Length=205

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 80/134 (60%), Gaps = 5/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  V+DT G+ +++GVKYY++PV   +GGGL ++S+G  TCP  VVQ  P+V  G 
Sbjct  24   AVAAPEPVVDTSGQKLRTGVKYYILPVFRGRGGGLTVSSSGNNTCPLFVVQEKPEVLNGT  83

Query  285  SVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             V+F P   K G +   TDLN+   G+ T C +  VW++    + +  V ++ +GG +GN
Sbjct  84   PVTFTPYNAKSGVILTSTDLNIKSYGTTTSCDKPPVWKLL---KVLTGVWFLSTGGVEGN  140

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  141  PGIDTIVNWFKIEK  154



>gb|AFL91226.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 76/131 (58%), Gaps = 9/131 (7%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSF  296
            P AV D DG  ++SG +YY++PV   +GGG+ LA T  E+CP  VVQ   ++  G  ++F
Sbjct  1    PDAVRDIDGNLLRSGTEYYILPVFRGRGGGVTLAPTRNESCPLDVVQEGFELDNGLPLTF  60

Query  297  FPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG-GDKGNPGS  470
             PV P KG +R  TDLN++FS S   C +S VW +          Q ++SG G  GNPG 
Sbjct  61   TPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWMLEEYEG-----QRIISGRGTSGNPGG  114

Query  471  STARSWFMILK  503
             T  +WF I K
Sbjct  115  ETISNWFKIEK  125



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 79/135 (59%), Gaps = 5/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKET-CPKSVVQVAPKVA-G  281
            A   P  VLD  G  +Q+GV YY++PV   +GGGL LAST  +T CP  VVQ   +V+ G
Sbjct  27   ADAAPSPVLDITGNKLQTGVNYYILPVIRGRGGGLTLASTSNKTSCPLDVVQEQNEVSNG  86

Query  282  DSVSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
             S+ F PV   KG V   TDLN+ FS + T C +STVW++    E      +V SGG +G
Sbjct  87   LSLKFSPVNVTKGVVLVSTDLNIKFSAT-TICVQSTVWKLGKFDEQTG-QWFVTSGGVEG  144

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  145  NPGRQTTSNWFKIEK  159



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 77/134 (57%), Gaps = 11/134 (8%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVS  293
            P  VLD  GK +++G KYY++PV   QGGGL LA  +  +TCP  VVQ       G  V+
Sbjct  29   PDPVLDVAGKKLRAGSKYYILPVTKGQGGGLTLAGRSNNKTCPLDVVQEQHSFRNGLPVT  88

Query  294  FFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV---QYVLSGGDKGN  461
            F PV P KG VR  TD N+ F  + T C +STVW++    +N D       V +GG +GN
Sbjct  89   FSPVNPKKGVVRESTDFNIKFDAA-TSCAQSTVWKL----DNFDAALGQWLVTTGGVEGN  143

Query  462  PGSSTARSWFMILK  503
            PG  T R+WF I K
Sbjct  144  PGPRTMRNWFKIEK  157



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 78/134 (58%), Gaps = 11/134 (8%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVS  293
            P  VLD  GK +++G KYY++PV   +GGGL LA  +  +TCP  VVQ       G  V+
Sbjct  29   PDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKTCPLDVVQEQHSFRNGLPVT  88

Query  294  FFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV---QYVLSGGDKGN  461
            F PV P KG VR  TDLN+ F  + T C +STVW++    +N D       V +GG +GN
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAA-TSCAQSTVWKL----DNFDTAFGQWLVTTGGVEGN  143

Query  462  PGSSTARSWFMILK  503
            PG  T R+WF I K
Sbjct  144  PGPRTMRNWFKIEK  157



>ref|XP_006495061.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 78/134 (58%), Gaps = 11/134 (8%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVS  293
            P  VLD  GK +++G KYY++PV   +GGGL LA  +  +TCP  VVQ       G  V+
Sbjct  29   PDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKTCPLDVVQEQHSFRNGLPVT  88

Query  294  FFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV---QYVLSGGDKGN  461
            F PV P KG VR  TDLN+ F  + T C +STVW++    +N D       V +GG +GN
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAA-TSCAQSTVWKL----DNFDAAFGQWLVTTGGVEGN  143

Query  462  PGSSTARSWFMILK  503
            PG  T R+WF I K
Sbjct  144  PGPRTMRNWFKIEK  157



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  117  KPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSV  290
            +P  VLD  GK +++G KYY++PV   +GGGL LA     +TCP  VVQ       G  V
Sbjct  28   QPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRRNNKTCPLDVVQEQHSFKNGLPV  87

Query  291  SFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV---QYVLSGGDKG  458
            +F PV P KG VR  TDLN+ F  + T C +STVW++    +N D       V +GG +G
Sbjct  88   TFSPVNPKKGVVRESTDLNIKFDAA-TSCAQSTVWKL----DNFDAAFGQWLVTTGGVEG  142

Query  459  NPGSSTARSWFMILK  503
            NPG  T R+WF I K
Sbjct  143  NPGPRTMRNWFKIEK  157



>gb|ACS92516.1| Kunitz-type protease inhibitor KPI-D12 [Populus trichocarpa x 
Populus deltoides]
Length=206

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 76/134 (57%), Gaps = 4/134 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLD  GK +++G  YY++PV   +GGGL +ASTG+ TCP  VVQ   + + G 
Sbjct  25   ATAAPEPVLDVTGKILRTGTGYYILPVIRGRGGGLKMASTGRRTCPLDVVQDRYEASNGL  84

Query  285  SVSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             + F PV   KG VR  TDLN+ FS +   C +ST W++    E      +V + G +GN
Sbjct  85   PLKFTPVNTKKGVVRVHTDLNIRFSAASI-CHQSTAWKLGSYDEWTK-QWFVTTNGVEGN  142

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  143  PGPETTNNWFKIEK  156



>ref|XP_007029360.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
 gb|EOY09862.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
Length=195

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 80/134 (60%), Gaps = 4/134 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLD  GK +++G  YY++PV   +GGGL LASTG E+CP  VVQ   +V+ G 
Sbjct  15   ANAAPDPVLDISGKKLRTGTDYYILPVFRGRGGGLTLASTGNESCPLDVVQEQLEVSDGL  74

Query  285  SVSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             V+F PV   KG VR  TD N+ FS + T C + T+W++    ++     +V +GG +GN
Sbjct  75   PVTFSPVNIKKGVVRVSTDQNIKFSAA-TICVQPTLWKLDSFDDSTR-QWFVTTGGVEGN  132

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  133  PGRETIDNWFKIEK  146



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 78/134 (58%), Gaps = 11/134 (8%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVS  293
            P  VLD  GK +++G KYY++PV   +GGGL LA  +  +TCP  VVQ       G  V+
Sbjct  29   PDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKTCPVDVVQEQHSFRNGLPVT  88

Query  294  FFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV---QYVLSGGDKGN  461
            F PV P KG VR  TDLN+ F  + T C +STVW++    +N D       V +GG +GN
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAA-TSCAQSTVWKL----DNFDAALGQWLVTTGGVEGN  143

Query  462  PGSSTARSWFMILK  503
            PG  T R+WF I K
Sbjct  144  PGPRTMRNWFKIEK  157



>gb|AFL91227.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 75/131 (57%), Gaps = 9/131 (7%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSF  296
            P AV D DG  V SG +YY++PV   +GGG+ LA T  E+CP  VVQ   ++  G  ++F
Sbjct  1    PDAVRDXDGNLVXSGTEYYILPVFRGRGGGVTLAPTRNESCPLDVVQEGFELDDGLPLTF  60

Query  297  FPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG-GDKGNPGS  470
             PV P KG +R  TDLN++FS S   C +S VW +          Q ++SG G  GNPG 
Sbjct  61   TPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWMLEEYEG-----QRIISGRGTAGNPGG  114

Query  471  STARSWFMILK  503
             T  +WF I K
Sbjct  115  ETISNWFKIEK  125



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 81/134 (60%), Gaps = 11/134 (8%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVS  293
            P  VLD  GK +++G KYY++PV   +GGGL LA  +  +TC   VVQ       G  V+
Sbjct  29   PDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKTCLLDVVQEQHSFRNGLPVT  88

Query  294  FFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV--QYVL-SGGDKGN  461
            F PV P KG VR  TDLN+ F  + T C +STVW++    +N D V  Q++L +GG +GN
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAA-TSCAQSTVWKL----DNFDAVLGQWLLTTGGVEGN  143

Query  462  PGSSTARSWFMILK  503
            PG  T R+WF I K
Sbjct  144  PGPRTMRNWFKIEK  157



>gb|AFK39812.1| unknown [Lotus japonicus]
 gb|AFK45182.1| unknown [Lotus japonicus]
Length=208

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 8/137 (6%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTG---KETCPKSVVQVAPKVA  278
            +A  P  VLD  G+ +++GVKYY++PV   +GGGL L S+G     TCP  VVQ   +V 
Sbjct  25   SAAAPEPVLDISGQKLRTGVKYYILPVLRGKGGGLTLTSSGNINNNTCPLHVVQEKLEVL  84

Query  279  -GDSVSFFPVKPKGAV-RNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGD  452
             G SV+F P   KG V    TDLN+  S + T C ++ VW++  +   +  V ++ +GG 
Sbjct  85   KGQSVTFTPYNAKGGVILTSTDLNIKSSLTNTTCAKAPVWKLLKE---LSGVWFLATGGV  141

Query  453  KGNPGSSTARSWFMILK  503
            +GNPG +T  +WF I K
Sbjct  142  EGNPGMATISNWFKIEK  158



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 78/134 (58%), Gaps = 11/134 (8%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVS  293
            P  VLD  GK +++G KYY++PV   +GGGL LA  +  +TCP  VVQ       G  V+
Sbjct  29   PDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKTCPLDVVQEQHSFRNGLPVT  88

Query  294  FFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV---QYVLSGGDKGN  461
            F PV P KG VR  TD+N+ F  + T C +STVW++    +N D       V +GG +GN
Sbjct  89   FSPVNPKKGVVRESTDINIKFDAA-TSCAQSTVWKL----DNFDAALGQWLVTTGGVEGN  143

Query  462  PGSSTARSWFMILK  503
            PG  T R+WF I K
Sbjct  144  PGPRTMRNWFKIEK  157



>gb|AFL91233.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 74/131 (56%), Gaps = 9/131 (7%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSF  296
            P AV D DG  V SG +YY++PV    GGG+ LA T  E+CP  VVQ   ++  G  ++F
Sbjct  1    PDAVRDIDGNLVXSGTEYYILPVFRGXGGGVTLAPTRNESCPLDVVQEGFELDDGLPLTF  60

Query  297  FPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG-GDKGNPGS  470
             PV P KG +R  TDLN++FS S   C +S VW +          Q ++SG G  GNPG 
Sbjct  61   TPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWMLEEYEG-----QRIISGRGTAGNPGG  114

Query  471  STARSWFMILK  503
             T  +WF I K
Sbjct  115  ETISNWFKIEK  125



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 79/134 (59%), Gaps = 11/134 (8%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVS  293
            P  V+D  GK +++G KYY++PV   +GGGL LA  +  +TCP  VVQ       G  V+
Sbjct  29   PDPVVDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKTCPLDVVQEQHSFRNGLPVT  88

Query  294  FFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV---QYVLSGGDKGN  461
            F PV P KG VR  TDLN+ F  + T C +STVW++    +N D V     V +GG +GN
Sbjct  89   FSPVNPKKGVVRESTDLNIKFDAA-TSCAQSTVWKL----DNFDAVLGQWLVTTGGVEGN  143

Query  462  PGSSTARSWFMILK  503
            PG  T R+WF I K
Sbjct  144  PGPRTMRNWFKIEK  157


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 67/126 (53%), Gaps = 14/126 (11%)
 Frame = +3

Query  147  KAVQSGVKYYVVPVQPKQGGGLDLASTGK-ETCPKSVVQVAPKVA-GDSVSFFPVKPK-G  317
            K ++ G K+Y++     +GGGL L S G  +T    VVQ    +  G  ++F PV PK G
Sbjct  204  KKLRVGSKHYILAAICGRGGGLTLGSRGNNKTVLLHVVQEQNILKYGSPMTFSPVNPKNG  263

Query  318  AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQY----VLSGGDKGNPGSSTARS  485
             +R   DLN+ F    T  Q STVW++       +++QY       GG +GNPG  T R+
Sbjct  264  VIRESIDLNIKFEVVKTSVQ-STVWKLD------NLMQYWGRICAIGGVRGNPGPQTTRN  316

Query  486  WFMILK  503
            WFMI K
Sbjct  317  WFMIEK  322



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  117  KPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTG-KETCPKSVVQVAPKVA-GDSV  290
            +P  VLD  GK +++G KYY++PV   +GGGL LA  G  +TCP  VVQ       G  V
Sbjct  28   QPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRGNNKTCPLDVVQEQHSFKNGLPV  87

Query  291  SFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV---QYVLSGGDKG  458
            +F PV P KG VR  TD+N+    + T C +STVW++    +N D       V +GG +G
Sbjct  88   TFSPVNPKKGVVRESTDINIKLDAA-TSCAQSTVWKL----DNFDAAFGQWLVTTGGVEG  142

Query  459  NPGSSTARSWFMILK  503
            NPG  T R+WF I K
Sbjct  143  NPGPRTMRNWFKIEK  157



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 79/129 (61%), Gaps = 7/129 (5%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVSFFP  302
            VLD  GK +++G KYY++PV   +GGGL LA  +  +TCP  VVQ       G  V+F P
Sbjct  32   VLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSNNKTCPVDVVQEQHSFRNGLPVTFSP  91

Query  303  VKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQY-VLSGGDKGNPGSST  476
            V P KG VR  TD+N+ F  + T C +STVW++  D  +  + Q+ V +GG +GNPG  T
Sbjct  92   VNPKKGVVRESTDINIKFDAA-TSCAQSTVWKL--DNFDAAIGQWLVTTGGVEGNPGPRT  148

Query  477  ARSWFMILK  503
             R+WF I K
Sbjct  149  MRNWFKIEK  157



>ref|XP_004137639.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64219.1| hypothetical protein Csa_1G043220 [Cucumis sativus]
Length=205

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 79/138 (57%), Gaps = 7/138 (5%)
 Frame = +3

Query  102  CEAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLAST-GKETCPKSVV-QVAPKV  275
            C A   P AVLDTDGK +++G +YY++ V  +  GGL +    G E CP +++ +    +
Sbjct  22   CRADASPDAVLDTDGKKLRAGDQYYILSVYSRNSGGLSIGGIYGYEKCPINILPESYDYL  81

Query  276  AGDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLS-GG  449
             G   +F P+ P KG VR  TDLN+ F  + T C  STVW++    E +   QY ++ GG
Sbjct  82   HGLPATFSPINPKKGVVRVSTDLNIQFEAN-TRCGISTVWKVGKFDEYLK--QYFVTMGG  138

Query  450  DKGNPGSSTARSWFMILK  503
             KGNPG  T  +WF + K
Sbjct  139  MKGNPGRETIENWFKVEK  156



>ref|XP_007210537.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
 gb|EMJ11736.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
Length=202

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 79/135 (59%), Gaps = 5/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKET-CPKSVVQVAPKVA-G  281
            A   P  VLD  GK +++G  YY++PV   +GGGL LAST   T CP  VVQ   +V+ G
Sbjct  23   ADAAPSPVLDITGKKLRTGTDYYILPVIRGRGGGLTLASTSNTTSCPLDVVQEQHEVSNG  82

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              ++F PV P KG VR  TD N+ FS + T C +ST+W++    E      +V SGG +G
Sbjct  83   LPLTFSPVNPKKGVVRVSTDHNIKFSAA-TICVQSTMWKLDKFDEQTG-QWFVTSGGVEG  140

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  141  NPGRQTTSNWFKIEK  155



>ref|XP_010279465.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=205

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 73/135 (54%), Gaps = 3/135 (2%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            +A   PPAV DT G  + SGVKYY+ P  PK+GGG    +T    CP  VVQ   K++ G
Sbjct  23   KADASPPAVRDTAGHKLSSGVKYYIFPANPKKGGGFTFEATNNGKCPFGVVQDNNKLSKG  82

Query  282  DSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V FFPV PK   +R  TD N+ F+   +    S+VW++    + +   Q V + G  G
Sbjct  83   LPVRFFPVNPKMDTIRVSTDHNIKFAIPISHPPSSSVWKVGEYSKWIG-KQLVTTCGVLG  141

Query  459  NPGSSTARSWFMILK  503
            NPG  T  SWF I K
Sbjct  142  NPGRDTLSSWFKIEK  156



>emb|CBI35471.3| unnamed protein product [Vitis vinifera]
Length=2095

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 76/117 (65%), Gaps = 5/117 (4%)
 Frame = +3

Query  159   SGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFPVKP-KGAVRNG  332
             SGV YY++PV   +GGGL LASTG ETCP  VVQ   +V+ G  ++F PV P KG +R  
Sbjct  1933  SGVDYYILPVFRGRGGGLTLASTGNETCPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVS  1992

Query  333   TDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTARSWFMILK  503
             TD N+ FS S T C +ST+W++ +D  +    ++V +GG +GNPG  T  +WF I K
Sbjct  1993  TDHNIKFSAS-TICVQSTLWKLEYDESSGQ--RFVTTGGVEGNPGRETLDNWFKIEK  2046



>ref|XP_008437082.1| PREDICTED: miraculin [Cucumis melo]
Length=207

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 79/138 (57%), Gaps = 7/138 (5%)
 Frame = +3

Query  102  CEAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLAST-GKETCPKSVV-QVAPKV  275
            C A   P AVLDTDGK +++G +YY++ V  +  GGL +    G E CP +++ +    +
Sbjct  22   CRADASPDAVLDTDGKKLRAGDQYYILSVYSRNSGGLSIGGIYGYEKCPINILPESYDYL  81

Query  276  AGDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLS-GG  449
             G   +F PV P KG VR  TDLN+ F  S T C  STVW++    + +   QY ++ GG
Sbjct  82   DGLPATFSPVNPKKGVVRVSTDLNIEFEAS-TRCGISTVWKVGKFDQYLK--QYFVTMGG  138

Query  450  DKGNPGSSTARSWFMILK  503
             KGNPG  T  +WF + K
Sbjct  139  TKGNPGRETIGNWFKVEK  156



>ref|XP_006372633.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
 gb|ERP50430.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
Length=206

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 4/134 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLD  GK +++G  YY++PV   +GGGL +AST + TCP  VVQ   + + G 
Sbjct  25   ATAAPEPVLDVTGKILRTGTSYYILPVIRGRGGGLKMASTVRRTCPLDVVQDRYEASNGL  84

Query  285  SVSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             + F PV   KG VR  TDLN+ FS +   C +ST W++ +  E      +V + G +GN
Sbjct  85   PLKFTPVNTKKGVVRVHTDLNIRFSAASI-CHQSTAWKLDNYDEWTK-QWFVTTDGVEGN  142

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  143  PGPETTNNWFKIEK  156



>ref|XP_009401850.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=203

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 82/126 (65%), Gaps = 5/126 (4%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFP  302
            +V DTD ++++ G +YYV+P+    GGGL LA+   +TCP +V Q + +V+ G  ++F P
Sbjct  23   SVRDTDRRSLRPGHEYYVLPLIRGHGGGLSLAARSNDTCPLAVAQESSEVSDGLPLTFSP  82

Query  303  VKPKGA-VRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTA  479
            V PK   V+  TDLNV F+ + T C +STVW++  D E     +YV++GG KG+PG +T 
Sbjct  83   VNPKDKYVKMSTDLNVWFA-AETICVQSTVWRLG-DAEATG-RRYVVTGGLKGDPGLATV  139

Query  480  RSWFMI  497
             +WF I
Sbjct  140  SNWFKI  145



>emb|CDO98557.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 83/139 (60%), Gaps = 11/139 (8%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPK---QGGGLDLASTGKETCPKSVVQ-VAPKV  275
            +A +P  VLD DG  +++   YY++P + +   +GGGL L+S G +TCP  V Q ++ + 
Sbjct  24   SAAEPEPVLDIDGNVLRTNHYYYILPAKVRGRFRGGGLALSSIGNDTCPVGVFQELSEQR  83

Query  276  AGDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAH--DPENVDVVQYVLSG  446
             G  ++F PVKP+ G VR  TDLN+ F+   T C ES VW++ +  DP    V  +V  G
Sbjct  84   NGIPLTFSPVKPRHGVVRTSTDLNIQFAYPET-CGESPVWRVDNYLDPL---VDSFVSIG  139

Query  447  GDKGNPGSSTARSWFMILK  503
            G  GNPG +T  SWF I K
Sbjct  140  GVVGNPGPATLGSWFKIQK  158



>ref|XP_006372654.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
 gb|ERP50451.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
Length=206

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 75/134 (56%), Gaps = 4/134 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLD  GK +++G  YY++PV   +GGGL +AST + TCP  VVQ   + + G 
Sbjct  25   ATAAPEPVLDVTGKILRTGTSYYILPVIRGRGGGLKMASTVRRTCPLDVVQDRYEASNGL  84

Query  285  SVSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             + F PV   KG VR  TDLN+ FS     C +ST W++ +  E      +V + G +GN
Sbjct  85   PLKFTPVNTKKGVVRVHTDLNIRFSAGSI-CHQSTAWKLDNYDEWTK-QWFVTTDGVEGN  142

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  143  PGPETTNNWFKIEK  156



>gb|AFL91228.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 73/131 (56%), Gaps = 9/131 (7%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSF  296
            P AV D DG  V  G +YY++P    +GGG+ LA T  E+CP  VVQ   ++  G  ++F
Sbjct  1    PDAVRDIDGNLVXXGXEYYILPXFRGRGGGVTLAPTRNESCPLDVVQEGFELDDGLPLTF  60

Query  297  FPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG-GDKGNPGS  470
             PV P KG +R  TDLN++FS S   C +S VW +          Q ++SG G  GNPG 
Sbjct  61   TPVDPKKGVIRESTDLNIIFSASSI-CIQSNVWMLEEYEG-----QRIISGRGTAGNPGG  114

Query  471  STARSWFMILK  503
             T  +WF I K
Sbjct  115  ETISNWFKIEK  125



>ref|XP_006372632.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
 gb|ERP50429.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
Length=206

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 75/134 (56%), Gaps = 4/134 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLD  GK ++ G  YY++PV   +GGGL +AST + TCP  VVQ   + + G 
Sbjct  25   ATAAPEPVLDVTGKILRIGTSYYILPVIRGRGGGLKMASTVRRTCPLDVVQDRYEASNGL  84

Query  285  SVSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             + F PV   KG VR  TDLN+ FS +   C +ST W++ +  E      +V + G +GN
Sbjct  85   PLKFTPVNTKKGVVRVHTDLNIRFSAASI-CHQSTAWKLDNYDEWTK-QWFVTTDGVEGN  142

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  143  PGPETTNNWFKIEK  156



>emb|CDO98558.1| unnamed protein product [Coffea canephora]
 emb|CDO98559.1| unnamed protein product [Coffea canephora]
Length=212

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 76/139 (55%), Gaps = 8/139 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQ----PKQGGGLDLASTGKETCPKSVVQ-VAP  269
             AA+ P  VLD  GK +++ + YY++P        +GGGL L+  G +TCP  V Q  + 
Sbjct  25   SAAEAPEPVLDVAGKMLRTYLNYYILPANVFRGRYRGGGLTLSGIGNDTCPAGVFQETSQ  84

Query  270  KVAGDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG  446
            ++ G  ++FFPV P KG VR  TDLN+ F    T C ES VW + +     D   +V  G
Sbjct  85   QINGIPLTFFPVNPKKGVVRVSTDLNIKFDYPDT-CDESPVWSVDNYVYPSD-DSFVNIG  142

Query  447  GDKGNPGSSTARSWFMILK  503
            G  GNPG  T  SWF I K
Sbjct  143  GVVGNPGPETLSSWFKIQK  161



>ref|XP_003534079.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 77/133 (58%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            A   P  VLDT GK V++   YY+VP  P   GGLD+A+TG + CP  VV V     G  
Sbjct  23   AGPAPEQVLDTSGKIVRARSSYYIVPASPDL-GGLDMATTGAD-CPLDVV-VVDGYQGQP  79

Query  288  VSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
            + F PV   KG +R  TDLN+ F  + T C ++TVW++  D +     ++V +GGD GNP
Sbjct  80   LIFTPVNFNKGVIRVSTDLNIYFPVA-TSCPQTTVWKL-KDYDYSTSQRFVTTGGDFGNP  137

Query  465  GSSTARSWFMILK  503
            GS T  +WF I K
Sbjct  138  GSQTVANWFKIEK  150



>ref|XP_011046091.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 4/134 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VL+  GK +++G  YY++ V   +GGGL +AST + TCP  VVQ   + + G 
Sbjct  25   ATAAPEPVLNVTGKILRTGTGYYILLVIRGRGGGLKMASTVRRTCPLDVVQERYEASNGL  84

Query  285  SVSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             + F PV   KG VR  TDLN+ FS +   CQ+ST W++    E      +V + G +GN
Sbjct  85   PLKFTPVNTKKGVVRVHTDLNIRFSAASI-CQQSTAWKLDSYDEWTK-QWFVTTNGVEGN  142

Query  462  PGSSTARSWFMILK  503
            PGS T  +WF I K
Sbjct  143  PGSETTNNWFKIEK  156



>gb|KHM99741.1| Miraculin [Glycine soja]
Length=199

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 76/133 (57%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            A   P  VLDT GK V++   YY+VP  P   GGLD+ASTG + CP  VV V     G  
Sbjct  23   AGPAPEQVLDTSGKIVRARSSYYIVPASPDL-GGLDMASTGAD-CPLDVV-VVDGYQGQP  79

Query  288  VSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
            + F PV   KG +R  TDLN+ F  + T C ++TVW++  D +      +V +GGD GNP
Sbjct  80   LIFTPVNFNKGVIRVSTDLNIYFPVA-TSCPQTTVWKL-KDYDYSTSQWFVTTGGDFGNP  137

Query  465  GSSTARSWFMILK  503
            GS T  +WF I K
Sbjct  138  GSQTVANWFKIEK  150



>gb|KHM99743.1| Miraculin [Glycine soja]
Length=199

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 76/133 (57%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            A   P  VLDT GK V++   YY+VP  P   GGLD+ASTG + CP  VV V     G  
Sbjct  23   AGPAPEQVLDTSGKIVRARSSYYIVPASPDL-GGLDMASTGAD-CPLDVVAV-DGYQGQP  79

Query  288  VSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
            + F PV   KG +R  TDLN+ F  + T C ++TVW++  D +      +V +GGD GNP
Sbjct  80   LIFTPVNFNKGVIRVSTDLNIYFPVA-TSCPQTTVWKL-KDYDYSTSQWFVTTGGDFGNP  137

Query  465  GSSTARSWFMILK  503
            GS T  +WF I K
Sbjct  138  GSQTVANWFKIEK  150



>dbj|BAA82840.1| miraculin homologue [Youngia japonica]
Length=142

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 69/119 (58%), Gaps = 7/119 (6%)
 Frame = +3

Query  153  VQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSFFPVKP-KGAVR  326
            ++SG +YY++PV    GGGL LAST  +TCP  VVQ   +V  G  ++F PV P KG +R
Sbjct  1    LRSGTEYYILPVFRGMGGGLTLASTRNDTCPLDVVQADLEVDNGLPLTFTPVDPKKGVIR  60

Query  327  NGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTARSWFMILK  503
              TDLN++FS S   C +S VW +    E  D    V + G  GNPG  T  +WF I K
Sbjct  61   ESTDLNIIFSASSI-CIQSNVWNL----EEYDGQLIVSAHGVAGNPGRETISNWFKIEK  114



>ref|XP_010537532.1| PREDICTED: miraculin [Tarenaya hassleriana]
Length=202

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 79/134 (59%), Gaps = 5/134 (4%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            +AA +P  V D  GK V++G+ YY++PV   +GGGL +AS G +TCP SVVQ   +V+ G
Sbjct  24   DAASEP--VRDIRGKPVRAGLDYYILPVVRGRGGGLTMASAGNKTCPMSVVQDKFEVSPG  81

Query  282  DSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
              ++F P      V   TD NV FS + T C +STVW++    E      +V +GG +GN
Sbjct  82   FPLTFSPSDKSRIVGISTDQNVKFSAA-TICVQSTVWKLESFDETTK-QWFVTTGGVEGN  139

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  140  PGRETISNWFKIEK  153



>ref|XP_003534080.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 76/133 (57%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            A   P  VLDT GK V++   YY+VP  P   GGLD+ASTG + CP  VV +     G  
Sbjct  23   AGPAPEQVLDTSGKIVRARSSYYIVPASPDL-GGLDMASTGAD-CPLDVVAI-DGYQGQP  79

Query  288  VSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
            + F PV   KG +R  TDLN+ F  + T C ++TVW++  D +      +V +GGD GNP
Sbjct  80   LIFTPVNFNKGVIRVSTDLNIYFPVA-TSCPQTTVWKL-KDYDYSTSQWFVTTGGDFGNP  137

Query  465  GSSTARSWFMILK  503
            GS T  +WF I K
Sbjct  138  GSQTMANWFKIEK  150



>ref|XP_003534101.1| PREDICTED: 21 kDa seed protein-like [Glycine max]
 gb|KHM99730.1| Miraculin [Glycine soja]
Length=203

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 82/134 (61%), Gaps = 7/134 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AAQ+P  VLDT G+ +++GVKYY++PV   +GGGL ++S+G  TCP  VVQ   +V+ G 
Sbjct  26   AAQEP--VLDTSGQKLRTGVKYYILPVFRGRGGGLTVSSSGNNTCPLFVVQEKLEVSKGT  83

Query  285  SVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             V+F P   + G +   TDLN+      T C +  VW++    + +  V ++ +GG +GN
Sbjct  84   PVTFTPYNAESGVILTSTDLNIKSYVKSTTCDKPPVWKLL---KVLTGVWFLSTGGVEGN  140

Query  462  PGSSTARSWFMILK  503
            PG +T  +WF I K
Sbjct  141  PGVNTVVNWFKIEK  154



>ref|XP_003620169.1| Kunitz-type trypsin inhibitor alpha chain [Medicago truncatula]
 gb|AES76387.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
 gb|AFK40758.1| unknown [Medicago truncatula]
 gb|AFK41434.1| unknown [Medicago truncatula]
Length=203

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 81/138 (59%), Gaps = 7/138 (5%)
 Frame = +3

Query  102  CEAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGK--ETCPKSVVQVAPKV  275
            C+    P  VLD  GK + +GVKYY++PV   +GGGL +A+ G+  +TCP  VVQ   +V
Sbjct  17   CKTIAAPEPVLDISGKQLTTGVKYYILPVIRGKGGGLTVANHGENNQTCPLYVVQEKLEV  76

Query  276  A-GDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGG  449
              G++V+F P   K G +   TDLN+    + T C ++ VW++  +   +  V ++ +GG
Sbjct  77   KNGEAVTFTPYNAKQGVILTSTDLNIKSFVTKTKCPQTQVWKLLKE---LTGVWFLATGG  133

Query  450  DKGNPGSSTARSWFMILK  503
             +GNP  +T  +WF I K
Sbjct  134  VEGNPSMATVGNWFKIEK  151



>gb|AFL91232.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=172

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 72/128 (56%), Gaps = 9/128 (7%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSFFPV  305
            V D DG  V  G +YY++PV   +GGG+ LA T  E+CP  VVQ   ++  G  ++F PV
Sbjct  1    VRDIDGNLVXXGXEYYILPVFRGRGGGVTLAPTRNESCPLDVVQEGFELDDGLPLTFTPV  60

Query  306  KP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG-GDKGNPGSSTA  479
             P KG +R  TDLN++FS S   C +S VW +          Q ++SG G  GNPG  T 
Sbjct  61   DPKKGVIRESTDLNIIFSASSI-CIQSNVWMLEEYEG-----QRIISGRGTAGNPGGETI  114

Query  480  RSWFMILK  503
             +WF I K
Sbjct  115  SNWFKIEK  122



>emb|CAN63617.1| hypothetical protein VITISV_041430 [Vitis vinifera]
Length=220

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 81/135 (60%), Gaps = 6/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPV-QPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            A   P  VLDT+GK +QS V YY++ V + + GGGL LASTG +TCP  VVQ   +V+ G
Sbjct  24   AEAAPDPVLDTEGKKLQSEVDYYILSVIRRRGGGGLTLASTGNKTCPLDVVQEQNEVSNG  83

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
             ++ F PV P KG +R  TD N+ FS + T C +STVW++ +D  +     +  +G  +G
Sbjct  84   LTLMFSPVNPKKGVIRVSTDHNIEFSAA-TICVQSTVWKLEYDESSGQ--WFFTTGWVEG  140

Query  459  NPGSSTARSWFMILK  503
            N G  T  + F I K
Sbjct  141  NLGRGTLSNQFKIEK  155



>ref|XP_006347379.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=204

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 78/135 (58%), Gaps = 7/135 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            +A +P  +LD +GK +++   Y+VVPV  K GG + L +TG E C   VVQ    V G S
Sbjct  21   SAPEPDPILDINGKILRTHTTYFVVPVNHKYGG-ISLETTGNEKCQLGVVQEIYDVHGGS  79

Query  288  VSFFPVKPK-GAVRNGTDLNV-VFSGSXTGCQESTVWQI-AHDPENVDVVQYVLSGGDKG  458
            V+  P+ PK G +R  TDLN+ +FS    G  +STVWQ+  +D +      ++  GG +G
Sbjct  80   VALLPLNPKEGVIRVSTDLNIAIFSTHGCG-DQSTVWQLETYDSKTGK--YFIKDGGVEG  136

Query  459  NPGSSTARSWFMILK  503
            NP   T R+WF I K
Sbjct  137  NPDPKTIRNWFKIEK  151



>ref|NP_001237312.1| uncharacterized protein LOC100527782 precursor [Glycine max]
 gb|ACU16955.1| unknown [Glycine max]
Length=199

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 75/133 (56%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            A   P  VLDT GK V++   YY+VP  P   GGLD+ASTG + CP  VV V     G  
Sbjct  23   AGPAPEQVLDTAGKIVRARSSYYIVPASPDL-GGLDMASTGAD-CPLDVVAV-DGYQGQP  79

Query  288  VSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
            + F PV   KG +R  TDLN+ F    T C ++TVW++  D +      +V +GGD GNP
Sbjct  80   LIFTPVNFNKGVIRVSTDLNIYFP-VGTSCPQTTVWKL-KDYDYSTSQWFVTTGGDFGNP  137

Query  465  GSSTARSWFMILK  503
            GS T  +WF I K
Sbjct  138  GSQTVANWFKIEK  150



>ref|XP_004137534.1| PREDICTED: miraculin-like [Cucumis sativus]
 ref|XP_004165460.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64217.1| Tumor-related protein [Cucumis sativus]
Length=206

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 81/135 (60%), Gaps = 6/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P AVLD DGK +++GV YY++PV   +GGGL L +   E CP +VVQ   +V  G 
Sbjct  26   ADASPEAVLDIDGKKLRAGVNYYILPVFRGRGGGLTLGNLQSEKCPLNVVQEQLEVMNGF  85

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLS-GGDKG  458
              +F PV P KG VR  TDLNV F  S T C  STVW++    E+    Q++++ GG +G
Sbjct  86   PTTFHPVNPKKGVVRVSTDLNVQFEAS-TICVTSTVWKLDKFDESTG--QWLVTIGGSRG  142

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  143  NPGVETVDNWFKIEK  157



>emb|CDP22082.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 81/139 (58%), Gaps = 11/139 (8%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPK---QGGGLDLASTGKETCPKSVVQ-VAPKV  275
            +A +P  VLD  G  +++ + YY++P   +   +GGGL L+S G +TCP  V Q ++ + 
Sbjct  24   SAAEPEPVLDVAGNVLRTDLYYYILPANVRGRFRGGGLTLSSIGNDTCPVGVFQELSAQR  83

Query  276  AGDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAH--DPENVDVVQYVLSG  446
             G  V+F PVKP+ G VR  TDLN+ F+   T C ES VW++ +  DP       +V  G
Sbjct  84   NGIPVTFSPVKPRNGVVRISTDLNIEFAYPET-CGESPVWRVDNYVDPS---ADSFVSIG  139

Query  447  GDKGNPGSSTARSWFMILK  503
            G  GNPG +T  SWF I K
Sbjct  140  GVVGNPGPATLGSWFKIQK  158



>dbj|BAA82843.1| miraculin homologue [Solanum melongena]
Length=160

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 75/123 (61%), Gaps = 5/123 (4%)
 Frame = +3

Query  144  GKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCP-KSVVQVAPKVA-GDSVSFFPVKP-K  314
            GK +++G+ YY++PV   +GGGL + S G +TCP  +VVQ   +V  G  ++F P  P K
Sbjct  1    GKILRTGIDYYILPVVRGRGGGLTMDSIGNKTCPLDAVVQEQEEVKQGLPLTFTPFNPKK  60

Query  315  GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTARSWFM  494
            G +R  TDLN++FS +   C ++T W++ +  E      ++  GG++GNPG  T  +WF 
Sbjct  61   GVIRESTDLNIIFSANSI-CVQTTQWKLDNFDETTGKY-FITLGGNQGNPGRETISNWFK  118

Query  495  ILK  503
            I K
Sbjct  119  IEK  121



>emb|CDP21540.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 81/139 (58%), Gaps = 11/139 (8%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPK---QGGGLDLASTGKETCPKSVVQ-VAPKV  275
            +A +P  VLD  G  +++ + YY++P   +   +GGGL L+S G +TCP  V Q ++ + 
Sbjct  24   SAAEPEPVLDVAGNVLRTDLYYYILPANVRGRFRGGGLTLSSIGNDTCPVGVFQELSAQR  83

Query  276  AGDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAH--DPENVDVVQYVLSG  446
             G  V+F PVKP+ G VR  TDLN+ F+   T C ES VW++ +  DP       +V  G
Sbjct  84   NGIPVTFSPVKPRNGVVRISTDLNIEFAYPET-CGESPVWRVDNYVDPS---ADSFVSIG  139

Query  447  GDKGNPGSSTARSWFMILK  503
            G  GNPG +T  SWF I K
Sbjct  140  GVVGNPGPATLGSWFKIQK  158



>ref|XP_004299457.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=218

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 82/141 (58%), Gaps = 9/141 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTG---KETCPKSVVQVAPKV  275
             A   P  VLD  G  +Q+GV+Y+++PV   +GGGL LA+TG   +  CP  VVQ   +V
Sbjct  30   HADSDPAPVLDIKGHNIQTGVEYWILPVIRGRGGGLTLATTGNRNRSICPLDVVQEQQEV  89

Query  276  A-GDSVSFFPVKPK-GAVRNGTDLNVVFSGSX--TGC-QESTVWQIAHDPENVDVVQYVL  440
            + G  ++F PV  K G VR  TDLN+ FS S   T C   S VW++ +  E+    ++V 
Sbjct  90   SNGLPLTFSPVNLKIGVVRLSTDLNIKFSTSAAVTICLNTSKVWKLDNLDESTG-QRFVT  148

Query  441  SGGDKGNPGSSTARSWFMILK  503
            +GG +GNPG  T  +WF I K
Sbjct  149  TGGVEGNPGPKTISNWFKIEK  169



>emb|CDP21544.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 81/139 (58%), Gaps = 11/139 (8%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPK---QGGGLDLASTGKETCPKSVVQ-VAPKV  275
            +A +P  VLD  G  +++ + YY++P   +   +GGGL L+S G +TCP  V Q ++ + 
Sbjct  24   SAAEPEPVLDVAGNVLRTDLYYYILPANVRGRFRGGGLTLSSIGNDTCPVGVFQELSEQR  83

Query  276  AGDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAH--DPENVDVVQYVLSG  446
             G  ++F P+KPK G VR  TDLN+ F+   T C ES VW++ +  DP    +V     G
Sbjct  84   NGIPLTFSPLKPKDGVVRISTDLNIQFAYPET-CGESPVWRVDNYLDPSADSIVSI---G  139

Query  447  GDKGNPGSSTARSWFMILK  503
            G  GNPG +T  SWF I K
Sbjct  140  GVVGNPGPATLGSWFKIQK  158



>emb|CDP16462.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 78/134 (58%), Gaps = 6/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVV-PVQPKQGGGLDLA-STGKETCPKSVVQVAPK-VA  278
            AA+KP  VLD DG  +++GV+YY+V  ++   GGG+    S G E+CP  VVQ     + 
Sbjct  20   AAEKPNPVLDHDGDEIRAGVEYYIVSSIRGAGGGGVTYGRSIGNESCPLPVVQEKLDLLR  79

Query  279  GDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDK  455
            G  V+F PV  K G VR  TDLN+ FS +   C ES VW++  D E      ++L+ G +
Sbjct  80   GHPVTFTPVNSKEGVVRVSTDLNIKFSKAAPVCNESNVWKLDFDEELGQ--HFILTNGVE  137

Query  456  GNPGSSTARSWFMI  497
            GNPG  T  +WF I
Sbjct  138  GNPGCGTIHNWFKI  151



>ref|XP_003534078.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            A   P  VLDT GK V++   YY+VP  P   GGLD+ASTG + CP  VV V     G  
Sbjct  23   AGPAPEQVLDTSGKIVRARSSYYIVPASPDL-GGLDMASTGAD-CPLDVVAV-DGYQGQP  79

Query  288  VSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
            + F PV   KG +R  TDLN+ F    T C ++T W++  D +      +V +GGD GNP
Sbjct  80   LIFTPVNFNKGVIRVSTDLNIYFP-VGTSCPQTTAWKL-KDYDYSTSQWFVTTGGDFGNP  137

Query  465  GSSTARSWFMILK  503
            GS T  +WF I K
Sbjct  138  GSQTVANWFKIEK  150



>ref|XP_010918417.1| PREDICTED: miraculin-like [Elaeis guineensis]
Length=199

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 71/125 (57%), Gaps = 6/125 (5%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSV-VQVAPKVAGDSVSFFPV  305
            VLDTDG  ++ GV+YY+ P      GGL LAS    +CP  V + ++P   G  V+F P 
Sbjct  25   VLDTDGNELRRGVEYYIYPGITDVAGGLTLASR-NHSCPLDVTLAISPTNNGLPVTFLPA  83

Query  306  KP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTAR  482
             P +  +   TDLN+VFS + T C +ST W++  D +N     YV +GG  GNPG  T  
Sbjct  84   DPEEDTINTSTDLNIVFS-AFTICLQSTAWKL--DFDNTTRRFYVTTGGVTGNPGRETLD  140

Query  483  SWFMI  497
            +WF I
Sbjct  141  NWFKI  145



>gb|KHM99738.1| Miraculin [Glycine soja]
Length=199

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            A   P  VLDT GK V++   YY+VP  P   GGLD+ASTG + CP  VV V     G  
Sbjct  23   AGPAPEQVLDTSGKIVRARSSYYIVPASPDL-GGLDMASTGAD-CPLDVVAV-DGYQGQP  79

Query  288  VSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
            + F PV   KG +R  TDLN+ F    T C ++T W++  D +      +V +GGD GNP
Sbjct  80   LIFTPVNFNKGVIRVSTDLNIYFP-VGTSCPQTTAWKL-KDYDYSTSQWFVTTGGDFGNP  137

Query  465  GSSTARSWFMILK  503
            GS T  +WF I K
Sbjct  138  GSQTVANWFKIEK  150



>gb|AEK26936.1| Kunitz-type trypsin inhibitor B3 [Populus nigra]
Length=209

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 8/135 (6%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA +P  VLD DG+ + +G KYY++PV   +GGG+ +AS  K +CP +VVQ   +V+ G 
Sbjct  23   AAAEP--VLDIDGEKLVAGTKYYILPVFRGRGGGITMAS-NKTSCPLAVVQDRLEVSNGL  79

Query  285  SVSFFPVK--PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
             ++F P     KG +   TDLN+ F    T C +STVW+I     N  V  +V +GG +G
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKFLAKTT-CPQSTVWKIIKS-SNSKVQWFVSTGGVEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG +T  +WF I K
Sbjct  138  NPGFNTVTNWFQIEK  152



>ref|XP_008437058.1| PREDICTED: miraculin-like [Cucumis melo]
Length=205

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 78/134 (58%), Gaps = 4/134 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P AVLD DGK +++GV YY++PV   +GGGL L +   E CP +VVQ   ++  G 
Sbjct  25   ADASPEAVLDIDGKKLRAGVNYYILPVFRGRGGGLTLGNLQSEICPVNVVQEQFELMNGF  84

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
              +F PV P KG VR  TDLNV F  S T C  STVW++    E+     +V  GG +GN
Sbjct  85   PTTFHPVNPKKGVVRVSTDLNVQFDAS-TICVTSTVWKLDKFDESTG-QWFVTIGGSRGN  142

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  143  PGVETVDNWFKIEK  156



>gb|ADW95389.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=209

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 8/135 (6%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA +P  VLD DG+ + +G KYY++PV   +GGG+ +AS  K +CP +VVQ   +V+ G 
Sbjct  23   AAAEP--VLDIDGEKLVAGTKYYILPVFRGRGGGITMAS-NKTSCPLAVVQDRLEVSKGL  79

Query  285  SVSFFPVK--PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
             ++F P     KG +   TDLN+ F    T C +STVW+I     N  V  +V +GG +G
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKFLAKTT-CPQSTVWKIIKS-SNSKVQWFVSTGGVEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG +T  +WF I K
Sbjct  138  NPGFNTVTNWFQIEK  152



>sp|P13087.3|MIRA_SYNDU RecName: Full=Miraculin; Short=MIR; Flags: Precursor [Synsepalum 
dulcificum]
 dbj|BAA07603.1| miraculin precursor [Synsepalum dulcificum]
 dbj|BAH84844.1| miraculin [Synsepalum dulcificum]
Length=220

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 77/134 (57%), Gaps = 11/134 (8%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLAST---GKETCPKSVVQVAPKVAGDS-  287
            P  VLD DG+ +++G  YY+VPV    GGGL +++T   G   CP  VVQ   +V  D  
Sbjct  33   PNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRP  92

Query  288  VSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQ--ESTVWQIAHDPENVDVVQYVLS-GGDK  455
            ++FFP  PK   VR  TDLN+ FS +   C+   STVW++  D  +    QY ++ GG K
Sbjct  93   LAFFPENPKEDVVRVSTDLNINFS-AFMPCRWTSSTVWRL--DKYDESTGQYFVTIGGVK  149

Query  456  GNPGSSTARSWFMI  497
            GNPG  T  SWF I
Sbjct  150  GNPGPETISSWFKI  163



>ref|XP_010683193.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=206

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 6/129 (5%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLAS-TGKETCPKSVVQVAPKVA-GDSVSFF  299
            AVLD +G+ +Q+G  YY++PV   +GGGL +AS    E CP  V Q   +V+ G  + F+
Sbjct  28   AVLDINGRPLQAGYNYYILPVIRGRGGGLTMASKNATELCPLYVAQEDHEVSNGLPLKFY  87

Query  300  PVKPKGA-VRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSST  476
            PV PK   +   +DLN VF  + T C +ST W +  + E     +YV +GG+ GNPG  T
Sbjct  88   PVNPKDKRISLSSDLNFVFDAATT-CVQSTGWSLTIEMETGR--RYVGTGGEIGNPGVET  144

Query  477  ARSWFMILK  503
              +WF I K
Sbjct  145  VDNWFKIEK  153



>ref|XP_008437071.1| PREDICTED: miraculin-like [Cucumis melo]
Length=212

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 81/140 (58%), Gaps = 9/140 (6%)
 Frame = +3

Query  102  CEAAQKPPAVLDTDGKAVQSGVKYYVVP-VQPKQGGGLDLASTGKE--TCPKSVVQVAPK  272
            C A   P AVLDTDGK ++   KYY++P  +   GGGL + +  KE   C  +VVQ   +
Sbjct  24   CRADASPDAVLDTDGKKLRVSNKYYILPAFEGSGGGGLAIGNIRKEYDRCGINVVQERYE  83

Query  273  VA-GDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLS-  443
             + GD  +F P+ P KG VR  TDLN+ F  + T C++STVW++      +   QY ++ 
Sbjct  84   QSDGDPTTFLPINPKKGVVRVSTDLNIEFDAT-TRCRKSTVWKLGTFDRYLR--QYFVTI  140

Query  444  GGDKGNPGSSTARSWFMILK  503
            GG KGNPG  T  +WF I K
Sbjct  141  GGTKGNPGRETTENWFKIEK  160



>emb|CDP21024.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 80/139 (58%), Gaps = 11/139 (8%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQ---GGGLDLASTGKETCPKSVVQ-VAPKV  275
            +A +P  VLD  G  +++ + YY++P   +    GGGL L+S G +TCP  V Q ++ + 
Sbjct  24   SAAEPEPVLDVAGNVLRTDLYYYILPANVRGRFGGGGLTLSSIGNDTCPVGVFQELSAQR  83

Query  276  AGDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAH--DPENVDVVQYVLSG  446
             G  V+F PVKP+ G VR  TDLN+ F+   T C ES VW++ +  DP       +V  G
Sbjct  84   NGIPVTFSPVKPRNGVVRISTDLNIEFAYPET-CGESPVWRVDNYLDPS---ADSFVSIG  139

Query  447  GDKGNPGSSTARSWFMILK  503
            G  GNPG +T  SWF I K
Sbjct  140  GVVGNPGPATLGSWFKIQK  158



>ref|XP_006372631.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ERP50428.1| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=209

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 81/135 (60%), Gaps = 8/135 (6%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA +P  VLD DG+ + +G +YY++PV   +GGG+ +AS  K +CP +VVQ   +V+ G 
Sbjct  23   AAAEP--VLDIDGEKLVAGTEYYILPVFRGRGGGITMAS-NKTSCPLAVVQDRLEVSKGL  79

Query  285  SVSFFPV--KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
             ++F P     KG +   TDLN+ F    T C +STVW+I     N  V  +V +GG +G
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKFLAKTT-CPQSTVWKITKS-SNSKVQWFVSTGGVEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG +T  +WF I K
Sbjct  138  NPGFNTVTNWFQIEK  152



>gb|AFK41478.1| unknown [Medicago truncatula]
Length=213

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 80/144 (56%), Gaps = 14/144 (10%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYV--VPVQPKQGGG--------LDLASTGKETCPKSV  254
            EA   P  V+DT+GK V++GV YY+  VP  P  G G        + +A +  ETCP +V
Sbjct  22   EADASPEQVVDTEGKKVRAGVDYYIRPVPTTPCDGRGPCVVGSGFVLIARSPNETCPLNV  81

Query  255  VQVAPKVAGDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQ  431
            V V     G  V+F PV P KG +R  TDLN+  S + T C+EST+W +  D ++     
Sbjct  82   V-VVEGFRGQGVTFTPVNPKKGVIRVSTDLNIKTSLN-TSCEESTIWTL-DDFDSSTGQW  138

Query  432  YVLSGGDKGNPGSSTARSWFMILK  503
            +V +GG  GNPG  T  +WF I K
Sbjct  139  FVTTGGVLGNPGKDTVDNWFKIEK  162



>ref|XP_003620188.1| Miraculin [Medicago truncatula]
 gb|AES76406.1| Lipid transfer protein [Medicago truncatula]
Length=213

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 80/144 (56%), Gaps = 14/144 (10%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYV--VPVQPKQGGG--------LDLASTGKETCPKSV  254
            EA   P  V+DT+GK V++GV YY+  VP  P  G G        + +A +  ETCP +V
Sbjct  22   EADASPEQVVDTEGKKVRAGVDYYIRPVPTTPCDGRGPCVVGSGFVLIARSPNETCPLNV  81

Query  255  VQVAPKVAGDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQ  431
            V V     G  V+F PV P KG +R  TDLN+  S + T C+EST+W +  D ++     
Sbjct  82   V-VVEGFRGQGVTFTPVNPKKGVIRVSTDLNIKTSLN-TSCEESTIWTL-DDFDSSTGQW  138

Query  432  YVLSGGDKGNPGSSTARSWFMILK  503
            +V +GG  GNPG  T  +WF I K
Sbjct  139  FVTTGGVLGNPGKDTVDNWFKIEK  162



>ref|XP_010101167.1| hypothetical protein L484_005403 [Morus notabilis]
 gb|EXB87528.1| hypothetical protein L484_005403 [Morus notabilis]
Length=197

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 77/128 (60%), Gaps = 4/128 (3%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSFFP  302
            AVLD  GK +Q GV YY++PV   +GGGL LA+   +T P  VVQ   +V +G  ++F P
Sbjct  23   AVLDLSGKKLQKGVDYYILPVIRGRGGGLKLANARNKTSPLDVVQDQFEVSSGFPLTFSP  82

Query  303  V-KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTA  479
              + +  V   TDLN+ FS + T C +STVW++    E++    +V SGG +GNPG  T 
Sbjct  83   ANQNQSFVCLSTDLNIKFSAATT-CAQSTVWKLDSFDESLG-QWFVTSGGVEGNPGRQTI  140

Query  480  RSWFMILK  503
             +WF I K
Sbjct  141  SNWFKIEK  148



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 7/136 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKE--TCPKSVVQVAPKV-A  278
            A   P  VLDT+G  +++G  Y+V+PV   +GGGL L S  K+  +CP+ ++Q + +V  
Sbjct  27   AGPSPSPVLDTNGDKIRAGSNYFVLPVIRGRGGGL-LPSNVKQNNSCPRDIIQNSNEVQE  85

Query  279  GDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDK  455
            G  V F PV P KG +R  TDLNV F  + T C   T+W++    E +    ++++GG +
Sbjct  86   GLPVVFTPVDPKKGVIRLSTDLNVRFF-TPTICARETIWKLGTYDEKLK-QYFIVTGGVE  143

Query  456  GNPGSSTARSWFMILK  503
            GNPG  T  +WF I K
Sbjct  144  GNPGPLTVSNWFKIEK  159



>gb|KHN24493.1| Miraculin [Glycine soja]
Length=200

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 72/133 (54%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            A   P  VLDT GK V++   YY+VP  P   GGL +ASTG E CP  VV V     G  
Sbjct  23   AGPAPEQVLDTSGKMVRARTSYYIVPASPDV-GGLAMASTG-EDCPLDVVAVD-GYQGQP  79

Query  288  VSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
            + F PV   KG +R  TDLN+ F    T C  +  W++  D +N     +V +GGD GNP
Sbjct  80   LIFTPVNVNKGVIRVSTDLNIYFP-IDTSCPLTKAWKL-KDYDNSTSQWFVTTGGDFGNP  137

Query  465  GSSTARSWFMILK  503
            GS T  +WF I K
Sbjct  138  GSQTLANWFKIEK  150



>gb|AHJ25677.1| Kunitz-type trypsin inhibitor [Curcuma longa]
Length=213

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 81/131 (62%), Gaps = 7/131 (5%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKET---CPKSVVQVAPKVAGDSVSF  296
            +V DTDG++++ G +YY++P+   +GGGL LA+   ++   CP +V Q   +V       
Sbjct  29   SVRDTDGRSLRPGHEYYILPLIRGRGGGLTLAARSNDSSFACPLAVAQEGLEVDSGLPVI  88

Query  297  FPVKPKGA--VRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGS  470
            F   P+G+  V+  TDLNV FS + T C +STVW++  D +     +YV+SGG +G+PG+
Sbjct  89   FSPAPEGSEFVKMSTDLNVRFSAA-TICVQSTVWRLG-DVDASTGRRYVISGGVEGSPGA  146

Query  471  STARSWFMILK  503
             TA +WF I +
Sbjct  147  GTASNWFKIER  157



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 78/136 (57%), Gaps = 5/136 (4%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGK-ETCPKSVVQVAPKV-A  278
             A   P  VLDT+G  +++G  Y+V+PV   +GGGL  ++  +  TCP+ ++Q +  V  
Sbjct  26   SAGPSPSPVLDTNGDKIRTGSNYFVLPVIRGRGGGLFPSNVKQNNTCPRDIIQESLDVQQ  85

Query  279  GDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDK  455
            G  V F PV P KG +R  +DLNV F  + T C   T+W++    E +    +V++GG +
Sbjct  86   GLPVVFTPVDPKKGVIRLSSDLNVRFF-TPTICARETIWKVGDFDEKLK-QYFVVTGGVE  143

Query  456  GNPGSSTARSWFMILK  503
            GNPG  T  +WF I K
Sbjct  144  GNPGPQTVSNWFKIEK  159



>gb|KHM99744.1| Miraculin [Glycine soja]
Length=174

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 71/125 (57%), Gaps = 6/125 (5%)
 Frame = +3

Query  132  LDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDSVSFFPVK-  308
            LDT GK V++   YY+VP  P  GG LD+ASTG + CP  VV V     G  + F PV  
Sbjct  6    LDTSGKIVRARSSYYIVPASPDLGG-LDMASTGAD-CPLDVVAVD-GYQGQPLIFTPVNF  62

Query  309  PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTARSW  488
             KG +R  TDLN+ F    T C ++T W++  D +      +V +GGD GNPGS T  +W
Sbjct  63   NKGVIRVSTDLNIYFP-VGTSCPQTTAWKL-KDYDYSTSQWFVTTGGDFGNPGSQTVANW  120

Query  489  FMILK  503
            F I K
Sbjct  121  FKIEK  125



>ref|XP_008778295.1| PREDICTED: miraculin, partial [Phoenix dactylifera]
Length=184

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 71/125 (57%), Gaps = 6/125 (5%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSV-VQVAPKVAGDSVSFFPV  305
            VLD DG  ++ GV+YY+ P      GGL LAS    +CP  V + ++P   G  ++F P 
Sbjct  33   VLDRDGNELRRGVEYYIYPGITDVAGGLTLASR-NHSCPLDVTLAISPTSNGLPLTFLPA  91

Query  306  KPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTAR  482
             P+   +   TDLN+VFS + T C +STVW++  D ++     YV +GG  GNPG  T  
Sbjct  92   DPEEDTINTSTDLNIVFS-AVTICVQSTVWKL--DFDDAAGRFYVTTGGVAGNPGRETLA  148

Query  483  SWFMI  497
            +WF I
Sbjct  149  NWFKI  153



>emb|CDO98554.1| unnamed protein product [Coffea canephora]
Length=209

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVPVQPK---QGGGLDLASTGKETCPKSVVQ-VAPKVAGDS  287
            P  VLDT G  +++   YY++P + +   +GGGL L+S G +TCP  V Q ++ +  G  
Sbjct  30   PEPVLDTAGNVLRTDRDYYILPAKVRGRFRGGGLTLSSIGNDTCPVGVFQEMSEQRNGIP  89

Query  288  VSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAH--DPENVDVVQYVLSGGDKG  458
            ++F PVK + G VR  TDLN+ F+   T C ES VW++ +  DP       +V  GG  G
Sbjct  90   LTFSPVKQRYGVVRTSTDLNIQFAYPET-CGESPVWRVDNYLDPS---ADSFVSIGGVVG  145

Query  459  NPGSSTARSWFMILK  503
            NPG +T  SWF I K
Sbjct  146  NPGPATLGSWFKIQK  160



>emb|CDP20822.1| unnamed protein product [Coffea canephora]
Length=204

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 76/129 (59%), Gaps = 7/129 (5%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFP  302
            AV D DGK V  G  YY++PV   +GGGL L S   ETCP  V+Q   +V  G  ++F P
Sbjct  29   AVRDIDGKEVIVGAHYYILPVIRGRGGGLTLGSADNETCPLDVIQEQFEVKRGLPLTFTP  88

Query  303  VK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVL-SGGDKGNPGSST  476
            V   KG V   TDLN+ F  + T C +STVW++  D    D+ QYV+ SGG +GNPG  T
Sbjct  89   VNTTKGVVPVSTDLNIKFFAA-TICVQSTVWKLEFD---ADISQYVIVSGGIEGNPGRET  144

Query  477  ARSWFMILK  503
              +WF I K
Sbjct  145  ISNWFKIEK  153



>gb|AFL91229.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=164

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 69/120 (58%), Gaps = 9/120 (8%)
 Frame = +3

Query  153  VQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSFFPVKP-KGAVR  326
            V+SG +YY +PV   +GGG+ LA T  E+CP  VVQ   ++  G  ++F PV P KG +R
Sbjct  1    VRSGXEYYXLPVFXGRGGGVTLAPTRNESCPLDVVQEGFELDDGLPLTFTPVDPKKGVIR  60

Query  327  NGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG-GDKGNPGSSTARSWFMILK  503
              TDLN++FS S   C +S VW +          Q ++SG G  GNPG  T  +WF I K
Sbjct  61   ESTDLNIIFSASSI-CIQSNVWMLEEYEG-----QRIISGRGTAGNPGGETISNWFKIEK  114



>ref|XP_003620172.1| 21 kDa seed protein [Medicago truncatula]
 gb|AES76390.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=205

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 76/141 (54%), Gaps = 10/141 (7%)
 Frame = +3

Query  102  CEAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-----STGKETCPKSVVQVA  266
            C+    P  VLD  GK V +GVKYY++PV   +GGGL +      +    TCP  V+Q  
Sbjct  17   CKTFAAPEPVLDISGKKVTTGVKYYILPVIRGKGGGLTVVNENNLNGNNNTCPLYVLQEK  76

Query  267  PKVA-GDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVL  440
             +V  G +V+F P    KG +   TDLN+    + T C +S VW++    + +  V ++ 
Sbjct  77   LEVKNGQAVTFTPYNAKKGVILTSTDLNIKSYVTKTTCAQSQVWKLN---KVLSGVWFLA  133

Query  441  SGGDKGNPGSSTARSWFMILK  503
            +GG +GNPG  T  +WF I K
Sbjct  134  TGGVEGNPGFDTIFNWFKIEK  154



>gb|ACF74332.1| Kunitz trypsin inhibitor 4 [Arachis hypogaea]
Length=203

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 7/135 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA     VLD  G+ ++SGVKY+++PV   +GGGL + S+   TCP  V+Q   +V  G 
Sbjct  21   AASAAEPVLDVTGQKLRSGVKYFILPVLRGRGGGLTVGSSVNSTCPIYVLQDKLEVTRGT  80

Query  285  SVSFFPVKPK--GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
             V+F P  P   G +   TDLN + S S   C+ES+VW++    + +  V ++ + G  G
Sbjct  81   PVTFTPSTPNKDGVILTSTDLN-INSTSAPKCKESSVWRLL---KVLSGVWFISTDGVAG  136

Query  459  NPGSSTARSWFMILK  503
            NPG +T  +WF I K
Sbjct  137  NPGVNTVVNWFKIEK  151



>ref|XP_010476950.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 11/135 (8%)
 Frame = +3

Query  108  AAQKPP--AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-  278
            AA +PP  AV D +GK +Q+   YY++PV   +GGGL ++    +TCP+SV+Q   +V+ 
Sbjct  20   AATEPPVEAVKDINGKPLQTRFYYYILPVVRGRGGGLTMSKAENKTCPRSVIQDQFEVSQ  79

Query  279  GDSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
            G  VSF P      VR  TD N+ FS        +++W++A D +      ++ + G +G
Sbjct  80   GLPVSFSPYDKSRIVRVSTDQNIKFSS-------TSIWELA-DFDEATRQNFISTCGVEG  131

Query  459  NPGSSTARSWFMILK  503
            NPG +T  +WF I K
Sbjct  132  NPGQTTVDNWFKIDK  146



>ref|XP_011046090.1| PREDICTED: miraculin-like [Populus euphratica]
Length=209

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA +P  VLD DG+ + +G KYY++PV   +GGG+ +AS  + +CP +VVQ   + + G 
Sbjct  23   AAAEP--VLDIDGEKLVAGTKYYILPVFRGRGGGITMASN-QTSCPLAVVQDRLEASKGL  79

Query  285  SVSFFPV--KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
             ++F P     KG +   TDLN+ F    T C  STVW+I     N  V  +V +GG +G
Sbjct  80   PLTFTPAADDKKGVILVSTDLNIKFLDKTT-CPHSTVWKIIKS-SNSKVQWFVSTGGVEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG +T  +WF I K
Sbjct  138  NPGFNTVGNWFQIEK  152



>ref|XP_010041215.1| PREDICTED: miraculin-like [Eucalyptus grandis]
 gb|KCW44534.1| hypothetical protein EUGRSUZ_L01961 [Eucalyptus grandis]
Length=203

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 78/133 (59%), Gaps = 5/133 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA  P  VLDTDG  +Q+GV Y+++PV   +GGGL L ++    CP +VVQ   +++ G 
Sbjct  26   AASSP--VLDTDGHKLQTGVNYHILPVLRGRGGGLTLGASRSGNCPLAVVQEQQELSDGL  83

Query  285  SVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
               F PV  +  +R  TDLNV F  + T C +STVW++A   E V    +V SGG  GNP
Sbjct  84   PAKFSPVDGRSTIRLSTDLNVWFDAA-TICVQSTVWRLAAFDEEVKQY-FVESGGVLGNP  141

Query  465  GSSTARSWFMILK  503
            G  T  +WF I K
Sbjct  142  GRETVSNWFKIEK  154



>ref|XP_003548288.1| PREDICTED: miraculin-like [Glycine max]
Length=200

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 71/133 (53%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            A   P  VLDT GK V++   YY+VP  P   GGL +ASTG E CP  VV V     G  
Sbjct  23   AGPAPEQVLDTSGKMVRARTSYYIVPASPDV-GGLAMASTG-EDCPLDVVAVD-GYQGQP  79

Query  288  VSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
            + F PV   KG +R  TDLN+ F    T C  +  W++  D +      +V +GGD GNP
Sbjct  80   LIFTPVNVNKGVIRVSTDLNIYFP-IDTSCPLTKAWKL-KDYDYSTSQWFVTTGGDFGNP  137

Query  465  GSSTARSWFMILK  503
            GS T  +WF I K
Sbjct  138  GSQTLANWFKIEK  150



>ref|NP_001241106.1| uncharacterized protein LOC100790688 precursor [Glycine max]
 gb|ACU23857.1| unknown [Glycine max]
 gb|KHM99731.1| Miraculin [Glycine soja]
Length=209

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 74/139 (53%), Gaps = 10/139 (7%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQP----KQGGGLDLASTGKETCPKSVVQVAPKV  275
            A   P  V+DT GK ++ G  YY+VP  P    +   GL LAS GK  CP  VV V    
Sbjct  24   AEASPEQVVDTLGKKLRVGTNYYIVPSLPYTKIRTTRGLGLASVGKPYCPLDVV-VVNGY  82

Query  276  AGDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGC--QESTVWQIAHDPENVDVVQYVLSG  446
             G  V+F PV P KG +R  TDLN+ FS + T C  Q STVW++  D +      +V +G
Sbjct  83   HGLPVTFSPVNPKKGVIRVSTDLNIKFS-ARTSCPRQYSTVWKL-DDFDFSKRQWFVTTG  140

Query  447  GDKGNPGSSTARSWFMILK  503
            G  GNP   T  +WF I K
Sbjct  141  GVVGNPSLETIHNWFKIEK  159



>ref|XP_010042449.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 79/134 (59%), Gaps = 7/134 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA  P  VLDTDG  +Q+GV Y+++PV   +GGGL L ++    CP +VVQ   +++ G 
Sbjct  85   AASSP--VLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRSGNCPLAVVQEQQELSDGL  142

Query  285  SVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVL-SGGDKGN  461
               F PV     +R  TDLNV F  + T C +STVW++A   E  +V QY + SGG  GN
Sbjct  143  PAKFSPVDGNSTIRLSTDLNVWFDAA-TICVQSTVWRLAAFDE--EVKQYFIESGGVLGN  199

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  200  PGRETVSNWFKIEK  213



>gb|AFL91234.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=161

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 67/117 (57%), Gaps = 9/117 (8%)
 Frame = +3

Query  162  GVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSFFPVKP-KGAVRNGT  335
            G +YY++PV   +GGG+ LA T  E+CP  VVQ   ++  G  ++F PV P KG +R  T
Sbjct  1    GTEYYILPVFRGRGGGVTLAPTRNESCPLDVVQEGFELDNGLPLTFTPVDPKKGVIREST  60

Query  336  DLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG-GDKGNPGSSTARSWFMILK  503
            DLN++FS S   C +S VW +          Q ++SG G  GNPG  T  +WF I K
Sbjct  61   DLNIIFSASSI-CIQSNVWMLEEYEG-----QRIISGRGTSGNPGGETISNWFKIEK  111



>ref|XP_010037029.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 77/133 (58%), Gaps = 5/133 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA  P  VLDTDG  +Q+GV Y+++PV   +GGGL L ++    CP +VVQ   +++ G 
Sbjct  85   AASSP--VLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRSGNCPLAVVQEQQELSDGL  142

Query  285  SVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
               F PV     +R  TDLNV F  + T C +STVW++A   E V    +V SGG  GNP
Sbjct  143  PAKFSPVDGNSTIRLSTDLNVWFDAA-TICVQSTVWRLAAFDEEVKQY-FVESGGVLGNP  200

Query  465  GSSTARSWFMILK  503
            G  T  +WF I K
Sbjct  201  GRETVSNWFKIEK  213



>ref|XP_010683194.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=208

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 75/130 (58%), Gaps = 7/130 (5%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKS-VVQVAPKVA-GDSVSF  296
            AVLD +G+ +Q+   YY++PV   +GGGL +      + CP + V Q   ++A G  + F
Sbjct  29   AVLDINGRPLQARSNYYILPVIRGRGGGLRMTPKNATQLCPLAYVAQEGSELANGLPLKF  88

Query  297  FPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSS  473
            +PV PK   +   TDLN VF  + T C +ST W++A D   V   +YV  GG+ GNPG +
Sbjct  89   YPVNPKDKTISLSTDLNFVFDAA-TICVQSTQWRLAFD--EVTGRRYVGFGGEIGNPGGN  145

Query  474  TARSWFMILK  503
            T  +WF I K
Sbjct  146  TVSNWFKIEK  155



>gb|KCW48670.1| hypothetical protein EUGRSUZ_K02326 [Eucalyptus grandis]
Length=203

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 77/133 (58%), Gaps = 5/133 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            AA  P  VLDTDG  +Q+GV Y+++PV   +GGGL L ++    CP +VVQ   +++ G 
Sbjct  26   AASSP--VLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRSGNCPLAVVQEQQELSDGL  83

Query  285  SVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
               F PV     +R  TDLNV F  + T C +STVW++A   E V    +V SGG  GNP
Sbjct  84   PAKFSPVDGNSTIRLSTDLNVWFDAA-TICVQSTVWRLAAFDEEVKQY-FVESGGVLGNP  141

Query  465  GSSTARSWFMILK  503
            G  T  +WF I K
Sbjct  142  GRETVSNWFKIEK  154



>ref|NP_001238098.1| uncharacterized protein LOC100306134 precursor [Glycine max]
 gb|ACU14169.1| unknown [Glycine max]
 gb|KHN24495.1| Miraculin [Glycine soja]
Length=214

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 75/142 (53%), Gaps = 15/142 (11%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYV--VPVQPKQGGG--------LDLASTGKETCPKSVV  257
            A   P  V+DT+GK V++GV YY+  VP  P  G G        + +A +   TCP SV 
Sbjct  23   ADASPRQVIDTEGKKVRAGVDYYIRPVPTTPCDGRGPCVVGSGYVLIARSSNHTCPLSVA  82

Query  258  QVAPKVAGDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQI-AHDPENVDVVQ  431
             V     G +V+F  V PK G +R  TDLN+  S + T C ESTVW++ A D        
Sbjct  83   -VVEGFRGLAVTFKLVNPKKGVIRVSTDLNIKTSLTNTSCSESTVWKLDAFDDSTGQ--W  139

Query  432  YVLSGGDKGNPGSSTARSWFMI  497
            +V +GG  GNPG  T  +WF I
Sbjct  140  FVTTGGVLGNPGKDTIDNWFKI  161



>ref|XP_009803614.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=210

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 75/135 (56%), Gaps = 5/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGK-ETCPKSVVQVAPKV-AG  281
            A   P  VLD +G  VQ G+ Y+V+PV   +GGGL  ++  +  TCP+ ++Q   +V  G
Sbjct  27   AGSSPSPVLDINGDKVQVGLNYFVLPVIRGRGGGLYPSNVKQNNTCPRDIIQEVDEVQQG  86

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V F P    KG VR  TDLNV F  + T C   T+W++    + +    ++++GG +G
Sbjct  87   LPVVFTPFDAKKGVVRLSTDLNVRFF-TPTICARETIWKLGTYDDKLK-QYFMVTGGVEG  144

Query  459  NPGSSTARSWFMILK  503
            NPG  T  SWF I K
Sbjct  145  NPGPQTLSSWFKIEK  159



>ref|XP_009615974.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 76/136 (56%), Gaps = 7/136 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKE--TCPKSVVQVAPKV-A  278
            A   P  VLD +G  V+ G  Y+V+PV   +GGGL L S  K+  TCP+ ++Q + +V  
Sbjct  27   AGSSPSPVLDINGDKVRVGSNYFVLPVIRGRGGGL-LPSNVKQINTCPRDIIQNSDEVQQ  85

Query  279  GDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDK  455
            G  V F P    KG VR  TDLNV F  + T C   T+W++    + +    ++++GG +
Sbjct  86   GLPVVFTPFDAKKGVVRLSTDLNVRFY-TPTICARETIWKLGTYDDKLK-QYFIVTGGVE  143

Query  456  GNPGSSTARSWFMILK  503
            GNPG  T  SWF I K
Sbjct  144  GNPGPQTVSSWFKIEK  159



>gb|AFK33359.1| unknown [Medicago truncatula]
Length=202

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 75/141 (53%), Gaps = 10/141 (7%)
 Frame = +3

Query  102  CEAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-----STGKETCPKSVVQVA  266
            C+    P  VLD  GK V +GVKYY++PV   +GGGL +      +    TCP  V+Q  
Sbjct  17   CKTFAAPEPVLDISGKKVTTGVKYYILPVIRGKGGGLTVVNENNLNGNNNTCPLYVLQEK  76

Query  267  PKVA-GDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVL  440
             +V  G +V+F P    KG +   TDLN+    + T C +S VW++    + +  V ++ 
Sbjct  77   LEVKNGQAVTFTPYNAKKGVILTSTDLNIKSYVTKTTCAQSQVWKLN---KVLSGVWFLA  133

Query  441  SGGDKGNPGSSTARSWFMILK  503
            +G  +GNPG  T  +WF I K
Sbjct  134  TGSVEGNPGFDTIFNWFKIEK  154



>emb|CDP20533.1| unnamed protein product [Coffea canephora]
Length=214

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 73/141 (52%), Gaps = 12/141 (9%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVP----VQPKQGGGLDLASTGKETCPKSVVQ-VAP  269
             AA+ P  V D  GK +++   YY++P        +GGGL L+  GK TCP +V Q  + 
Sbjct  27   SAAEAPEPVRDVAGKMLRTDRHYYILPAANVFDKFRGGGLTLSGIGKNTCPAAVFQETSE  86

Query  270  KVAGDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAH--DPENVDVVQYVL  440
            +  G  ++F PV P KG VR  TDLN+ F+   T C +S VW I +   P     V    
Sbjct  87   QKNGIPLAFLPVNPKKGVVRVSTDLNIKFAYPET-CGQSPVWSIDNYVYPSGDSFVNI--  143

Query  441  SGGDKGNPGSSTARSWFMILK  503
             GG  GNPG  T  SWF I K
Sbjct  144  -GGVVGNPGPKTLSSWFKIEK  163



>emb|CDP21543.1| unnamed protein product [Coffea canephora]
Length=214

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 73/141 (52%), Gaps = 12/141 (9%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVP----VQPKQGGGLDLASTGKETCPKSVVQ-VAP  269
             AA+ P  V D  GK +++   YY++P        +GGGL L+  GK TCP +V Q  + 
Sbjct  27   SAAEAPEPVRDVAGKILRTDRHYYILPAANVFDKFRGGGLTLSGIGKNTCPAAVFQETSE  86

Query  270  KVAGDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAH--DPENVDVVQYVL  440
            +  G  ++F PV P KG VR  TDLN+ F+   T C +S VW I +   P     V    
Sbjct  87   QKNGIPLAFLPVNPKKGVVRVSTDLNIKFAYPET-CGQSPVWSIDNYVYPSGDSFVNI--  143

Query  441  SGGDKGNPGSSTARSWFMILK  503
             GG  GNPG  T  SWF I K
Sbjct  144  -GGVVGNPGPKTLSSWFKIEK  163



>ref|XP_004301214.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
 ref|XP_011464438.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=226

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 78/138 (57%), Gaps = 8/138 (6%)
 Frame = +3

Query  111  AQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKET--CPKSVVQVAPKVA-G  281
            A  P  V D  G  +Q+GV+Y+++PV   +GGGL LAS   +T  CP  VVQ   +V+ G
Sbjct  39   AADPAPVRDIKGDNLQTGVEYWILPVIRGKGGGLTLASNRNKTIGCPLDVVQEQSEVSNG  98

Query  282  DSVSFFPVK-PKGAVRNGTDLNVVFSGSX--TGC-QESTVWQIAHDPENVDVVQYVLSGG  449
              ++F PV   KG VR  TDLN+ FS S   T C Q S VW++    E+    + V +GG
Sbjct  99   LPLTFSPVNLTKGVVRLSTDLNIKFSTSAAVTLCPQTSKVWKLDEVDESTG-QRSVTTGG  157

Query  450  DKGNPGSSTARSWFMILK  503
             +GNP   T  +WF I K
Sbjct  158  VEGNPSPKTLMNWFKIEK  175



>ref|XP_004235409.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=201

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQ-VAPKVAGDSVSFFPV  305
            +LD  G AV++GV YY++P     GGGL +AS    T P  V Q V   V G +V F PV
Sbjct  28   ILDVSGNAVRTGVNYYILPAGRGNGGGLQVASIKNRTNPLVVSQNVDDSVIGVNVQFSPV  87

Query  306  KPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTAR  482
             PK   +R  TD+NV F+ S      STVW+I  + E +     V  GG +GNPG  T  
Sbjct  88   DPKENTIRLSTDMNVKFT-SMEISDSSTVWRI--NTELIPQRYLVTIGGVEGNPGRETLG  144

Query  483  SWFMILK  503
            +WF I K
Sbjct  145  NWFNIDK  151



>ref|XP_009793041.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 76/136 (56%), Gaps = 7/136 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKE--TCPKSVVQVAPKV-A  278
            A   P  VLD +G  V+ G+ Y+V+PV   +GGGL L S  K+  TCP+ ++Q + +V  
Sbjct  27   AGSSPSPVLDINGDKVKVGLNYFVLPVIRGRGGGL-LPSNVKQNNTCPRDIIQNSDEVQE  85

Query  279  GDSVSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDK  455
            G  V F P    KG VR   DLNV F  + T C   T+W++    + +    ++++GG +
Sbjct  86   GLPVVFTPFNTKKGVVRLSIDLNVRFF-TPTICARETIWKLGTYDDKLK-QYFIVTGGVE  143

Query  456  GNPGSSTARSWFMILK  503
            GNPG  T  SWF I K
Sbjct  144  GNPGPQTLSSWFKIEK  159



>gb|ACL12055.1| Kunitz trypsin inhibitor [Nicotiana tabacum]
Length=209

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 76/136 (56%), Gaps = 7/136 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKE--TCPKSVVQVAPKV-A  278
            A   P  VLD +G  V+ G+ Y+V+PV   +GGGL L S  K+  TCP+ ++Q + +V  
Sbjct  27   AGSSPSPVLDINGDKVKVGLNYFVLPVIRGRGGGL-LPSNVKQNNTCPRDIIQNSDEVQE  85

Query  279  GDSVSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDK  455
            G  V F P    KG VR   DLNV F  + T C   T+W++    + +    ++++GG +
Sbjct  86   GLPVVFAPFNTKKGVVRLSIDLNVRFF-TPTICARETIWKLGTYDDKLK-QYFIVTGGVE  143

Query  456  GNPGSSTARSWFMILK  503
            GNPG  T  SWF I K
Sbjct  144  GNPGPQTLSSWFKIEK  159



>gb|ADW95380.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=210

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 72/134 (54%), Gaps = 4/134 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSV-VQVAPKVAGD  284
            A   P  VLD  GK +++G  Y ++PV+  +GGG+  A TG ++CP  V ++      G 
Sbjct  28   AGAAPEPVLDIAGKVLRTGTYYDILPVERGRGGGITFACTGHKSCPVDVMLEDYEDSDGL  87

Query  285  SVSFFPV-KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             + F P  + KG +R  TDLN+ F G  + C  + VW++    E +    ++ + G +GN
Sbjct  88   PLQFIPANRKKGVIRLSTDLNIKFPGPAS-CAATAVWKVEKYDE-LTSQMFISTSGVEGN  145

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  146  PGPETVDNWFKIEK  159



>ref|XP_002305034.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
 gb|EEE85545.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
Length=207

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 72/134 (54%), Gaps = 4/134 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSV-VQVAPKVAGD  284
            A   P  VLD  GK +++G  Y ++PV+  +GGG+  A TG ++CP  V ++      G 
Sbjct  25   AGAAPEPVLDIAGKVLRTGTYYDILPVERGRGGGITFACTGHKSCPVDVMLEDYEDSDGL  84

Query  285  SVSFFPV-KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             + F P  + KG +R  TDLN+ F G  + C  + VW++    E +    ++ + G +GN
Sbjct  85   PLQFIPANRKKGVIRLSTDLNIKFPGPAS-CAATAVWKVEKYDE-LTSQMFISTSGVEGN  142

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  143  PGPETVDNWFKIEK  156



>ref|XP_004515059.1| PREDICTED: miraculin-like [Cicer arietinum]
Length=204

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 74/140 (53%), Gaps = 9/140 (6%)
 Frame = +3

Query  102  CEAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGL---DLASTGKETCPKSVVQVAPK  272
            C+    P  VLD  GK V +GVKYY++PV    GGGL    +A     TCP  VVQ   +
Sbjct  17   CKTIAAPQPVLDISGKKVTTGVKYYILPVIVGNGGGLTVTSIADNNNNTCPLYVVQEKQE  76

Query  273  VA-GDSVSFFPVKP-KGAVRNGTDLNVVFSGS-XTGCQESTVWQIAHDPENVDVVQYVLS  443
            V  G  V+F P    KG +   TDLN+  S +  T C +  VW++    + +  V ++ +
Sbjct  77   VQNGQPVTFTPYNATKGVILTSTDLNIKSSFTKKTTCAQPPVWKLL---KVLSGVWFLST  133

Query  444  GGDKGNPGSSTARSWFMILK  503
            GG +GNPG  T  +W+ I K
Sbjct  134  GGVEGNPGFQTIGNWYKIEK  153



>emb|CDY19181.1| BnaC05g13820D [Brassica napus]
Length=192

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 73/134 (54%), Gaps = 11/134 (8%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EAA +P  V D DG  + SG KYY++PV   +GGGL ++    +TCPKSV+Q   +++ G
Sbjct  20   EAALEP--VTDIDGGRLTSGTKYYILPVLRGRGGGLTMSKPENKTCPKSVIQDQYEISQG  77

Query  282  DSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
              + F P      +R  TDLN  F         ++VW + +  E  +   +V + G +GN
Sbjct  78   LPLEFSPSDNSRIIRVSTDLNFKFCA-------ASVWNLDNYDEKTN-QWFVTACGVEGN  129

Query  462  PGSSTARSWFMILK  503
            PG +T  +WF I K
Sbjct  130  PGQATVDNWFKIEK  143



>ref|XP_009149240.1| PREDICTED: miraculin [Brassica rapa]
Length=192

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 72/134 (54%), Gaps = 11/134 (8%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EAA +P  V D DG  + SG KYY++PV   +GGGL ++    +TCPKSV+Q   +V+ G
Sbjct  20   EAALEP--VTDIDGGRLTSGTKYYILPVLRGRGGGLTMSKPENKTCPKSVIQDPYEVSKG  77

Query  282  DSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
              V F P      +R  TDLN  F         ++VW + +  E  +   +V + G  GN
Sbjct  78   LPVEFSPSDNSRIIRVSTDLNFKFCA-------ASVWNLDNYDETTN-QWFVTACGVAGN  129

Query  462  PGSSTARSWFMILK  503
            PG +T  +WF I K
Sbjct  130  PGQATVDNWFKIEK  143



>ref|XP_006353931.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=208

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 72/130 (55%), Gaps = 11/130 (8%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPK-VAGDSVSFFPV  305
            VLD  G AV+ GV YY++P     GGGL +AS    T P  V Q A + V G +V F PV
Sbjct  35   VLDVSGNAVRRGVNYYILPAGRGNGGGLQVASIRNRTNPLVVSQNADESVIGVNVQFSPV  94

Query  306  KPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHD--PENVDVVQYVLS-GGDKGNPGSS  473
             PK   VR   D+NV F+ S      STVW+I  +  PE     +Y+++ GG +GNPG  
Sbjct  95   DPKENTVRLSIDMNVKFT-SMVISDSSTVWRINTELIPE-----RYLVTIGGVEGNPGRE  148

Query  474  TARSWFMILK  503
            T  +WF I K
Sbjct  149  TLGNWFNIDK  158



>gb|AEK26927.1| Kunitz-type trypsin inhibitor B4 [Populus nigra]
Length=211

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 73/135 (54%), Gaps = 5/135 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYY-VVPVQPKQGGGLDLASTGKETCPKSV-VQVAPKVAG  281
            A   P  VLD  GK +++G  YY ++PV+  +GGG+  A TG ++CP  V ++      G
Sbjct  28   AGAAPEPVLDIAGKVLRTGTNYYDILPVERGRGGGITFAITGHKSCPVDVMLEDYEDSDG  87

Query  282  DSVSFFPV-KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              + F P  + KG +R  TDLN+ F G  + C  + VW++    + +    ++ + G +G
Sbjct  88   LPLQFIPANRKKGVIRLSTDLNIKFPGPAS-CAATAVWKV-EKYDKLTSQMFISTSGVEG  145

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  146  NPGPETVDNWFKIEK  160



>gb|AFL91230.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=159

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 65/115 (57%), Gaps = 9/115 (8%)
 Frame = +3

Query  168  KYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSFFPVKP-KGAVRNGTDL  341
            +YY +PV   +GGG+ LA T  E+CP  VVQ   ++  G  ++F PV P KG +R  TDL
Sbjct  1    EYYXLPVFXGRGGGVTLAPTRNESCPLDVVQEGFELDDGLPLTFTPVDPKKGVIRESTDL  60

Query  342  NVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG-GDKGNPGSSTARSWFMILK  503
            N++FS S   C +S VW +          Q ++SG G  GNPG  T  +WF I K
Sbjct  61   NIIFSASSI-CIQSNVWMLEEYEG-----QRIISGRGTAGNPGGETISNWFKIEK  109



>emb|CDX83886.1| BnaC08g17590D [Brassica napus]
Length=195

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 76/134 (57%), Gaps = 11/134 (8%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EAA +P  V D  G+ +++G KYY++PV   +GGGL ++    +TCPKSV+Q   +V+ G
Sbjct  23   EAAVEP--VTDIYGQRLRAGTKYYILPVVRGRGGGLTMSKAENKTCPKSVIQERFEVSNG  80

Query  282  DSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
              ++F P      +R  TDLN  FS        +++W + +  E  +   ++ + G +GN
Sbjct  81   MPLTFSPSDKSKVIRVSTDLNFKFSA-------TSIWNLDNVDEKTN-QWFIGTCGVEGN  132

Query  462  PGSSTARSWFMILK  503
            PG +T  +WF I K
Sbjct  133  PGRTTVGNWFKIDK  146



>emb|CDP21779.1| unnamed protein product [Coffea canephora]
Length=213

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 75/133 (56%), Gaps = 6/133 (5%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            AA++P  VLDT+G+ ++ GV+YY+  +    GG       G E CP +VVQ   +  GD 
Sbjct  20   AAEEPNPVLDTNGEEIRPGVEYYMGTIFRPGGGVTYGKGPGNEICPLAVVQAWLQ-RGDP  78

Query  288  VSFFPVKP-KGAVRNGTDLNVVFSGS--XTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
            V+F PV P +G VR  TDLN+ F+       C+ S VW++ H  E +    +VL+ G +G
Sbjct  79   VTFTPVNPEEGVVRVSTDLNIKFAEPPIINFCRGSNVWKV-HFNEALK-QHFVLTDGVEG  136

Query  459  NPGSSTARSWFMI  497
            N G  T  +WF I
Sbjct  137  NSGCETTANWFKI  149



>gb|ABX76297.1| stigma expressed protein [Nicotiana alata]
Length=243

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 72/132 (55%), Gaps = 8/132 (6%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAP-KVAGDSVSFF--  299
            VLDT+GK +Q G +Y+++    + GGG+ L +     CP  VVQ       G  V FF  
Sbjct  51   VLDTNGKPLQIGEEYHIISASWRTGGGVYLTNLTNTKCPNDVVQHWEGSKDGMPVKFFTM  110

Query  300  --PVKPKGAVRNGTDLNVVFSGSXTG-CQESTVWQIAHDPENVDV-VQYVLSGGDKGNPG  467
               V P   VR   D+N++FS   T  C   TVW++  DP++ +  V++V++GG  G PG
Sbjct  111  DPEVAPSSVVRETNDINIMFSVPTTKLCVNETVWKVG-DPDSTEQGVRFVVTGGTLGYPG  169

Query  468  SSTARSWFMILK  503
              T +SWF I K
Sbjct  170  PITIKSWFKIEK  181



>emb|CDY26209.1| BnaA06g12080D [Brassica napus]
Length=192

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 72/134 (54%), Gaps = 11/134 (8%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EAA +P  V D DG  + SG KYY++PV   +GGGL ++    +TCPKSV+Q   +V+ G
Sbjct  20   EAALEP--VTDIDGGRLTSGTKYYILPVLRGRGGGLTMSKPENKTCPKSVIQDQYEVSKG  77

Query  282  DSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
              + F P      +R  TDLN  F         ++VW + +  E  +   +V + G  GN
Sbjct  78   LPLEFSPSDNSRIIRVSTDLNFKFCA-------ASVWNLDNYDEMTN-QWFVTACGVAGN  129

Query  462  PGSSTARSWFMILK  503
            PG +T  +WF I K
Sbjct  130  PGQATVDNWFKIEK  143



>ref|XP_009782173.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=252

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 65/126 (52%), Gaps = 4/126 (3%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDSVSFFPVK  308
            VLD  G AV+ G  Y +VP      GGLD++S    T P  V Q     +G  V F PV 
Sbjct  37   VLDVSGNAVRKGANYLIVPAGRGSPGGLDISSIRNTTNPLVVSQNTQNSSGTDVQFIPVN  96

Query  309  PK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTARS  485
            PK   +R  TDLN+ ++ + T    STVW+I  + E +     V  GG +GNPG  T  +
Sbjct  97   PKENTIRISTDLNIKYT-AMTISDSSTVWRI--NTELIPQRYLVTVGGVEGNPGRETLSN  153

Query  486  WFMILK  503
            WF I K
Sbjct  154  WFKIDK  159



>ref|XP_010459406.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 11/135 (8%)
 Frame = +3

Query  108  AAQKPP--AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-  278
            AA + P  AV D +GK +Q+   YY++PV   +GGGL ++    +TCP+SV+Q   +V+ 
Sbjct  20   AATEAPVEAVKDINGKPLQTRFYYYILPVVRGRGGGLTMSKPENKTCPRSVIQDRFEVSQ  79

Query  279  GDSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
            G  VSF P      VR  TD N+ FS        +++W++A+  E      ++ + G +G
Sbjct  80   GLPVSFSPYDKSRIVRVSTDQNIKFS-------PTSIWELANFDEATS-QNFISTCGVEG  131

Query  459  NPGSSTARSWFMILK  503
            NPG +T  +WF I K
Sbjct  132  NPGQTTVDNWFKIDK  146



>ref|NP_173228.1| kunitz family trypsin and protease inhibitor protein [Arabidopsis 
thaliana]
 gb|AAF97266.1|AC034106_9 Contains similarity to a tumor-related protein from Nicotiana 
tabacum gb|U66263 and contains a trypsin and protease inhibitor 
PF|00197 domain. ESTs gb|AV561824, gb|T44961, gb|H36186, 
gb|T45060, gb|N38006, gb|F19847 come from this gene [Arabidopsis 
thaliana]
 gb|AAG48779.1|AF332416_1 putative lemir (miraculin) protein [Arabidopsis thaliana]
 gb|AAK48962.1|AF370535_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK95260.1|AF410274_1 At1g17860/F2H15_8 [Arabidopsis thaliana]
 gb|AAM10091.1| unknown protein [Arabidopsis thaliana]
 gb|AAM19885.1| At1g17860/F2H15_8 [Arabidopsis thaliana]
 gb|AEE29645.1| kunitz type trypsin and protease inhibitor domain-containing 
protein [Arabidopsis thaliana]
Length=196

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 13/135 (10%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EAA +P  V D +GK++ +GV YY++PV   +GGGL +++   ETCP SV+Q   +V+ G
Sbjct  23   EAAVEP--VKDINGKSLLTGVNYYILPVIRGRGGGLTMSNLKTETCPTSVIQDQFEVSQG  80

Query  282  DSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG-GDKG  458
              V F P      +   TD+N+ FS        +++W++A+  E     Q+ +S  G +G
Sbjct  81   LPVKFSPYDKSRTIPVSTDVNIKFS-------PTSIWELANFDETTK--QWFISTCGVEG  131

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  132  NPGQKTVDNWFKIDK  146



>gb|KHM99735.1| Miraculin [Glycine soja]
Length=154

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 62/106 (58%), Gaps = 11/106 (10%)
 Frame = +3

Query  201  GGGLDLASTGKETCPKSVVQVAPKVAGDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQ  377
            GGGL LAS G E+CP  VV V P+  G  + F PV PK G VR  TDLN++FS   T C 
Sbjct  3    GGGLSLASIG-ESCPLDVV-VVPRSHGLPLQFSPVDPKKGVVRVSTDLNIMFSTDHTSCA  60

Query  378  E-STVWQIAHDPENVDVVQ---YVLSGGDKGNPGSSTARSWFMILK  503
            E S VW++ H     DV +   +V +GG  GNP   T R+WF I K
Sbjct  61   EYSPVWKLDH----FDVSKGKWFVSTGGSMGNPSWETIRNWFKIEK  102



>ref|XP_009614755.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=210

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 71/135 (53%), Gaps = 5/135 (4%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            +A   P  VLD  G AV++GV YY++P     GGGL +AS    T P  V Q A + + G
Sbjct  27   KAQDVPDPVLDVSGNAVRTGVNYYILPAGQGNGGGLQVASIRNRTNPLVVSQHADESSIG  86

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              + F PV P +  +   TDLNV F+ S      STVW+I  + E +     V  GG +G
Sbjct  87   GYLQFSPVNPNENIIGISTDLNVKFT-SIHISDSSTVWRI--NTELIPQRYLVTVGGVEG  143

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  144  NPGRETLSNWFRIDK  158



>emb|CDX96746.1| BnaA08g22890D [Brassica napus]
Length=195

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 76/134 (57%), Gaps = 11/134 (8%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EAA +P  V D  G+ +++G KYY++PV   +GGGL ++    +TCP+SV+Q   +V+ G
Sbjct  23   EAAVEP--VTDIYGQRLRTGTKYYILPVFRGRGGGLTMSKAENKTCPRSVIQERFEVSNG  80

Query  282  DSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
              ++F P      +R  TDLN  FS        +++W + +  E  +   ++ + G +GN
Sbjct  81   LPLTFSPSDKSKVIRVSTDLNFKFSA-------TSIWNLDNVDEKTN-QWFIGTCGVEGN  132

Query  462  PGSSTARSWFMILK  503
            PG +T  +WF I K
Sbjct  133  PGRTTVGNWFKIDK  146



>ref|NP_001237333.1| uncharacterized protein LOC100500648 precursor [Glycine max]
 gb|ACU15788.1| unknown [Glycine max]
Length=213

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 72/144 (50%), Gaps = 16/144 (11%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQ---------GGGLDLASTGKETCPKSVVQ  260
            A   P  V+DT GK +++   Y+++P  P           GGGL L S   E+CP  V+ 
Sbjct  24   AGAAPEPVIDTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDSI-DESCPLDVI-  81

Query  261  VAPKVAGDSVSFFPVK-PKGAVRNGTDLNVVFSGSXTGC-QESTVWQIAHDPENVDVVQ-  431
            +     G  + F PV   KG +R  TDLN+ FS S   C   STVW +  D  +  + Q 
Sbjct  82   IEKANEGLPLRFSPVNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWML--DQFDASIGQT  139

Query  432  YVLSGGDKGNPGSSTARSWFMILK  503
            YV +GG  GNPG  T  +WF I K
Sbjct  140  YVTTGGVVGNPGEHTILNWFKIQK  163



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 74/136 (54%), Gaps = 8/136 (6%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQP-KQGGGLDLAS-TGKETCPKSVVQVAPKV-A  278
            A +KP  V+D +G+ ++ GV YYVV V P  +G G+      G E CP +VVQ  P    
Sbjct  20   ATEKPNPVVDFNGEEIRPGVDYYVVSVFPGGRGSGVTYGKGPGNEICPLAVVQARPDFNR  79

Query  279  GDSVSFFPVKP-KGAVRNGTDLNVVFSGS--XTGCQESTVWQIAHDPENVDVVQYVLSGG  449
            G  V+F PV P +  VR  TDLN+ FS       C+ S VW++ H  E +    +VL+ G
Sbjct  80   GHPVTFTPVNPEESVVRVSTDLNIKFSEPPFINFCRGSNVWKV-HFNEALK-QHFVLTDG  137

Query  450  DKGNPGSSTARSWFMI  497
             +GN G  T  +WF I
Sbjct  138  VEGNSGCETEANWFKI  153



>gb|KFK42293.1| hypothetical protein AALP_AA2G237000 [Arabis alpina]
Length=194

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 77/134 (57%), Gaps = 12/134 (9%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EAA +  +V D +G+ ++SG+ YY++PV   +GGGL ++ T  +TC  SV+Q    V+ G
Sbjct  23   EAAVE--SVTDINGQRLRSGINYYILPVVRGRGGGLTISKTHNKTCLNSVIQDRYGVSNG  80

Query  282  DSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             ++ F P      +R  TDLN +FS       ++++W++  D ++     +V + G  GN
Sbjct  81   LALKFSPSDNSKIIRVSTDLNFIFS-------KTSIWKL--DRDDTANQWFVSTCGVAGN  131

Query  462  PGSSTARSWFMILK  503
            PG +T  +WF I K
Sbjct  132  PGRTTVDNWFKIDK  145



>ref|XP_011035408.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 4/134 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A   P  VLD  GK +++G  Y ++PV   +G G+  A TG ++CP  V+Q   + + G 
Sbjct  25   AGAAPEPVLDIAGKVLRTGTYYDILPVVRGRGSGITFAITGHKSCPVDVMQEDYEDSDGL  84

Query  285  SVSFFPV-KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             + F P  + KG +R  TDLN+ F G+ + C  + VW++    E +    ++ + G +GN
Sbjct  85   PLQFIPANRKKGVIRLSTDLNIKFPGTAS-CAPTAVWKVEKYDE-LTGQMFISTSGVEGN  142

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I K
Sbjct  143  PGPETVDNWFKIEK  156



>emb|CDO98552.1| unnamed protein product [Coffea canephora]
Length=205

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 5/135 (4%)
 Frame = +3

Query  102  CEAAQKP-PAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA  278
            C AA +P P VLD  GK +++GV YY++P            +    TCP  V+Q   +  
Sbjct  22   CSAAPEPLPPVLDVAGKLLRAGVNYYILPAIIIGNDIGGGLTLANGTCPPEVIQDNYEFT  81

Query  279  -GDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGD  452
             G  + F P+ P KG VR  +D NV FS S + C +S+VW+++ + + +    +V  GG 
Sbjct  82   DGIPLIFSPLDPKKGIVRVSSDTNVKFS-STSKCAQSSVWKLS-ELDALTGKYFVGIGGV  139

Query  453  KGNPGSSTARSWFMI  497
            +GNPG  T  SWF I
Sbjct  140  EGNPGPKTLSSWFKI  154



>emb|CDO98555.1| unnamed protein product [Coffea canephora]
Length=214

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 74/140 (53%), Gaps = 12/140 (9%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVP----VQPKQGGGLDLASTGKETCPKSVVQ-VAPK  272
            AA+ P  V D  GK +++   YY++P        +GGGL L+  GK TCP +V Q ++ +
Sbjct  28   AAEAPEPVSDVAGKMLRTDRHYYILPAANVFDKFRGGGLTLSGIGKNTCPTAVFQEMSEQ  87

Query  273  VAGDSVSFFPV-KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAH--DPENVDVVQYVLS  443
              G  ++F PV + KG V+  TDLN+ F+   T C +S VW I +   P     V     
Sbjct  88   ENGIPLAFLPVNRKKGVVQVSTDLNIKFAYPQT-CGQSPVWSIDNYVYPSGDSFVNI---  143

Query  444  GGDKGNPGSSTARSWFMILK  503
            GG  GNPG  T  SWF I K
Sbjct  144  GGVVGNPGPKTLSSWFKIEK  163



>emb|CDP18338.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 6/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVP--VQPKQGGGLDLASTGKETCPKSVVQVAPKV-A  278
            AA++P  VLD +G+ ++ GV+Y++V        GG       G + CP +VVQ    +  
Sbjct  20   AAEEPNPVLDINGEEIRPGVEYHIVSAIFGGGGGGVTYGKGPGNQICPLAVVQALSDLNR  79

Query  279  GDSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDK  455
            G  VSF PV P +G VR  TDLN+ FS     C+ S VW++ H  E ++   +VL+ G +
Sbjct  80   GHPVSFTPVNPEEGVVRVSTDLNIKFSPFINFCRGSNVWKV-HFNEALE-QHFVLTDGVE  137

Query  456  GNPGSSTARSWFMI  497
            GN G  T  +WF I
Sbjct  138  GNSGCETEANWFKI  151



>ref|XP_010498164.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (56%), Gaps = 11/135 (8%)
 Frame = +3

Query  108  AAQKPP--AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-  278
            AA + P  AV D +GK +Q+   YY++PV   +GGGL ++    +TCP+SV+Q   +V+ 
Sbjct  20   AATEAPVEAVKDINGKPLQTRFYYYILPVVRGRGGGLTMSKPENKTCPRSVIQDQFEVSH  79

Query  279  GDSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
            G  VSF P      VR  TD N+ FS        +++W++A+  E       + + G +G
Sbjct  80   GLPVSFSPYDRSRIVRVSTDQNIKFS-------PTSIWELANFDEATS-QNLISTCGVEG  131

Query  459  NPGSSTARSWFMILK  503
            NPG +T  +WF I K
Sbjct  132  NPGQTTVDNWFKIDK  146



>ref|XP_010683192.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=211

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 69/129 (53%), Gaps = 7/129 (5%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVSFFP  302
            VLD +G+ +++   YY++PV   +GGGL +A     E+CP  V Q   +V+ G  + FFP
Sbjct  33   VLDINGRPLKTDSTYYILPVSRGRGGGLAMAPKNATESCPLYVAQENHEVSNGLPLKFFP  92

Query  303  VKP--KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSST  476
              P     +  G D+N+VF  + T C + T W +A D       +YV  GG  GNPG  T
Sbjct  93   TNPNDHDKIPLGYDVNIVFDAA-TICVQPTGWMLAFD--EASGTRYVGIGGTIGNPGVDT  149

Query  477  ARSWFMILK  503
              +WF I K
Sbjct  150  LSNWFAIEK  158



>gb|ACO40154.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
             +V+F P       +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LTVTFSPASSDDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>emb|CAI77767.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77778.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77779.1| kunitz trypsin inhibitor [Populus tremula]
Length=215

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AG  281
            EA  +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  V  G
Sbjct  24   EADTEP--VLDIQGEELKAGTEYIITSIFRGAGGG-DVAATNK-TCPDDVIQYSLDVFQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>ref|XP_009110379.1| PREDICTED: miraculin-like [Brassica rapa]
Length=195

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 71/126 (56%), Gaps = 9/126 (7%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFPV  305
            V D  G+ +++G KYY++PV   +GGGL ++    +TCPKSV+Q   +V+ G  ++F P 
Sbjct  29   VTDIYGQRLRTGTKYYILPVVRGRGGGLTMSKAENKTCPKSVIQERFEVSNGMPLTFSPS  88

Query  306  KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTARS  485
                 +R  TDLN  FS        ++VW + +  E  +   ++ + G +GNPG +T  +
Sbjct  89   DKSKVIRVSTDLNFKFSA-------TSVWNLDNVDEKTN-QWFIGTCGVEGNPGRTTVGN  140

Query  486  WFMILK  503
            WF I K
Sbjct  141  WFKIDK  146



>ref|XP_003534100.1| PREDICTED: miraculin-like [Glycine max]
 gb|KHM99733.1| Miraculin [Glycine soja]
Length=216

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 74/145 (51%), Gaps = 23/145 (16%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVP----------VQPKQGGGLDLASTGKETCPKSVVQVAP  269
            P AV+DT G  +Q G+ YYVVP           +     GL LAS G E+CP  VV V  
Sbjct  27   PEAVIDTSGTELQPGLSYYVVPAMRSFTRCGKFECLNAEGLSLASIG-ESCPLDVV-VEQ  84

Query  270  KVAGDSVSFFPVKP-KGAVRNGTDLNVVFSGSXT--GCQE-STVWQIAHDPENVDVVQ--  431
            +  G  +SF P+   +  VR  TDLN++F    T   C E S VW++ H     DV +  
Sbjct  85   RSFGLPLSFSPLDTNESVVRVSTDLNIMFCTDRTSYSCAEYSPVWKLDH----FDVSKGK  140

Query  432  -YVLSGGDKGNPGSSTARSWFMILK  503
             +V +GG  GNP   T R+WF I K
Sbjct  141  WFVTTGGSMGNPSWETIRNWFKIEK  165



>emb|CAI77771.1| kunitz trypsin inhibitor [Populus tremula]
Length=215

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-AG  281
            EA  +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  V  G
Sbjct  24   EADTEP--VLDIQGEELKAGTEYIITSIFRGAGGG-DVAATNK-TCPDDVIQYSLDVFQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>ref|XP_002890252.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66511.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=196

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 74/133 (56%), Gaps = 13/133 (10%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EAA +P  V D +GK + +   YY++PV   +GGGL +++   ETCP+SV+Q   +V+ G
Sbjct  23   EAAVEP--VKDINGKPLLTKYNYYILPVVRGRGGGLTMSNFKNETCPRSVIQDQFEVSQG  80

Query  282  DSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG-GDKG  458
              V F P      VR  TD N+ FS        +++W++A+  E     Q+ +S  G +G
Sbjct  81   LPVKFSPYDKSRIVRVSTDQNIKFS-------PTSIWELANFDERTS--QWFISTCGVEG  131

Query  459  NPGSSTARSWFMI  497
            NPG  T  +WF I
Sbjct  132  NPGQKTVGNWFKI  144



>ref|XP_009782174.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=208

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 11/138 (8%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            +A   P  VLD  G AV++GV YY++P     GGGL +AS    T P  V Q A + + G
Sbjct  27   KAQDVPEPVLDVSGNAVRTGVNYYILPAGRGNGGGLQVASIRNRTNPLVVSQHADESSIG  86

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVV--QYVLS-GG  449
              + F P  P +  +   TDLNV F+ S      STVW+I     N +++  +Y+++ GG
Sbjct  87   GYLQFSPANPNENIIGISTDLNVKFT-SIHISDSSTVWRI-----NTEIIPQRYLVTVGG  140

Query  450  DKGNPGSSTARSWFMILK  503
             +GNPG  T  +WF I K
Sbjct  141  VEGNPGRETLSNWFKIDK  158



>gb|KFK42292.1| hypothetical protein AALP_AA2G236900 [Arabis alpina]
Length=194

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 69/127 (54%), Gaps = 10/127 (8%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFP  302
            +V D +G+ +Q+   YY++PV   +GGGL ++ T  +TCP +V+Q   +V+ G  + F P
Sbjct  28   SVTDINGRPLQTDTAYYILPVVRGRGGGLTISKTHNKTCPNNVIQDRYEVSNGLPLKFSP  87

Query  303  VKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTAR  482
                  +R   DLN +FS        +++W++  D +     ++V + G  GNPG  T  
Sbjct  88   ADSSKIIRVSADLNFIFS-------PTSIWKL--DSDETTNQRFVSTCGRAGNPGRETVS  138

Query  483  SWFMILK  503
            +WF I K
Sbjct  139  NWFRIDK  145



>ref|XP_010683390.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=224

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 6/129 (5%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKET-CPKSVVQVAPKV-AGDSVSFF  299
            +VLDT+G+ +++  +YY++P    QGGG+ ++   + T CP  V Q + ++  G SV F 
Sbjct  28   SVLDTEGRPLRAKSRYYILPASQGQGGGITVSQKNQTTLCPLYVSQESQEIYLGLSVWFL  87

Query  300  PVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSST  476
            P K  +  +   +D+N++F+     C +S  W+++ D  +    +YV +GG  GNPG  T
Sbjct  88   PSKHNQRLIYISSDINILFNMVNI-CLQSAAWKLSID--HTTWRKYVATGGAIGNPGEET  144

Query  477  ARSWFMILK  503
              SWF I K
Sbjct  145  VSSWFKIEK  153



>gb|ACO40082.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40094.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40118.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40124.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40128.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40146.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>gb|ACO40073.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40075.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40076.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40079.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40085.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40087.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40088.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40089.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40092.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40095.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40096.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40097.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40098.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40099.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40102.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40103.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40107.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40109.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40111.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40112.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40113.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40114.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40121.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40122.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40125.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40126.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40129.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40131.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40134.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40135.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40136.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40137.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40147.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40152.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40160.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40162.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40164.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>emb|CAI77774.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77775.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77765.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77792.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77796.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77797.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77801.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77768.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+++T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVSATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V + V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQRLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77783.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77784.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77788.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77789.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77804.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77805.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77764.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77793.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77770.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77786.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77769.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77787.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>gb|ACO40104.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40105.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40106.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40110.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40139.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40140.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40159.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40161.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40163.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
             +V+F P       +R  TDLN+ FS     C  S+VW+I     N  V  +V +GG++G
Sbjct  65   LTVTFSPASSDDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSKVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>emb|CAI77777.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77773.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77782.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77794.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>ref|XP_002305033.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|EEE85544.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92484.1| Kunitz-type protease inhibitor KPI-D1.2 [Populus trichocarpa]
 gb|ADW95379.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=212

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  24   EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGVHTLTNWFKIEK  152



>gb|AEK26926.1| Kunitz-type trypsin inhibitor B1 [Populus nigra]
Length=212

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  24   EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGVHTLTNWFKIEK  152



>gb|ACO40086.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40141.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40149.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40150.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40151.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACVHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>gb|ACO40077.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40090.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40115.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40116.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40120.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40132.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40156.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P       +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSDDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>emb|CAI77766.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFINWFKIEK  152



>gb|ACO40080.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=180

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 77/135 (57%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAP-KVAG  281
            EA  +P  VLD  G+ +++G +Y +  +     GG D+++T K TCP  V++ +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSIFWGARGG-DVSATNK-TCPDDVIKYSSDRLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N++V  +V +GG++G
Sbjct  65   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNLEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGIDTLTNWFKIEK  137



>ref|XP_010540187.1| PREDICTED: bark lectin isoform 2-like [Tarenaya hassleriana]
Length=213

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 69/130 (53%), Gaps = 11/130 (8%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTG---KETCPKSVVQV-APKVAGDSVSF  296
            VLDT G  V++GV+YY++P +   GGGL  +S     ++ CP  VVQ   P + G  V+F
Sbjct  27   VLDTSGNPVEAGVQYYIIPAKSGNGGGLVPSSRTFNPQQLCPLDVVQSPLPFIPGLPVTF  86

Query  297  FPVKPKGAVRN-GTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSS  473
              +     V    T+LNV F  +   C E+ VW+   D EN D   Y+ +GG+ G P   
Sbjct  87   TVLNSADNVLQLNTNLNVQFESTVWLCPETKVWK-GEDFENTDEYAYISTGGEIGGP---  142

Query  474  TARSWFMILK  503
               SWF +LK
Sbjct  143  --NSWFRVLK  150



>emb|CAI77798.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77799.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77806.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77807.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+++T K TCP  V+Q +  +  G
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVSATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>ref|XP_006304577.1| hypothetical protein CARUB_v10011616mg [Capsella rubella]
 gb|EOA37475.1| hypothetical protein CARUB_v10011616mg [Capsella rubella]
Length=195

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFP  302
            AV D +GK + +G  YY++PV   +GGGL ++    +TC  SV+Q   +V+ G  + F P
Sbjct  28   AVKDINGKPLLAGYNYYILPVVRGRGGGLTMSKPENKTCRTSVIQARFEVSQGLPLKFSP  87

Query  303  VKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTAR  482
                  VR  TD N+ FS       ++++W++A+  E      ++ + G +GNPG +T  
Sbjct  88   FDKSRIVRVSTDQNIKFS-------QTSIWELANFDETTS-QSFISTCGVEGNPGLTTVS  139

Query  483  SWFMILK  503
            +WF I K
Sbjct  140  NWFKIDK  146



>emb|CDP21726.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 72/134 (54%), Gaps = 6/134 (4%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYV--VPVQPKQGGGLDLASTGKETCPKSVVQVAPKV-A  278
            A ++P  VLD +G+ ++ GV+Y++         GG       G E CP +VVQ    V  
Sbjct  20   ATEEPNPVLDINGEEIRPGVEYHIESAIFGGGGGGVTYGKGPGNEICPLAVVQALSDVNR  79

Query  279  GDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDK  455
            G  V+F PV P+ G +R  TDLN+ FS     C+ S VW++ H  E ++   +VL+ G +
Sbjct  80   GHPVTFTPVNPEEGVIRVSTDLNIKFSPFINFCRGSNVWKV-HFNEALE-QHFVLTDGVE  137

Query  456  GNPGSSTARSWFMI  497
            GN G  T  +WF I
Sbjct  138  GNSGCETEANWFKI  151



>ref|XP_004515058.1| PREDICTED: miraculin-like [Cicer arietinum]
Length=196

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 69/133 (52%), Gaps = 11/133 (8%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            A   P  VLDT GK ++    YY++P     GG +DL + G E+CP  VV V     G  
Sbjct  24   AKASPDHVLDTSGKKLRVDADYYIIPA---NGGFIDLETNG-ESCPLHVV-VDKHSQGLP  78

Query  288  VSFFPVKPKGAVRNGTDLNVVFSGSXTGC-QESTVWQIAHDPENVDVVQYVLSGGDKGNP  464
            + F P+  KG +R   DLN++ +   + C   S VW+I  DP + +   +V  GG  G P
Sbjct  79   LRFAPI--KGVIRVSIDLNIMLANYDSRCPHHSIVWKI--DPSSKE-ETFVTLGGVLGYP  133

Query  465  GSSTARSWFMILK  503
             S T +SWF I K
Sbjct  134  SSKTIQSWFKIEK  146



>gb|ACO40133.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P       +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSDDDVIRVSTDLNIKFS-IKKACVHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>emb|CAI77785.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 72/128 (56%), Gaps = 6/128 (5%)
 Frame = +3

Query  126  AVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVSFFP  302
            +VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +  G  V+F P
Sbjct  29   SVLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQGLPVTFSP  86

Query  303  VKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTA  479
               +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++GNPG  T 
Sbjct  87   ASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEGNPGCDTF  144

Query  480  RSWFMILK  503
             +WF I K
Sbjct  145  TNWFKIEK  152



>gb|AAQ84217.1| Kunitz trypsin inhibitor 4 [Populus trichocarpa x Populus deltoides]
 gb|ACS92488.1| Kunitz-type protease inhibitor KPI-D10.2 [Populus trichocarpa 
x Populus deltoides]
Length=212

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA  +P  VLD  G+ +++G +Y +  +    GGG D+++T K TCP  V+Q +  +  G
Sbjct  24   EAYTEP--VLDIQGEELKAGTEYIIGSIFFGAGGG-DVSATNK-TCPDDVIQYSSDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P       +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  80   LPVTFSPASSDDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGIDTLTNWFKIEK  152



>gb|KHM99732.1| Miraculin [Glycine soja]
Length=207

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 68/135 (50%), Gaps = 16/135 (12%)
 Frame = +3

Query  135  DTDGKAVQSGVKYYVVPVQPKQ---------GGGLDLASTGKETCPKSVVQVAPKVAGDS  287
            DT GK +++   Y+++P  P           GGGL L S   E+CP  V+ +     G  
Sbjct  27   DTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDSI-DESCPLDVI-IEKANEGLP  84

Query  288  VSFFPVK-PKGAVRNGTDLNVVFSGSXTGC-QESTVWQIAHDPENVDVVQ-YVLSGGDKG  458
            + F PV   KG +R  TDLN+ FS S   C   STVW +  D  +  + Q YV +GG  G
Sbjct  85   LRFSPVNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWML--DQFDASIGQTYVTTGGVVG  142

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  143  NPGEHTILNWFKIQK  157



>gb|ACO40153.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P       +R  TDLN+ FS     C  S+VW+I     N  V  +V +GG++G
Sbjct  65   LPVTFSPASSDDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSKVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>gb|ACO40093.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40143.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R   DLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSEDDVIRVSADLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>gb|ACO40119.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40127.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40130.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40142.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40157.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R   DLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSEDDVIRVSADLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>gb|ACO40144.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40158.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ F      C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSEDDVIRVSTDLNIKFY-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>emb|CDO98560.1| unnamed protein product [Coffea canephora]
Length=214

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 11/143 (8%)
 Frame = +3

Query  102  CEAAQ---KPPAVLDTDGKAVQSGVKYYVVPVQPK---QGGGLDLASTGKETCPKSVVQV  263
            C+AA    +P AV   DGK V++ + YY+ P   +   +GGGL L S G ++CP  V+Q 
Sbjct  22   CQAAAESVQPAAVFGVDGKEVRTDLFYYIRPANNRGKDRGGGLGLRSIGNDSCPLVVIQE  81

Query  264  APKVA-GDSVSFFP-VKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQY  434
              ++  G  ++F P V PK   VR  TDLN+  +   T C + TVW++    ++ +  ++
Sbjct  82   TNELRDGLPLTFSPAVAPKDNVVRVSTDLNIQVAFPDT-CNQPTVWRVDVSDKS-EGRKF  139

Query  435  VLSGGDKGNPGSSTARSWFMILK  503
            V  GG  GNPG  T  +WF I K
Sbjct  140  VNLGGVIGNPGPETLGNWFKIEK  162



>gb|ACO40074.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40083.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40091.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40101.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40108.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40117.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40123.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40138.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40148.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
 gb|ACO40155.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ F      C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSEDDVIRVSTDLNIKFY-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>ref|XP_006347377.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=210

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 77/131 (59%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKE--TCPKSVVQVAPKV-AGDSVSFF  299
            VLD +G  VQ+G  Y+++PV   +GGGL  ++  +   TCP+ +VQ   +V  G  V F 
Sbjct  34   VLDINGDKVQAGPNYFILPVIRGKGGGLYPSNVKQHNSTCPRDIVQETDEVQQGLPVVFT  93

Query  300  PVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQI-AHDPENVDVVQY-VLSGGDKGNPGS  470
             +   KG VR  TD+NV F  + T C   T+W++ A+D +   + QY V++GG +GNPG 
Sbjct  94   RLDAKKGVVRVSTDVNVRFY-TPTICARETIWKLGAYDDK---LKQYFVVTGGVEGNPGP  149

Query  471  STARSWFMILK  503
             T  +WF I K
Sbjct  150  QTVGNWFKIEK  160



>emb|CAI77772.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77776.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77780.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77781.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77791.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77802.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA  +P  VLD  G+ +++G +Y +  +    GGG D+++T K TCP  V+Q +  +  G
Sbjct  24   EANTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVSATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>ref|XP_003620187.1| Miraculin [Medicago truncatula]
 gb|AES76405.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=212

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 74/145 (51%), Gaps = 18/145 (12%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQP---------KQGGGLDLASTGKETCPKSVVQ  260
            A   P  V+DT GK +++   YY++P +P            GG+ L + G E+CP  VV 
Sbjct  23   AEASPDQVIDTSGKKLRADTNYYIIPAKPFTTCGFVSCFNSGGIALETVG-ESCPLDVV-  80

Query  261  VAPKVAGDSVSFFPV-KPKGAVRNGTDLNVVFSGSX--TGC-QESTVWQIAHDPENVDVV  428
            V     G  + F PV   KG VR  TDLN+ FS     + C   S VW+I  DP + +  
Sbjct  81   VVKHNQGLPLRFTPVNNKKGVVRVSTDLNIKFSNDAYDSRCPNHSLVWKI--DPFSKEET  138

Query  429  QYVLSGGDKGNPGSSTARSWFMILK  503
             +V + G  GNPGS+T  +WF I K
Sbjct  139  -FVTTNGVLGNPGSNTIHNWFQIEK  162



>gb|ACO40084.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VL+  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLEIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P       +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSDDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>dbj|BAA82842.1| miraculin homologue [Taraxacum officinale]
Length=136

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 58/104 (56%), Gaps = 7/104 (7%)
 Frame = +3

Query  198  QGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTG  371
            +GGG+ LA T  E CP  VVQ   ++  G  ++F PV PK G +R  TDLN++FS S   
Sbjct  4    RGGGVTLAPTRTELCPLDVVQANQELDNGLPLTFTPVDPKKGVIRESTDLNIIFSASSI-  62

Query  372  CQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTARSWFMILK  503
            C +S VW I    E  D    V + G +GNPG  T  +WF I K
Sbjct  63   CIQSNVWMI----EEYDGSLIVSAHGVQGNPGQETLSNWFKIEK  102



>emb|CAI77790.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA  +P  VLD  G+ +++G +Y +  +    GGG D+++T K TCP  V+Q +  +  G
Sbjct  24   EANTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVSATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77795.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA  +P  VLD  G+ +++G +Y +  +    GGG D+++T K TCP  V+Q +  +  G
Sbjct  24   EANTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVSATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>emb|CAI77803.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA  +P  VLD  G+ +++G +Y +  +    GGG D+++T K TCP  V+Q +  +  G
Sbjct  24   EANTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVSATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>gb|ACO40078.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=180

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAP-KVAG  281
            EA  +P  VLD  G+ +++G +Y +  +     GG D+++T K TCP  V++ +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSIFWGARGG-DVSATNK-TCPDDVIKYSSDRLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGIDTLTNWFKIEK  137



>gb|ACO40145.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 74/135 (55%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P       +R   DLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSDDDVIRVSADLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>ref|XP_006477858.1| PREDICTED: 21 kDa seed protein-like isoform X1 [Citrus sinensis]
 ref|XP_006477859.1| PREDICTED: 21 kDa seed protein-like isoform X2 [Citrus sinensis]
Length=213

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 66/127 (52%), Gaps = 6/127 (5%)
 Frame = +3

Query  120  PPAVLDTDGKAVQSGVKYYVVP-VQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GDSVS  293
            P  ++D +G  V++   YYVV  +    GGGL L     E CP  V+Q++  +  G  + 
Sbjct  25   PDPLVDVNGNEVEASRDYYVVSLISGAGGGGLTLFRGRNELCPLDVIQLSSDLRRGTRLR  84

Query  294  FFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQI-AHDPENVDVVQYVLSGGDKGNPGS  470
            F        +    DLNV FS + T C E TVW++  +DP       ++ +GG +GNPG+
Sbjct  85   FATYNNTRIIHENVDLNVRFS-TATRCNEPTVWKVDNYDPSRGK--WFITTGGIEGNPGA  141

Query  471  STARSWF  491
             T ++WF
Sbjct  142  QTLKNWF  148



>gb|ABK96521.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ACS92517.1| Kunitz-type protease inhibitor KPI-D11 [Populus trichocarpa x 
Populus deltoides]
Length=212

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  +  G
Sbjct  24   EAYTEP--VLDIQGEQLKAGTEYIISSAIWGAGGG-DVSATNK-TCPDDVIQYSLDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKDCDHSSVWKI-QKSSNSEVQWFVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGVHTITNWFKIEK  152



>gb|ACS92519.1| Kunitz-type protease inhibitor KPI-D8 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA  +P  VLD  G+ +++G +Y +  +     GG D+++T K TCP  V+Q +  +  G
Sbjct  24   EAYTEP--VLDIQGEELKAGTEYIITSIFWGALGG-DVSATNK-TCPDDVIQYSSDLLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  80   LPVTFSPASSEDDIIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGIDTLTNWFKIEK  152



>gb|ACO40100.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGREYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ F      C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSEDDVIRVSTDLNIKFY-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>gb|AFK34345.1| unknown [Medicago truncatula]
Length=212

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 74/145 (51%), Gaps = 18/145 (12%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQP---------KQGGGLDLASTGKETCPKSVVQ  260
            A   P  V+DT GK +++   YY++P +P            GG+ L + G E+CP  VV 
Sbjct  23   AEASPDQVIDTSGKKLRADTNYYIIPAKPFTTCGFVSCFNSGGIALETVG-ESCPLDVV-  80

Query  261  VAPKVAGDSVSFFPV-KPKGAVRNGTDLNVVFSGSX--TGC-QESTVWQIAHDPENVDVV  428
            V     G  + F PV   KGAVR  TDLN+ FS     + C   S VW+I  DP + +  
Sbjct  81   VVKHNQGLPLRFTPVNNKKGAVRVSTDLNIKFSNDAYDSRCPNHSLVWKI--DPFSKEET  138

Query  429  QYVLSGGDKGNPGSSTARSWFMILK  503
             +V + G  GNPG +T  +WF I K
Sbjct  139  -FVTTNGVLGNPGFNTIHNWFQIEK  162



>ref|XP_003622420.1| Endopeptidase inhibitor [Medicago truncatula]
 gb|AES78638.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
Length=205

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 74/140 (53%), Gaps = 15/140 (11%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTG-KETCPKSVVQVAPKVAG  281
            + A++P  V DT G  V++ + Y+++P   + G   ++A     +TCP  VV+    +  
Sbjct  21   QGAEQPEEVRDTSGNLVRNSINYFILPSSIQCGTRCEMALLNTNKTCPLDVVEEEEAM--  78

Query  282  DSVSFFPVK-PKGAVRNGTDLNVVFSGSXTGCQES--TVWQIAHDPENVDVV---QYVLS  443
               SF P    KG +R  TDLNV+ S   T C  S  TVW++    + VDV    ++V +
Sbjct  79   -QFSFVPFNFKKGVIRVSTDLNVIHSFP-TNCSTSSVTVWKV----DKVDVATSQRFVTT  132

Query  444  GGDKGNPGSSTARSWFMILK  503
            GG +GNPG  T  +WF I +
Sbjct  133  GGVQGNPGRETVDNWFKIER  152



>emb|CAI77800.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAG-  281
            EA+ +P  VLD  G+ +++G +Y +  +    GGG D+A+T K TCP  V+Q +  +   
Sbjct  24   EASTEP--VLDIQGEELKAGTEYIISSIFWGAGGG-DVAATNK-TCPDDVIQYSLDLLQV  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V   V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDRSSVWKI-QKSSNSEVQWLVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGCDTFTNWFKIEK  152



>gb|ACS92500.1| Kunitz-type protease inhibitor KPI-D9 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAP-KVAG  281
            EA  +P  VLD  G+ +++G +Y +  +     GG D+++T K TCP  V++ +  ++ G
Sbjct  24   EAYTEP--VLDIQGEELKAGTEYIISSIFWGARGG-DVSATNK-TCPDDVIKYSSDRLQG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGIDTLTNWFKIEK  152



>gb|ABX76298.1| sexual organ expressed protein [Nicotiana alata]
Length=242

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 67/130 (52%), Gaps = 5/130 (4%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVV-PVQPKQGGGLDLASTGKETCPKSVVQVAP-KVAGDSVSFFP  302
            VLD +G+ +  G +Y+++  ++   GGG+ L   G   CP  V+Q     + G  V F  
Sbjct  53   VLDINGEPLHVGEEYHIISAIRGAGGGGVYLTYVGNTKCPNGVLQHGTDTLPGMPVKFVT  112

Query  303  V--KPKGAVRNGTDLNVVFSGSXTG-CQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSS  473
               +P   VR  TD+N++FS + T  C   TVW++          ++V++GG  GNPG  
Sbjct  113  THSRPFNVVRENTDINIMFSVATTRLCVNQTVWKVGDPDLTARGTRFVVTGGTLGNPGPE  172

Query  474  TARSWFMILK  503
            T  +WF I K
Sbjct  173  TINNWFKIEK  182



>ref|XP_010279489.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=208

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 68/134 (51%), Gaps = 4/134 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A  +P AVLDT G+ + S   YY++P      GGL+  ST   TCP  V+Q   + + G 
Sbjct  26   AQDEPEAVLDTMGRQLYSTATYYILPANSGMAGGLNFESTQNGTCPFVVIQDEDQESDGL  85

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             +SF PV P +  +   TD N+ F+   T   + TVW +    E+ +    V + G  GN
Sbjct  86   PLSFSPVNPTEEIIHVSTDHNIRFA-IETSLPQPTVWSLEGLDESTNTFS-VDTCGSIGN  143

Query  462  PGSSTARSWFMILK  503
            PG  T  +WF I +
Sbjct  144  PGRGTLSNWFTIER  157



>ref|XP_011035403.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  +  G
Sbjct  24   EAYTEP--VLDIQGEELKAGAEYIISSAIWGAGGG-DVSATNK-TCPDDVIQYSLDLLRG  79

Query  282  DSVSFFPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P       +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG++G
Sbjct  80   LPVTFSPANYGDDVIRISTDLNIKFS-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGVDTLTNWFKIEK  152



>ref|XP_009614754.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=251

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 62/126 (49%), Gaps = 4/126 (3%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDSVSFFPVK  308
            VLD  G +V+ G  Y +VP      GGLD+AS    T    V Q     +G  + F PV 
Sbjct  36   VLDVSGNSVRKGANYLIVPAGRGNSGGLDVASIRNTTNLLVVSQNTQNSSGTYLQFSPVN  95

Query  309  PK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTARS  485
            PK   +R  TDLN+ ++        STVW+I  + E +     V  GG +GNPG  T  +
Sbjct  96   PKENNIRTSTDLNIKYTAMIIS-DLSTVWRI--NTELIPQRNLVTVGGVEGNPGRETLSN  152

Query  486  WFMILK  503
            WF I K
Sbjct  153  WFKIDK  158



>gb|ACS37303.1| trypsin inhibitor [Murraya koenigii]
 gb|ACS37304.1| trypsin inhibitor [Murraya koenigii]
Length=215

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 6/130 (5%)
 Frame = +3

Query  117  KPPAVLDTDGKAVQSGVKYYVVPV-QPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSV  290
            +P  +LD +G  V++   YY+V V     GGGL L     E CP  V+Q++P +  G  +
Sbjct  24   RPDPLLDINGNVVEASRDYYLVSVIGGAGGGGLTLYRGRNELCPLDVIQLSPDLHKGTRL  83

Query  291  SFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQI-AHDPENVDVVQYVLSGGDKGNPG  467
             F        +    DLNV FS + T C E TVW++  +DP       ++ +GG +GNPG
Sbjct  84   RFAAYNNTSIIHEAVDLNVKFS-TETSCNEPTVWRVDNYDPSRGK--WFITTGGVEGNPG  140

Query  468  SSTARSWFMI  497
            + T ++WF +
Sbjct  141  AQTLKNWFKL  150



>ref|XP_009406658.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=200

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 68/132 (52%), Gaps = 8/132 (6%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAGD  284
            +A +P  V DTDG  +Q GV YY+ P     GGGL L +    +CP SV   + P   G 
Sbjct  23   SADEP--VRDTDGNVLQRGVDYYIRPTVTDIGGGLTLEARNG-SCPLSVALASLPADNGL  79

Query  285  SVSFFPV-KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             + F P       V   TD NV+FS + T C +STVW++  D    +   YV+ GG  GN
Sbjct  80   PLQFSPEDDDDDTVELSTDTNVIFS-AFTTCLQSTVWKLELD--EGEGRYYVVIGGVAGN  136

Query  462  PGSSTARSWFMI  497
            PG  T  +WF I
Sbjct  137  PGKETLSNWFKI  148



>ref|XP_004241480.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=211

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 77/131 (59%), Gaps = 10/131 (8%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKE--TCPKSVVQVAPKV-AGDSVSFF  299
            VLD +G  V++G  Y+++PV   +GGGL  ++  +   TCP+ ++Q    V  G  V F 
Sbjct  35   VLDINGDKVKAGPNYFILPVIQGKGGGLYPSNVKQHNSTCPRDIIQETDDVQEGLPVVFT  94

Query  300  PVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQI-AHDPENVDVVQY-VLSGGDKGNPGS  470
             +  K G VR  TD+NV F  + T C   T+W++ A+D +   + QY V++GG +GNPG 
Sbjct  95   RLDAKKGVVRVSTDVNVRFF-TPTICARETIWKLGAYDDK---LKQYFVVTGGVEGNPGP  150

Query  471  STARSWFMILK  503
             T  +WF I+K
Sbjct  151  KTVGNWFKIVK  161



>ref|XP_003548289.1| PREDICTED: miraculin-like [Glycine max]
Length=201

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 7/127 (6%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKET-CPKSVVQVAPKVAGDSVSFFPV  305
            VLD  GK V++   YY+VP     GG   LAS   +  CP  VV V   + G  +SF PV
Sbjct  27   VLDALGKKVRADSIYYIVPASSDIGG---LASARTDVDCPLDVVAVDGDL-GLPLSFTPV  82

Query  306  K-PKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSSTAR  482
               KG +R  +DLN+ F+     C ++TVW++ +  ++     +V +GG+ G+P S T  
Sbjct  83   NDKKGIIRVSSDLNIYFTSYTIFCPQTTVWKLKYYDDSTS-QWFVTTGGELGHPSSQTVA  141

Query  483  SWFMILK  503
            +WF I K
Sbjct  142  NWFKIEK  148



>ref|XP_010279488.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=208

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 68/132 (52%), Gaps = 4/132 (3%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-GD  284
            A  +P AVLDT G+ + S   Y+++P     GGGL+  ST   TCP  VVQ   + + G 
Sbjct  26   AQDEPEAVLDTMGRQLCSTATYFILPAISGMGGGLNFESTKNGTCPFDVVQDEDEESNGL  85

Query  285  SVSFFPVKPKGA-VRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGN  461
             ++F PV PK   +R  TD N+ F+   T   + TVW +    E+      V + G  GN
Sbjct  86   PLAFSPVNPKEEIIRVLTDQNIRFA-IDTLLPQPTVWNLGDFNESARTF-LVETCGSIGN  143

Query  462  PGSSTARSWFMI  497
            PG  T  +WF I
Sbjct  144  PGIETLSNWFRI  155



>ref|XP_003620174.1| Pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AES76392.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=213

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 69/136 (51%), Gaps = 14/136 (10%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGG---------GLDLASTGKETCPKSVVQVAPKVAG  281
            V+DT GK +++   YY++PV   + G              ++  +TCP  VV V  +   
Sbjct  31   VVDTLGKKLRADANYYIIPVPIYKCGPYGKCRSSGSSLALASNGKTCPLDVV-VVDRYQA  89

Query  282  DSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLS-GGDK  455
              ++F PV PK G +R  TDLN+ FS   T    S VW++  D  NV   Q+ ++ GG  
Sbjct  90   LPLTFIPVNPKKGVIRVSTDLNIKFSSRATCLHHSMVWKL--DRFNVSKRQWFITIGGVA  147

Query  456  GNPGSSTARSWFMILK  503
            GNPG  T  +WF I K
Sbjct  148  GNPGWETINNWFKIEK  163



>emb|CDP19138.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPV--QPKQGGGLDLASTGKETCPKSVVQV-APKVA  278
            AA++P  VLD +G+ ++ GV+Y+VV +      GG       G E CP +VVQ  + +  
Sbjct  20   AAEEPNPVLDINGEEIRPGVEYHVVSLFWGAGGGGVTYGKGPGNEICPLAVVQEPSDRNR  79

Query  279  GDSVSFFPVKP-KGAVRNGTDLNVVFSGS--XTGCQESTVWQIAHDPENVDVVQYVLSGG  449
            G  V+F PV P +G VR  TDLN+ F+       C+ S VW++ H  E ++   +VL+ G
Sbjct  80   GHPVTFTPVNPEEGVVRVSTDLNIKFAEPPIINFCRGSNVWKV-HFNEALE-QHFVLTDG  137

Query  450  DKGNPGSSTARSWFMI  497
             +GN G  T  +WF I
Sbjct  138  VEGNSGCETEANWFKI  153



>gb|ACO40081.1| kunitz trypsin inhibitor 4, partial [Populus balsamifera]
Length=181

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 74/135 (55%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVA-PKVAG  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  ++ G
Sbjct  9    EAYTEP--VLDIQGEELKAGTEYIITSAIWGAGGG-DVSATNK-TCPDDVIQYSLDQLQG  64

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P   +   +R   DLN+ F      C  S+VW+I     N +V  +V +GG++G
Sbjct  65   LPVTFSPASSEDDVIRVSADLNIKFY-IKKACDHSSVWKI-QKSSNSEVQWFVTTGGEEG  122

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  123  NPGVHTLTNWFKIEK  137



>ref|XP_006441460.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
 gb|ESR54700.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
Length=153

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 61/108 (56%), Gaps = 11/108 (10%)
 Frame = +3

Query  198  QGGGLDLA-STGKETCPKSVVQVAPKVA-GDSVSFFPVKPK-GAVRNGTDLNVVFSGSXT  368
            +GGGL LA  +  +TCP  VVQ       G  V+F PV PK G VR  TDLN+ F  + T
Sbjct  2    RGGGLTLAGRSNNKTCPLDVVQEQHSFKNGFPVTFSPVNPKKGVVRESTDLNIKFDAA-T  60

Query  369  GCQESTVWQIAHDPENVDVV---QYVLSGGDKGNPGSSTARSWFMILK  503
             C +STVW++    +N D       V +GG +GNPG  T R+WF I K
Sbjct  61   SCAQSTVWKL----DNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEK  104



>ref|XP_003620175.1| Pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AAT45389.1| pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AES76393.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=213

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 72/137 (53%), Gaps = 16/137 (12%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQGG----------GLDLASTGKETCPKSVVQVAPKVA  278
            V+DT GK +++   YY++PV   + G           L LAS GK TCP  VV V  +  
Sbjct  31   VVDTLGKKLRADANYYIIPVPIYKCGPYGKCRSSGSSLALASIGK-TCPLDVV-VVDRYQ  88

Query  279  GDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLS-GGD  452
               ++F PV PK G +R  TDLN+ FS   T    S VW++  D  NV   Q+ ++ GG 
Sbjct  89   ALPLTFIPVNPKKGVIRVSTDLNIKFSSRATCLHHSMVWKL--DRFNVSKRQWFITIGGV  146

Query  453  KGNPGSSTARSWFMILK  503
             GNPG  T  +WF I K
Sbjct  147  AGNPGWETINNWFKIEK  163



>ref|XP_011035402.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 8/135 (6%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKETCPKSVVQVAPKVA-G  281
            EA  +P  VLD  G+ +++G +Y +       GGG D+++T K TCP  V+Q +  +  G
Sbjct  24   EAYTEP--VLDIQGEELKAGAEYIISSAIWGAGGG-DVSATNK-TCPDDVIQYSLDLLRG  79

Query  282  DSVSFFPVKPKG-AVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKG  458
              V+F P       +R  TDLN+ FS     C  S+VW+I     N +V  +V +GG +G
Sbjct  80   LPVTFSPASSDDDVIRVSTDLNIKFS-IEKACDHSSVWKI-QKSSNSEVQWFVTTGGAEG  137

Query  459  NPGSSTARSWFMILK  503
            NPG  T  +WF I K
Sbjct  138  NPGVDTLFNWFKIEK  152



>ref|XP_006442410.1| hypothetical protein CICLE_v10022211mg [Citrus clementina]
 gb|ABL67650.1| putative miraculin-like protein 2 [Citrus hybrid cultivar]
 gb|ESR55650.1| hypothetical protein CICLE_v10022211mg [Citrus clementina]
Length=213

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 6/124 (5%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVV-PVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDSVSFFPV  305
            ++D +G  V++   YY+V  ++   GGGL L     E CP  VVQ++      +   F +
Sbjct  28   LVDVNGNKVEASRDYYLVSAIRGAGGGGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSM  87

Query  306  KPKGAVRN-GTDLNVVFSGSXTGCQESTVWQI-AHDPENVDVVQYVLSGGDKGNPGSSTA  479
              K ++ N   DLNV FS + T C E TVW++ ++DP       ++ +GG +GNPG+ T 
Sbjct  88   SDKTSIINEDVDLNVRFS-TETRCNEPTVWRVDSYDPSRGK--WFITTGGVEGNPGAQTL  144

Query  480  RSWF  491
            ++WF
Sbjct  145  KNWF  148



>ref|XP_004242148.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=194

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 71/139 (51%), Gaps = 18/139 (13%)
 Frame = +3

Query  102  CEAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGKE-TCPKSVVQ---VAP  269
            CEA+  P  VLDT GK +++   Y++VP+  ++ GG+ + +TG   TC  SV+Q   V P
Sbjct  22   CEASSAPNPVLDTTGKILRTEKTYFIVPINGEKYGGVAVETTGNNSTCQLSVIQKRYVEP  81

Query  270  KVAGDSVSFFPV-KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG  446
               G  +   PV K KG +R  TDL +    S   C  ST+WQ+    E  D  ++ +  
Sbjct  82   H--GHGLELIPVNKKKGVIRVSTDLKIAIY-STYDCLNSTMWQL----EKYDGGRFFV--  132

Query  447  GDKGNPGSSTARSWFMILK  503
                N G    R+WF I K
Sbjct  133  ----NVGPKVRRNWFRIEK  147



>ref|XP_002309884.2| hypothetical protein POPTR_0007s03650g [Populus trichocarpa]
 gb|EEE90334.2| hypothetical protein POPTR_0007s03650g [Populus trichocarpa]
Length=207

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 73/137 (53%), Gaps = 13/137 (9%)
 Frame = +3

Query  111  AQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTGK-ETCPKSVVQ--VAPKVA-  278
            AQ  PAVLD DG+ ++SGV+YYV+P      GGL L +      CP  V Q  +AP V+ 
Sbjct  21   AQTWPAVLDADGQPLRSGVEYYVLPAVTDVAGGLTLVNLNNGSICPLFVGQEPLAPVVSR  80

Query  279  GDSVSFFPVKPKGAVRNGTDLNVVFSGSXTGCQESTVWQIA-HDPENVDVVQYVLSGGDK  455
            G SV F P      VR   D  V F+G  T C +ST W +   +PE     +Y+L+  D 
Sbjct  81   GTSVIFTPRVADTVVRETRDFTVAFTG-VTICAQSTAWMVGEQNPETRR--RYILAETDP  137

Query  456  GNPGSSTARSW-FMILK  503
             NP S+   +W F I+K
Sbjct  138  -NPSSN---AWHFNIVK  150



>gb|KDO44067.1| hypothetical protein CISIN_1g031474mg [Citrus sinensis]
Length=159

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 68/124 (55%), Gaps = 6/124 (5%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVV-PVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDSVSFFPV  305
            ++D  G  V++   YY+V  ++   GGGL L     E CP  VVQ++      +   F +
Sbjct  28   LVDVHGNKVEASRDYYLVSAIRGAGGGGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSM  87

Query  306  KPKGAVRN-GTDLNVVFSGSXTGCQESTVWQI-AHDPENVDVVQYVLSGGDKGNPGSSTA  479
              K ++ N   DLNV FS + T C E TVW++ ++DP       ++ +GG +GNPG+ T 
Sbjct  88   HDKTSIINEDVDLNVRFS-TETRCNEPTVWRVDSYDPSRGK--WFITTGGVEGNPGAQTL  144

Query  480  RSWF  491
            ++WF
Sbjct  145  KNWF  148



>ref|XP_006477857.1| PREDICTED: 21 kDa seed protein-like [Citrus sinensis]
Length=213

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 6/124 (5%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVV-PVQPKQGGGLDLASTGKETCPKSVVQVAPKVAGDSVSFFPV  305
            ++D +G  V++   YY+V  ++   GGGL L     E CP  VVQ++      +   F +
Sbjct  28   LVDVNGNKVEASRDYYLVSAIRGAGGGGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSM  87

Query  306  KPKGAVRN-GTDLNVVFSGSXTGCQESTVWQI-AHDPENVDVVQYVLSGGDKGNPGSSTA  479
              K ++ N   DLNV FS + T C E TVW++ ++DP       ++ +GG +GNPG+ T 
Sbjct  88   YDKTSIINEDVDLNVRFS-TETRCNEPTVWRVDSYDPSRGK--WFITTGGVEGNPGAQTL  144

Query  480  RSWF  491
            ++WF
Sbjct  145  KNWF  148



>ref|XP_010683195.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=221

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 69/130 (53%), Gaps = 8/130 (6%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPVQPKQG--GGLDLASTGKET-CPKSVVQVAPKVAGD-SVSF  296
            VLD DG  ++ G  YYV     K G  GGL  AS    T CP+ V Q+A    G+  V+F
Sbjct  32   VLDVDGNPIEVGSAYYVRTELSKAGIGGGLVTASKPNHTQCPQYVAQLAYGFEGEIPVTF  91

Query  297  FPVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSS  473
            +P    +  +   +D+N++F+ +   C +   WQ+  D  N ++  Y+ +GG  GNPGS 
Sbjct  92   YPSSSSQKFIHISSDINIIFNTTSNVCSQG-AWQLTPDASNGNL--YLSTGGVIGNPGSL  148

Query  474  TARSWFMILK  503
            T  +WF I K
Sbjct  149  TTANWFKIAK  158



>ref|XP_006347378.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=194

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 69/139 (50%), Gaps = 18/139 (13%)
 Frame = +3

Query  102  CEAAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLASTG-KETCPKSVVQ---VAP  269
            CEA+  P  VLD  GK +++   Y++VP+  ++ GG+ + + G   TC  SV+Q   + P
Sbjct  22   CEASSAPNPVLDITGKILRTEKTYFIVPINGEKYGGVAVETIGNNNTCQLSVIQKRYIEP  81

Query  270  KVAGDSVSFFPV-KPKGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSG  446
               G  +   PV K KG +R  TDLNV    S   C  ST WQ+    E  D  +Y +  
Sbjct  82   H--GHGLELIPVDKKKGVIRVSTDLNVAIY-STYDCLHSTRWQL----EKYDGGRYFI--  132

Query  447  GDKGNPGSSTARSWFMILK  503
                N G    R+WF I K
Sbjct  133  ----NVGPKDRRNWFRIEK  147



>pdb|3IIR|A Chain A, Crystal Structure Of Miraculin Like Protein From Seeds 
Of Mu Koenigii
 pdb|3IIR|B Chain B, Crystal Structure Of Miraculin Like Protein From Seeds 
Of Mu Koenigii
 pdb|3ZC8|A Chain A, Crystal Structure Of Murraya Koenigii Miraculin-like 
Protein At 2.2 A Resolution At Ph 7.0
 pdb|3ZC9|A Chain A, Crystal Structure Of Murraya Koenigii Miraculin-like 
Protein At 2.2 A Resolution At Ph 4.6
Length=190

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 6/126 (5%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPV-QPKQGGGLDLASTGKETCPKSVVQVAPKV-AGDSVSFFP  302
            +LD +G  V++   YY+V V     GGGL L     E CP  V+Q++P +  G  + F  
Sbjct  3    LLDINGNVVEASRDYYLVSVIGGAGGGGLTLYRGRNELCPLDVIQLSPDLHKGTRLRFAA  62

Query  303  VKPKGAVRNGTDLNVVFSGSXTGCQESTVWQI-AHDPENVDVVQYVLSGGDKGNPGSSTA  479
                  +    DLNV FS + T C E TVW++  +DP       ++ +GG +GNPG+ T 
Sbjct  63   YNNTSIIHEAVDLNVKFS-TETSCNEPTVWRVDNYDPSRGK--WFITTGGVEGNPGAQTL  119

Query  480  RSWFMI  497
            ++WF +
Sbjct  120  KNWFKL  125



>ref|XP_003534082.1| PREDICTED: miraculin-like [Glycine max]
 gb|KHM99736.1| Miraculin [Glycine soja]
Length=211

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 69/142 (49%), Gaps = 15/142 (11%)
 Frame = +3

Query  105  EAAQKPPAVLDTDGKAVQSGVKYYVVPVQP----KQGGGLDLASTGKETCPKSVVQVAPK  272
            EA   P  VLDT GK ++ GV Y ++   P    +   GL L+  G  +CP  VV V   
Sbjct  24   EAETSPEQVLDTSGKVLREGVNYNILISMPYTSCRSPQGLGLSKIG-NSCPLDVVVVDIN  82

Query  273  VAGDSVSFFPVKPK-GAVRNGTDLNVVFSGSXTGC-QESTVWQIAHDPENVDVV---QYV  437
                 + F PV PK G +R  TDLN++F      C   STVW++    +N  V    + V
Sbjct  83   -HRLPLRFIPVNPKKGVIRVATDLNIMFPDRNVTCPHHSTVWKV----DNFHVSKGHRLV  137

Query  438  LSGGDKGNPGSSTARSWFMILK  503
             +GG  G PG  T  +WF I K
Sbjct  138  TTGGVVGYPGRETIGNWFKIEK  159



>gb|ABK01288.1| miraculin-like protein [Coffea arabica]
Length=214

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 73/134 (54%), Gaps = 8/134 (6%)
 Frame = +3

Query  108  AAQKPPAVLDTDGKAVQSGVKYYVVPVQPKQGGGLDLAST-GKETCPKSVVQVAPKVAGD  284
            AA++   VLD +G+ ++ GV+YY +    + GGG+      G E CP +V Q   +  G 
Sbjct  20   AAEELYPVLDINGEEIRPGVEYY-IGTTFRPGGGVTYGKGPGNEICPLAVAQAWLQ-RGL  77

Query  285  SVSFFPVKP-KGAVRNGTDLNVVFSGSXTG--CQESTVWQIAHDPENVDVVQYVLSGGDK  455
             V+F PV P +G VR  TDLN+ F+    G  C  S VW++  +  ++    +VL+ G +
Sbjct  78   PVTFTPVNPEEGVVRVSTDLNIKFAEPPVGRICSGSNVWKVHFN--DLFEKHFVLTDGVE  135

Query  456  GNPGSSTARSWFMI  497
            GN G  T  +WF I
Sbjct  136  GNSGCGTTANWFKI  149



>ref|XP_006347376.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=202

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 70/129 (54%), Gaps = 6/129 (5%)
 Frame = +3

Query  129  VLDTDGKAVQSGVKYYVVPV-QPKQGGGLD-LASTGKETCPKSVVQV-APKVAGDSVSFF  299
            VLD +G  V++G  Y+++PV + + GGGL         TCP+ ++Q    +  G  V F 
Sbjct  25   VLDVNGNEVEAGPNYFILPVIRGRGGGGLSPFNVKQNNTCPRDIIQWDDEEQEGLPVVFT  84

Query  300  PVKP-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAHDPENVDVVQYVLSGGDKGNPGSST  476
             +   K  VR  TD+NV F  + T C   T+W++    EN+    +V++GG +GNPG  T
Sbjct  85   RIDAKKSVVRVSTDVNVRFY-TPTICARETIWKLGEYDENLK-QYFVVTGGVEGNPGLKT  142

Query  477  ARSWFMILK  503
              +WF I K
Sbjct  143  VGNWFKIEK  151



>ref|XP_010249125.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=211

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 66/125 (53%), Gaps = 8/125 (6%)
 Frame = +3

Query  135  DTDGKAVQSGVKYYVVPVQPKQGGGLDLAST-GKETCPKSVVQVAPKVA-GDSVSFFPVK  308
            DT G+ + S V+YY++P   +  GG   AST    +CP  VVQ     + G  + F+PV 
Sbjct  34   DTMGRPLHSRVRYYILPAD-ESAGGFGFASTKNSSSCPFGVVQHEENQSNGLPLWFYPVD  92

Query  309  P-KGAVRNGTDLNVVFSGSXTGCQESTVWQIAH-DPENVDVVQYVLSGGDKGNPGSSTAR  482
            P KG +R  TDLN+ F+   T   + TVW++   DP       +V + G  GNPG  T  
Sbjct  93   PKKGIIRVSTDLNIRFA-ILTLLPQPTVWKLGEFDPSTQQ--WFVNTCGALGNPGPETLS  149

Query  483  SWFMI  497
            SWF I
Sbjct  150  SWFKI  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905