BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G11

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    113   3e-25   Solanum tuberosum [potatoes]
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        113   3e-25   Solanum lycopersicum
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        110   5e-24   Nicotiana sylvestris
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         108   1e-23   Jatropha curcas
dbj|BAG16527.1|  putative aconitase                                     107   3e-23   Capsicum chinense [bonnet pepper]
ref|XP_006376779.1|  aconitate hydratase family protein                 107   4e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        105   1e-22   Nelumbo nucifera [Indian lotus]
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        105   2e-22   Populus euphratica
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    105   2e-22   Sesamum indicum [beniseed]
ref|XP_002524184.1|  aconitase, putative                                105   2e-22   Ricinus communis
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        105   3e-22   Nicotiana tomentosiformis
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        104   4e-22   Eucalyptus grandis [rose gum]
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    104   5e-22   Populus euphratica
emb|CDP05740.1|  unnamed protein product                                103   8e-22   Coffea canephora [robusta coffee]
emb|CDP10817.1|  unnamed protein product                                103   1e-21   Coffea canephora [robusta coffee]
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             101   4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             100   1e-20   Citrus clementina [clementine]
gb|KDO62733.1|  hypothetical protein CISIN_1g001863mg                 99.8    2e-20   Citrus sinensis [apfelsine]
gb|EPS60517.1|  hypothetical protein M569_14286                       96.3    3e-19   Genlisea aurea
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  95.5    5e-19   Solanum tuberosum [potatoes]
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg           93.2    3e-18   Citrus clementina [clementine]
ref|XP_006447556.1|  hypothetical protein CICLE_v10014140mg           92.8    4e-18   
ref|XP_009598331.1|  PREDICTED: aconitate hydratase 2, mitochondr...  92.4    5e-18   Nicotiana tomentosiformis
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...  92.4    5e-18   Nicotiana tomentosiformis
gb|KDO54659.1|  hypothetical protein CISIN_1g001917mg                 92.4    5e-18   Citrus sinensis [apfelsine]
gb|KDO54661.1|  hypothetical protein CISIN_1g001917mg                 92.4    5e-18   Citrus sinensis [apfelsine]
gb|KDO54660.1|  hypothetical protein CISIN_1g001917mg                 92.0    6e-18   Citrus sinensis [apfelsine]
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic      92.0    7e-18   Vitis vinifera
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg              90.9    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  90.1    3e-17   Nelumbo nucifera [Indian lotus]
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                 89.7    5e-17   Citrus sinensis [apfelsine]
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                 89.7    5e-17   Citrus sinensis [apfelsine]
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...  89.0    8e-17   Glycine max [soybeans]
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                      89.0    9e-17   Glycine soja [wild soybean]
ref|XP_009787326.1|  PREDICTED: aconitate hydratase 2, mitochondr...  87.0    4e-16   Nicotiana sylvestris
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  87.0    4e-16   Nicotiana sylvestris
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...  86.3    7e-16   Glycine max [soybeans]
gb|KJB60835.1|  hypothetical protein B456_009G327800                  83.2    6e-15   Gossypium raimondii
gb|KJB60836.1|  hypothetical protein B456_009G327800                  82.8    9e-15   Gossypium raimondii
gb|KJB60837.1|  hypothetical protein B456_009G327800                  82.8    9e-15   Gossypium raimondii
ref|XP_007045642.1|  Aconitase 3                                      82.8    1e-14   
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic      82.0    2e-14   Solanum lycopersicum
gb|KJB50479.1|  hypothetical protein B456_008G173400                  81.3    3e-14   Gossypium raimondii
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g           80.1    7e-14   Phaseolus vulgaris [French bean]
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic      80.1    8e-14   Sesamum indicum [beniseed]
gb|KDP39136.1|  hypothetical protein JCGZ_00893                       79.3    1e-13   Jatropha curcas
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...  79.3    1e-13   Solanum tuberosum [potatoes]
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...  78.2    3e-13   Camelina sativa [gold-of-pleasure]
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg              78.2    4e-13   Erythranthe guttata [common monkey flower]
ref|XP_003596988.1|  Aconitate hydratase                              77.8    4e-13   Medicago truncatula
gb|KJB62847.1|  hypothetical protein B456_009G440000                  77.8    4e-13   Gossypium raimondii
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  77.8    5e-13   Cucumis sativus [cucumbers]
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  77.8    5e-13   
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic      77.4    6e-13   Cucumis melo [Oriental melon]
gb|KJB62848.1|  hypothetical protein B456_009G440000                  77.4    6e-13   Gossypium raimondii
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099           77.4    7e-13   
ref|XP_010445106.1|  PREDICTED: aconitate hydratase 3, mitochondr...  75.5    7e-13   
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic      77.0    8e-13   
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg           77.0    9e-13   Capsella rubella
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg           76.6    1e-12   Eutrema salsugineum [saltwater cress]
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic      76.6    1e-12   Pyrus x bretschneideri [bai li]
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  76.3    2e-12   Glycine max [soybeans]
ref|NP_567763.2|  aconitase 2                                         75.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAK91447.1|  AT4g26970/F10M23_310                                  75.9    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial  75.5    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006592372.1|  PREDICTED: aconitate hydratase 2, mitochondr...  75.1    3e-12   Glycine max [soybeans]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...  75.1    3e-12   Glycine max [soybeans]
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...  74.7    4e-12   Cicer arietinum [garbanzo]
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  74.3    6e-12   Nicotiana tomentosiformis
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  73.9    7e-12   Nicotiana sylvestris
gb|KHG15607.1|  Aconitate hydratase 2, mitochondrial -like protein    73.6    8e-12   Gossypium arboreum [tree cotton]
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein    72.8    2e-11   Gossypium arboreum [tree cotton]
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                  72.8    2e-11   Arabis alpina [alpine rockcress]
emb|CDY14291.1|  BnaA08g14220D                                        72.0    4e-11   Brassica napus [oilseed rape]
emb|CDY66424.1|  BnaAnng22230D                                        72.0    4e-11   Brassica napus [oilseed rape]
gb|KJB30566.1|  hypothetical protein B456_005G149700                  70.9    8e-11   Gossypium raimondii
gb|KJB30569.1|  hypothetical protein B456_005G149700                  70.9    8e-11   Gossypium raimondii
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic      70.5    1e-10   Prunus mume [ume]
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial  70.5    1e-10   Brassica rapa
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg           70.1    2e-10   Prunus persica
ref|XP_002532564.1|  aconitase, putative                              69.7    2e-10   
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  69.7    2e-10   
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                  69.3    2e-10   Gossypium arboreum [tree cotton]
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...  68.9    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...  68.9    4e-10   Elaeis guineensis
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial  68.6    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...  68.6    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...  68.2    5e-10   
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...  68.2    6e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186           67.8    9e-10   
emb|CDY50945.1|  BnaC03g74450D                                        65.5    4e-09   Brassica napus [oilseed rape]
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                  64.3    9e-09   Arabis alpina [alpine rockcress]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg           63.9    1e-08   Capsella rubella
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...  63.9    1e-08   Phoenix dactylifera
gb|KHG02134.1|  hypothetical protein F383_25649                       63.2    2e-08   Gossypium arboreum [tree cotton]
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial  62.8    3e-08   Brassica rapa
emb|CDX97969.1|  BnaA06g07200D                                        62.8    3e-08   
emb|CDY18054.1|  BnaC07g04160D                                        62.8    3e-08   Brassica napus [oilseed rape]
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic      62.8    4e-08   Vitis vinifera
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial  62.4    4e-08   Brassica rapa
ref|XP_010100637.1|  Aconitate hydratase                              62.4    4e-08   
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic      61.6    7e-08   Fragaria vesca subsp. vesca
ref|XP_003605929.1|  Aconitate hydratase                              60.5    2e-07   Medicago truncatula
ref|NP_178634.2|  aconitate hydratase 3                               60.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007020811.1|  Aconitase 3                                      60.1    2e-07   
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg           59.7    3e-07   Eutrema salsugineum [saltwater cress]
emb|CDX93088.1|  BnaA03g38100D                                        58.9    6e-07   
ref|XP_007132546.1|  hypothetical protein PHAVU_011G1037001g          57.8    1e-06   Phaseolus vulgaris [French bean]
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...  57.4    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...  57.4    2e-06   
emb|CDY56501.1|  BnaAnng14360D                                        56.6    3e-06   Brassica napus [oilseed rape]
ref|XP_002870438.1|  predicted protein                                55.8    5e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...  55.5    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...  54.3    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...  54.3    2e-05   Cicer arietinum [garbanzo]
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...  52.4    6e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...  49.3    8e-04   Phoenix dactylifera



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   113 bits (283),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  386  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTS  565
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+AT+A+ENPFKGI T 
Sbjct  53   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  112

Query  566  LP  571
            LP
Sbjct  113  LP  114



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   113 bits (283),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  386  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTS  565
            ++S  RSLRCSVPRWSHGVDWKSP SLTAQIR+AAP LN FHRK+AT+A+ENPFKGI T 
Sbjct  51   YSSTLRSLRCSVPRWSHGVDWKSPISLTAQIRTAAPALNGFHRKLATMAAENPFKGILTG  110

Query  566  LP  571
            LP
Sbjct  111  LP  112



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   110 bits (274),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  386  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTS  565
            F+S FRS+RCSVPRWSHG+DWKSP SLTAQIR+AAP LN FHRK++T+A +NPFK I T+
Sbjct  52   FSSTFRSVRCSVPRWSHGIDWKSPISLTAQIRTAAPALNSFHRKLSTMAEKNPFKEILTA  111

Query  566  LP  571
            LP
Sbjct  112  LP  113



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   108 bits (271),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F +A RS RCSVPRWSHGVDW+SP SL +QIRSAAPV+  F RKIAT+A+E+PFKG
Sbjct  50   RSLSFTAAVRSFRCSVPRWSHGVDWRSPVSLRSQIRSAAPVIEQFQRKIATMAAEHPFKG  109

Query  554  IFTSLP  571
            I T+LP
Sbjct  110  IVTALP  115



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   107 bits (268),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  386  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTS  565
            ++S  RSL CSV RWSHGVDWKSP SLTAQIR+AAP LN FHRK+AT+A+ENPFKGI T+
Sbjct  51   YSSTLRSLGCSVTRWSHGVDWKSPISLTAQIRTAAPALNSFHRKLATMAAENPFKGILTA  110

Query  566  LP  571
            LP
Sbjct  111  LP  112



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   107 bits (267),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIAT+A E+PFKG
Sbjct  47   RSLSFSSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  554  IFTSLP  571
            IFTSLP
Sbjct  107  IFTSLP  112



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   105 bits (263),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+SAFRSLR S PRWSHG DW+SP SL AQIR+AAPV+  F RKIAT+ASEN FKG
Sbjct  44   RSLSFSSAFRSLRSSPPRWSHGYDWRSPLSLRAQIRTAAPVIERFQRKIATMASENAFKG  103

Query  554  IFTSLP  571
            I TSLP
Sbjct  104  ILTSLP  109



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+SAFRSLRCS PRWSHGVDW+SPA+L  QIR+ +P +  F RKIAT+  E+PFKG
Sbjct  53   RSLSFSSAFRSLRCSYPRWSHGVDWRSPATLRHQIRAVSPFVERFQRKIATMVPEHPFKG  112

Query  554  IFTSLP  571
            IFTSLP
Sbjct  113  IFTSLP  118



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+SA RS+RCS PRWSHGVDW+SP SL AQIR+A+PVL  F RKIAT+ASE+PF G
Sbjct  63   RSLSFSSALRSIRCSAPRWSHGVDWRSPVSLRAQIRTASPVLERFERKIATMASEHPFSG  122

Query  554  IFTSLP  571
            I + LP
Sbjct  123  ILSGLP  128



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   105 bits (262),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F++A RSLRCSVPRWSHGVDW+SP SL +QIR+A+PV+  F RKI+T+A+E+PFKG
Sbjct  48   RSLSFSAAVRSLRCSVPRWSHGVDWRSPVSLRSQIRTASPVIERFQRKISTMAAEHPFKG  107

Query  554  IFTSLP  571
            I T LP
Sbjct  108  IVTPLP  113



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   105 bits (261),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  386  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTS  565
            F+S  RS+RCSVPRWSHGVDWKSP SLTAQIR+AAP  N FH+K++T+A +NPFK I T+
Sbjct  53   FSSTLRSVRCSVPRWSHGVDWKSPISLTAQIRTAAPAFNSFHKKLSTMAEKNPFKEILTA  112

Query  566  LP  571
            LP
Sbjct  113  LP  114



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   104 bits (260),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/66 (71%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+SAFRSLR SVPRWSHGVDW+SPASL  QIR+ APV+    RK AT+ASENPFK 
Sbjct  48   RSLSFSSAFRSLRSSVPRWSHGVDWRSPASLRPQIRAVAPVIERLQRKFATMASENPFKE  107

Query  554  IFTSLP  571
            I T+LP
Sbjct  108  ILTTLP  113



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   104 bits (259),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/66 (71%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R  +F SA RSLRCS PRWSHGVDW+SPA+L  QIR+ APV+  F RKIAT+A E+PFKG
Sbjct  47   RSSSFTSAVRSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIATMAHEHPFKG  106

Query  554  IFTSLP  571
            IFTSLP
Sbjct  107  IFTSLP  112



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   103 bits (257),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 47/66 (71%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R    +SA RSLRCSVPRWSHGVDW+SP SL AQIR+AAPV+  F RKIAT+A E+P+KG
Sbjct  63   RSFKPSSAVRSLRCSVPRWSHGVDWRSPVSLRAQIRTAAPVIERFERKIATMAPEHPYKG  122

Query  554  IFTSLP  571
            I TSLP
Sbjct  123  ILTSLP  128



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   103 bits (256),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+++SA RS+R SVPRWSHGVDWKSP+SL +QIR+ +P  N F+RK+AT+ASENPFKG
Sbjct  62   RLLSYSSALRSVRSSVPRWSHGVDWKSPSSLCSQIRTTSPACNGFYRKMATMASENPFKG  121

Query  554  IFTSLP  571
              TSLP
Sbjct  122  TLTSLP  127



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   101 bits (252),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+SA RSLRCS  RWSHGVDW+SPA+L  QIR+ AP +  F RKIAT+A E+PFKG
Sbjct  51   RSLSFSSAVRSLRCSYRRWSHGVDWRSPATLRHQIRAVAPFVERFQRKIATMAPEHPFKG  110

Query  554  IFTSLP  571
            IFTSLP
Sbjct  111  IFTSLP  116



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA++A EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  554  IFTSLP  571
            I TSLP
Sbjct  114  ILTSLP  119



>gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=875

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+SA R++RCS PRWSHGV+W+SP SL AQ R AAPVL  F RKIA++A EN FKG
Sbjct  54   RSLSFSSALRTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIASMAPENAFKG  113

Query  554  IFTSLP  571
            I TSLP
Sbjct  114  ILTSLP  119



>gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlisea aurea]
Length=862

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+SA RSLR S PRWSHGVDW+ P SL +QI + +PVL  FHRKIAT+ASE+PF G
Sbjct  17   RSLSFSSAIRSLRISAPRWSHGVDWRYPVSLRSQIGTVSPVLERFHRKIATMASEHPFSG  76

Query  554  IFTSLP  571
            +  +LP
Sbjct  77   LLQTLP  82



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 47/66 (71%), Positives = 53/66 (80%), Gaps = 7/66 (11%)
 Frame = +2

Query  380  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATIASENPFKG  553
            L F+S FRS     PRWS+GVDWKSP SL AQIR+AA  PVLN+FHRK+ T+ASENPFKG
Sbjct  38   LGFSSTFRS-----PRWSYGVDWKSPISLKAQIRTAAVTPVLNNFHRKLTTMASENPFKG  92

Query  554  IFTSLP  571
            I TSLP
Sbjct  93   ILTSLP  98



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  AT+A+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  554  IFTSLP  571
            I T+LP
Sbjct  112  ILTALP  117



>ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 gb|ESR60796.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=888

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  AT+A+E+PFK 
Sbjct  52   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  111

Query  554  IFTSLP  571
            I T+LP
Sbjct  112  ILTALP  117



>ref|XP_009598331.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IAT+ASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  554  IFTSLP  571
            IFTSLP
Sbjct  176  IFTSLP  181



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R  +F+SA  SLR SVPRWSHGVDW+SP SL AQ+R+A+P +    R IAT+ASE+PF+G
Sbjct  116  RSFSFSSALPSLRYSVPRWSHGVDWRSPISLRAQVRTASPDIEPLDRNIATMASEHPFRG  175

Query  554  IFTSLP  571
            IFTSLP
Sbjct  176  IFTSLP  181



>gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=896

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  AT+A+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  554  IFTSLP  571
            I T+LP
Sbjct  108  ILTALP  113



>gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=876

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  AT+A+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  554  IFTSLP  571
            I T+LP
Sbjct  108  ILTALP  113



>gb|KDO54660.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=902

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  AT+A+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  554  IFTSLP  571
            I T+LP
Sbjct  108  ILTALP  113



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L F SAFRS      RWSHGVDW+SP SL AQIR+AAPV+  F RK+ATIASE+PFKG
Sbjct  66   RSLGFLSAFRS-----RRWSHGVDWRSPVSLRAQIRAAAPVIERFERKMATIASEHPFKG  120

Query  554  IFTSLP  571
            I TS+P
Sbjct  121  ILTSVP  126



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +2

Query  374  RPLTFASAFRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFK  550
            R L+F+SA RS+R  S  RWSHG DW+SP SL AQIRS++PVL  F RKIAT+ASE+PF 
Sbjct  61   RSLSFSSALRSIRYSSSQRWSHGADWRSPVSLRAQIRSSSPVLERFERKIATMASEHPFN  120

Query  551  GIFTSLP  571
            GI + LP
Sbjct  121  GILSGLP  127



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  410  RCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            R S PRWSHG DWKSP SL AQIR+AAPV+  F RKIAT+ASEN FKGI TSLP
Sbjct  61   RSSAPRWSHGFDWKSPLSLRAQIRTAAPVIERFQRKIATMASENAFKGILTSLP  114



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  AT+A+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  554  IFTSLP  571
            I T+LP
Sbjct  108  ILTALP  113



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L FASA RS RCSVPRWSH VDW+SP SL AQIR+ AP +    R  AT+A+E+PFK 
Sbjct  48   RSLGFASAVRSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFATMAAEHPFKE  107

Query  554  IFTSLP  571
            I T+LP
Sbjct  108  ILTALP  113



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  377  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGI  556
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  557  FTSLP  571
             TSLP
Sbjct  97   LTSLP  101



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  377  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGI  556
            P + ++A RS   +VPRWSHGVDW+SP  L  QIR+AAP++  FHR+IAT A++NPFKG 
Sbjct  37   PGSSSAATRSFGSAVPRWSHGVDWRSPLGLRPQIRAAAPLIERFHRRIATSATDNPFKGN  96

Query  557  FTSLP  571
             TSLP
Sbjct  97   LTSLP  101



>ref|XP_009787326.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=818

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  386  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTS  565
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IAT+ASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  566  LP  571
            LP
Sbjct  133  LP  134



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  386  FASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTS  565
            F+SA  SL  S PRWSHGVDW+SP SL AQIR+A+P +    R IAT+ASE+PF+GIFTS
Sbjct  73   FSSALPSLSYSTPRWSHGVDWRSPISLRAQIRTASPDIERLDRNIATMASEHPFRGIFTS  132

Query  566  LP  571
            LP
Sbjct  133  LP  134



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  377  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGI  556
            P + A+A RS   +VPRWS GVDW+SP  L   IR+AAP++  FHR+IAT A+ENPFKG 
Sbjct  37   PGSSAAATRSFGSAVPRWSRGVDWRSPLGLRPHIRAAAPLIERFHRRIATSATENPFKGN  96

Query  557  FTSLP  571
             TSLP
Sbjct  97   LTSLP  101



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  389  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSL  568
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +T+A+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  569  P  571
            P
Sbjct  107  P  107



>gb|KJB60836.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=860

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  389  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSL  568
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +T+A+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  569  P  571
            P
Sbjct  107  P  107



>gb|KJB60837.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=865

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  389  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSL  568
            ++A RS  CSVPRWSH +DW+SP SL AQIR+  PV+    RK +T+A+E+PFK + TSL
Sbjct  47   SAAVRSFHCSVPRWSHRLDWRSPFSLRAQIRAVNPVIERLERKFSTMAAEHPFKAVLTSL  106

Query  569  P  571
            P
Sbjct  107  P  107



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R LT ++A RS   SVPRWSH +DW+SP SL AQIR+  PV+    RK AT+ASE+PFK 
Sbjct  48   RSLT-SAAVRSFHGSVPRWSHRLDWRSPLSLRAQIRAVTPVIERLERKFATMASEHPFKA  106

Query  554  IFTSLP  571
            + TSLP
Sbjct  107  VLTSLP  112



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 47/60 (78%), Gaps = 7/60 (12%)
 Frame = +2

Query  398  FRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATIASENPFKGIFTSLP  571
            FRSLR     W +GVDWKSP SLT+QIR+AA  PVLN+F RK+ T+AS NPFKGI TSLP
Sbjct  44   FRSLR-----WRYGVDWKSPISLTSQIRTAAVTPVLNNFRRKLTTMASGNPFKGILTSLP  98



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R LT ++A RS  CSVPRWSH +DW+SP +L ++IR+  P++    RK AT+A+E+PFK 
Sbjct  49   RSLT-SAAVRSFHCSVPRWSHRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  554  IFTSLP  571
            + TSLP
Sbjct  108  VLTSLP  113



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  416  SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            +VPRWSHGVDW+SP  L  QIR+ AP++  FHR+IAT A +NPFKG  TSLP
Sbjct  49   AVPRWSHGVDWRSPLGLRHQIRAVAPLIERFHRRIATSALDNPFKGNLTSLP  100



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = +2

Query  398  FRSLR-CSVPRWSHGVDWKSPASLTAQIRSAAPVLND--FHRKIATIASENPFKGIFTSL  568
             RSL   S  RWSHGVDWKSP SL AQIR A+ V +D   HRKIAT+A+ENPFKGIFTSL
Sbjct  55   LRSLSYLSAARWSHGVDWKSPPSLAAQIRIAS-VSSDTLLHRKIATMAAENPFKGIFTSL  113

Query  569  P  571
            P
Sbjct  114  P  114



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 6/66 (9%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+   RSLRCS P WSHGVDW SP SL AQ R ++PV+    R+++T+ SE+PFKG
Sbjct  57   RYLSFS---RSLRCSAPLWSHGVDWHSPISLRAQARVSSPVV---ERRLSTMTSEHPFKG  110

Query  554  IFTSLP  571
            I T+LP
Sbjct  111  ILTNLP  116



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 4/63 (6%)
 Frame = +2

Query  386  FASAFRSLRCSVPRWS-HGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFT  562
            FA+ +RS+RCSVPRWS +GV+ + P SL AQIR+A+ V+    R +AT+ASE+PFKGIFT
Sbjct  38   FATTYRSIRCSVPRWSNYGVNRRFPISLKAQIRTASQVV---ERNVATMASEHPFKGIFT  94

Query  563  SLP  571
            SLP
Sbjct  95   SLP  97



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = +2

Query  374  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPF  547
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R++APV+  F RK AT+ASE+ +
Sbjct  48   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRNSAPVMEKFERKYATMASEHAY  107

Query  548  KGIFTSLP  571
            K I TSLP
Sbjct  108  KDILTSLP  115



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/53 (74%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +2

Query  416  SVPRWSHGVDWKSPASLTAQIR-SAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            S  RWSHGVDWKSPASL +QIR S+A      HRKIAT+ASEN FKGIFTSLP
Sbjct  60   SAARWSHGVDWKSPASLASQIRISSAFSDTLLHRKIATMASENAFKGIFTSLP  112



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  380  LTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
             T ++   + R +V RWSHGV W+SP SL  QIR+ AP +  +HRKIAT A ENPFKG  
Sbjct  33   FTSSAVANAARSTVNRWSHGVLWRSPFSLRPQIRAVAPFIEQYHRKIATSAGENPFKGNL  92

Query  560  TSLP  571
            TSLP
Sbjct  93   TSLP  96



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 4/66 (6%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  554  IFTSLP  571
            + TSLP
Sbjct  105  VMTSLP  110



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 4/66 (6%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK +++A+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  554  IFTSLP  571
              TSLP
Sbjct  101  NLTSLP  106



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 4/66 (6%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK +++A+ENPFK 
Sbjct  45   RSLSASSAFRS----TARWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  554  IFTSLP  571
              TSLP
Sbjct  101  NLTSLP  106



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 4/66 (6%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+ +SAFRS      RWSHGV W+SP SL AQIR+ AP +   HRK +++A+ENPFK 
Sbjct  45   RSLSASSAFRS----TTRWSHGVGWRSPLSLRAQIRAVAPAIERLHRKFSSMAAENPFKE  100

Query  554  IFTSLP  571
              TSLP
Sbjct  101  NLTSLP  106



>gb|KJB62848.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=864

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 4/66 (6%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R L+F+ + RSLRCS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG
Sbjct  49   RSLSFSYSLRSLRCSAPR----LHWRSPESLRVLARTSVPVVERFHRRIATTASEHPFKG  104

Query  554  IFTSLP  571
            + TSLP
Sbjct  105  VMTSLP  110



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +2

Query  374  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPF  547
            R  +F+SA RS R CS   RWSHGV W SPASL AQ R++APV+  F R  AT+ASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGVSWGSPASLRAQSRNSAPVMEKFERTYATMASEHAY  104

Query  548  KGIFTSLP  571
            K I TSLP
Sbjct  105  KDILTSLP  112



>ref|XP_010445106.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=383

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +2

Query  374  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPF  547
            R  +F+SA RS R CS   RWSHG  W+ PASL AQ R++APV+  F RK ATIASE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRYPASLRAQSRNSAPVMEKFERKYATIASEHAY  106

Query  548  KGIFTSLP  571
            K I TSLP
Sbjct  107  KDILTSLP  114



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +2

Query  380  LTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGI  556
            L F SA  + R S PRWSHG V W+SP +L +QIR+ APV+  F RKIA++ASENPFK  
Sbjct  48   LRFLSASSAAR-SFPRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFKAN  106

Query  557  FTSLP  571
             TSLP
Sbjct  107  LTSLP  111



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +2

Query  374  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPF  547
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK AT+ASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQSRISAPVMEKFERKYATMASEHAY  104

Query  548  KGIFTSLP  571
            K I TSLP
Sbjct  105  KDILTSLP  112



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = +2

Query  374  RPLTFASAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPF  547
            R  +F+SA RS R   +  RWS+G +W+SPASL AQ R++APV+  F RK AT+ASE+ +
Sbjct  48   RSKSFSSALRSFRVGSASTRWSYGGNWRSPASLRAQTRNSAPVMERFERKYATMASEHAY  107

Query  548  KGIFTSLP  571
            K I TSLP
Sbjct  108  KDILTSLP  115



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 48/67 (72%), Gaps = 5/67 (7%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFK  550
            R L+ +SA RS     PRWSHG V W+SP +L +QIR+ APV+  F RKIA++ASENPFK
Sbjct  49   RFLSSSSAARSF----PRWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKIASMASENPFK  104

Query  551  GIFTSLP  571
               TSLP
Sbjct  105  ANLTSLP  111



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R  +F++A   LRCSVPRWSH +   SP S    I + APV+  FHR+IAT+A+ENPFKG
Sbjct  31   RTSSFSAAPSLLRCSVPRWSHRLHSTSPLSPRPPITAVAPVVERFHRQIATMANENPFKG  90

Query  554  IFTSLP  571
              TSLP
Sbjct  91   NLTSLP  96



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +2

Query  374  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPF  547
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK AT+ASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  548  KGIFTSLP  571
            K I TSLP
Sbjct  105  KDILTSLP  112



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +2

Query  374  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPF  547
            R  +F+SA RS R CS   RWSHG  W SPASL AQ R++ PV+  F RK AT+ASE+ +
Sbjct  45   RSKSFSSALRSFRVCSASTRWSHGGSWGSPASLRAQARNSTPVMEKFERKYATMASEHSY  104

Query  548  KGIFTSLP  571
            K I TSLP
Sbjct  105  KDILTSLP  112



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +2

Query  374  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPF  547
            R  +F+SA RS R CS   RWSHG  W+SP SL AQ R++APV+  F RK AT+ SE+ +
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPVSLRAQSRNSAPVMEKFERKYATMTSEHAY  106

Query  548  KGIFTSLP  571
            K I TSLP
Sbjct  107  KDILTSLP  114



>ref|XP_006592372.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=890

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFT  562
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IAT+A+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  563  SLP  571
            SLP
Sbjct  99   SLP  101



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFT  562
            +F++  RSL CSVPRWSH +   SP +   +I + AP++  FHR+IAT+A+ENPFKG  T
Sbjct  39   SFSATARSLLCSVPRWSHRLHSASPLTPRPRISAVAPLVERFHREIATMANENPFKGNLT  98

Query  563  SLP  571
            SLP
Sbjct  99   SLP  101



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  419  VPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            V RWSHGV W+SP SL  QIR+ AP +  FHRKIAT A ENPFKG   +LP
Sbjct  52   VNRWSHGVHWRSPFSLRPQIRAVAPFIERFHRKIATSAGENPFKGNLATLP  102



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 47/68 (69%), Gaps = 11/68 (16%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATIASENPF  547
            R L F+SA RSLR     W    +WKSP  L AQIR+ A  PVLN FHRK++T+A+ENPF
Sbjct  44   RSLNFSSAVRSLR-----W----NWKSPIILKAQIRTTATTPVLNSFHRKLSTMAAENPF  94

Query  548  KGIFTSLP  571
            KGI T LP
Sbjct  95   KGILTVLP  102



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 11/68 (16%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAA--PVLNDFHRKIATIASENPF  547
            R L+F+SA RSLR     W    +WKSP SL AQIR+ A  PVLN  HRK++T+A+ENPF
Sbjct  48   RSLSFSSAVRSLR-----W----NWKSPISLKAQIRTTATTPVLNSSHRKLSTMAAENPF  98

Query  548  KGIFTSLP  571
            KGI T LP
Sbjct  99   KGILTVLP  106



>gb|KHG15607.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=668

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            R LT ++A RS  CSVPRWS  +DW+SP +L ++IR+  P++    RK AT+A+E+PFK 
Sbjct  49   RSLT-STAVRSFHCSVPRWSPRLDWRSPLNLRSEIRAFNPIIEQLQRKFATMAAEHPFKA  107

Query  554  IFTSLP  571
            + TSLP
Sbjct  108  VLTSLP  113



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +2

Query  389  ASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSL  568
            ++A RS  CS PRWSH +DW+SP SL AQ+R+  PV+    RK +T+A+E+PFK + TSL
Sbjct  47   SAAVRSFHCS-PRWSHRLDWRSPFSLRAQVRAVNPVIERLERKFSTMAAEHPFKAVLTSL  105

Query  569  P  571
            P
Sbjct  106  P  106



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 4/70 (6%)
 Frame = +2

Query  374  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIA--SEN  541
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+  F RK ATIA  SE+
Sbjct  47   RSKSFSSALRSFRVCSASTRWSHGGSWRSPASLRAQARISAPVMERFERKYATIASDSEH  106

Query  542  PFKGIFTSLP  571
             +K I TSLP
Sbjct  107  AYKDILTSLP  116



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +2

Query  374  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPF  547
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A++ASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  548  KGIFTSLP  571
            K + TSLP
Sbjct  105  KDLLTSLP  112



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +2

Query  374  RPLTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPF  547
            R  +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A++ASE+ +
Sbjct  45   RSRSFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHAY  104

Query  548  KGIFTSLP  571
            K + TSLP
Sbjct  105  KDLLTSLP  112



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFT  562
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ AT+A+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  563  SLP  571
            SLP
Sbjct  107  SLP  109



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFT  562
            T +   RS   S  RW H +DW+SP SL AQIR+  PV+  F ++ AT+A+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPFSLRAQIRALNPVIERFQKQFATMAAEHPFKEVLT  106

Query  563  SLP  571
            SLP
Sbjct  107  SLP  109



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  425  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            RWSHG V W+SP +L +QIR+ APV+  F RKIA++ASENPFK   TSLP
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAIAPVIEQFQRKIASMASENPFKANLTSLP  113



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 2/65 (3%)
 Frame = +2

Query  383  TFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGI  556
            +F+SA RS R CS   RWSHG  W+SPASL AQ R +APV+    R+ A++ASE+ ++ I
Sbjct  48   SFSSALRSYRVCSASTRWSHGGSWRSPASLRAQARVSAPVMERLERRYASMASEHTYQDI  107

Query  557  FTSLP  571
             TSLP
Sbjct  108  LTSLP  112



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  425  RWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            RWSHG V W+SP +L +QIR+ APV+  F RK+A++ASENPFK   TSLP
Sbjct  64   RWSHGGVHWRSPYTLRSQIRAVAPVIEQFQRKMASMASENPFKANLTSLP  113



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENP  544
            R  +F+SA RSL C+V RWSH VDW+SP SL AQ  +A+PV+    RK++TIASE+P
Sbjct  51   RSFSFSSALRSLPCAVSRWSHRVDWRSPISLRAQAPAASPVI---ERKLSTIASEHP  104



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +2

Query  422  PRWSHG-VDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            PRWSHG V W+S  +L +QIR+ APV+  F RKIA++ASENPFK   TSLP
Sbjct  59   PRWSHGGVHWRSSYTLRSQIRAVAPVIEQFQRKIASMASENPFKPNLTSLP  109



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFT  562
            T +   RS   S  RW H +DW+SP SL AQIR+  PV   F ++ AT+A+E+PFK + T
Sbjct  47   TASVVVRSFHSSASRWCHRLDWRSPLSLRAQIRAFNPVTERFQKQFATMAAEHPFKEVLT  106

Query  563  SLP  571
            SLP
Sbjct  107  SLP  109



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  +++ASE+P+KGIF
Sbjct  52   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  107

Query  560  TSLP  571
            T+LP
Sbjct  108  TTLP  111



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +2

Query  401  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            R L  S   W HG +W+SP SL AQIRS+A V+  F RK+AT+A+ENPFK I TSLP
Sbjct  69   RPLVRSFGTWRHG-NWRSPVSLRAQIRSSAVVIERFQRKMATLATENPFKNILTSLP  124



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  +++ASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  560  TSLP  571
            T+LP
Sbjct  105  TTLP  108



>ref|XP_010443085.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443086.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443087.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443088.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443089.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443090.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443091.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010443092.1| PREDICTED: aconitate hydratase 3, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=981

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 2/65 (3%)
 Frame = +2

Query  380  LTFASAFRSLR-CSVP-RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKG  553
            + F  AFR  R CS   RWSHG +W+ PASL AQ R AAP L  F RK A+IASE+ +K 
Sbjct  38   VKFLLAFRLFRVCSAATRWSHGANWRLPASLQAQTRIAAPRLKKFERKFASIASEHAYKD  97

Query  554  IFTSL  568
            I T+L
Sbjct  98   ILTTL  102



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
            T + AFRSL    PRWSH    K SP SLT+QIR+ +PVL+   R  +++ASE+P+KGIF
Sbjct  49   TISPAFRSL----PRWSHCFHSKPSPFSLTSQIRAVSPVLDRLQRTFSSMASEHPYKGIF  104

Query  560  TSLP  571
            T+LP
Sbjct  105  TTLP  108



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  434  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            HGVDW+SP SL +QI ++ P++  F RKIAT+ASE+P+K IFTSLP
Sbjct  87   HGVDWRSPVSLRSQIAASPPLVERFQRKIATMASEHPYKEIFTSLP  132



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 5/64 (8%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
            T + AFRSL    PRWSH    K SP  LT QIR+ +PVL+   R  +++ASE+PFKGIF
Sbjct  51   TISPAFRSL----PRWSHCFHSKPSPFRLTTQIRAVSPVLDRLERTFSSMASEHPFKGIF  106

Query  560  TSLP  571
            T+LP
Sbjct  107  TTLP  110



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 6/68 (9%)
 Frame = +2

Query  374  RPLTFAS-AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPF  547
            RP   +S AFRSL    PRWSH +  + SP  L++QIR+ +P L+   RK +++ASE+PF
Sbjct  49   RPFATSSPAFRSL----PRWSHCLHSRLSPFRLSSQIRAVSPGLDRLERKFSSMASEHPF  104

Query  548  KGIFTSLP  571
            KGIFT+LP
Sbjct  105  KGIFTTLP  112



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
            +FA+ FRSL    PRWSH +  + S   L++QIR+ +PVL+   R  +++ASE+PFKGIF
Sbjct  44   SFATCFRSL----PRWSHCLHSRPSSFRLSSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  99

Query  560  TSLP  571
            T+LP
Sbjct  100  TTLP  103



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +2

Query  395  AFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            +F S+  +  RWSH    K SP SLT+QIR+ +PVL+   R  +++ASE+PFKGIFT+LP
Sbjct  46   SFGSISPAFRRWSHCFHSKPSPISLTSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTALP  105



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +2

Query  401  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            R L  S   W HG   +SP SL AQIRS+A V+  F RK+AT+A+ENPFK I TSLP
Sbjct  70   RPLVRSFGTWRHGSS-RSPVSLRAQIRSSAAVIERFQRKMATMATENPFKNILTSLP  125



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 4/53 (8%)
 Frame = +2

Query  413  CSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            CS PR    + W+SP SL    R++ PV+  FHR+IAT ASE+PFKG+ TSLP
Sbjct  62   CSAPR----LHWRSPESLRILARTSVPVVERFHRRIATTASEHPFKGVMTSLP  110



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 5/64 (8%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  +++ASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  560  TSLP  571
            T+LP
Sbjct  105  TTLP  108



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 5/64 (8%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  +++ASE+PFKGIF
Sbjct  49   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  104

Query  560  TSLP  571
            T+LP
Sbjct  105  TTLP  108



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 46/64 (72%), Gaps = 5/64 (8%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
            T++ AFRSL     RWSH +  + SP  L++QIR+A+PVL+   +  +++ASE+PFKGI 
Sbjct  44   TYSPAFRSL----ARWSHCLHSRPSPFRLSSQIRTASPVLDRLEKNFSSMASEHPFKGIL  99

Query  560  TSLP  571
            T+LP
Sbjct  100  TTLP  103



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 9/67 (13%)
 Frame = +2

Query  374  RPLTFAS-AFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFK  550
            R L F+S AFRSLR         V+++ P SL AQI +A PV+  F R+IAT+A EN FK
Sbjct  46   RSLRFSSSAFRSLR--------SVNFRPPMSLRAQIGAAVPVVEQFQRRIATMAPENAFK  97

Query  551  GIFTSLP  571
            GI T LP
Sbjct  98   GILTGLP  104



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 5/64 (8%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
            T + AFRSL    PRWSH +  + SP  L++QIR+ +P L+   R  +++ASE+PFKGIF
Sbjct  53   TSSPAFRSL----PRWSHCLHSRPSPFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  108

Query  560  TSLP  571
            T+LP
Sbjct  109  TTLP  112



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 3/49 (6%)
 Frame = +2

Query  392  SAFRSLRC---SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATI  529
            +A+RSL     SVPRWSHGV W SP +L +QIR+ APV+  F RKIA++
Sbjct  50   AAYRSLSSAVRSVPRWSHGVHWNSPYTLRSQIRAVAPVIQQFQRKIASM  98



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +2

Query  377  PLTFASAFRSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASEN-PFKG  553
            P +F +       +  RWSHGV W++P +L +QIR+ APV+    R+IAT+A E+ PFK 
Sbjct  42   PRSFTAQRLLSSSAATRWSHGVHWRAPYTLRSQIRAIAPVVERVQRRIATMAPESHPFKE  101

Query  554  IFTSLP  571
              TSLP
Sbjct  102  HLTSLP  107



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  401  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            RS   S+PR++      S  SL  QI + AP++  FHRKIAT+ASENPFKG  TSLP
Sbjct  40   RSFFYSLPRFNRRFHSSSHLSLRPQITAVAPLVERFHRKIATMASENPFKGNLTSLP  96



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 8/64 (13%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
            T + AFR       RWSH    K SP   T+QIR+ +PVL+   R  +++ASE+PFKGIF
Sbjct  51   TISPAFR-------RWSHSFHSKPSPFRFTSQIRAVSPVLDRLQRTFSSMASEHPFKGIF  103

Query  560  TSLP  571
            T+LP
Sbjct  104  TTLP  107



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  422  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIAS  535
            PRWSHGVDW SP SL AQ+R A PV+  F R+IATI S
Sbjct  67   PRWSHGVDWNSPGSLRAQVRIAVPVMERFRRRIATIGS  104



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWKSPASL--TAQIRSAAPVLNDFHRKIATIASENPFKGI  556
            +FA++  + R S+PRWSH +  + P S   ++QIR+ +PVL+   R  +++ASE+PFKGI
Sbjct  50   SFATSSPTFR-SLPRWSHCLHSR-PYSFRFSSQIRAVSPVLDRLERNFSSMASEHPFKGI  107

Query  557  FTSLP  571
            FTSLP
Sbjct  108  FTSLP  112



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 5/64 (8%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIF  559
            T + AFRSL    PRWSH +  + S   L++QIR+ +P L+   R  +++ASE+PFKGIF
Sbjct  52   TSSPAFRSL----PRWSHCLHSRPSLFRLSSQIRAVSPGLDRLERNFSSMASEHPFKGIF  107

Query  560  TSLP  571
            T+LP
Sbjct  108  TTLP  111



>ref|XP_007132546.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
 gb|ESW04540.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
Length=846

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  422  PRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            P+WSH +   SP +L   IR+ AP +  FHR+IA  A ENPFKG  TSLP
Sbjct  50   PQWSHRLRRVSPLTLRRPIRAVAPPVERFHREIAATAKENPFKGNLTSLP  99



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  401  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            RS   S+PR SH +  KS    L +QIR+ +PVL+   R  +++ASE+PFKGIFT+LP
Sbjct  40   RSFLTSLPRLSHCLHSKSFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLP  97



>ref|XP_010482909.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Camelina 
sativa]
Length=997

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +2

Query  392  SAFRSLRC--SVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTS  565
            SAFR  R   S  RWS   +W+ P S  AQ R AAP L  F RK A+IASE+ +K I T+
Sbjct  42   SAFRLFRVCSSATRWSQHANWRLPESFRAQTRIAAPRLEKFQRKFASIASEHAYKDILTT  101

Query  566  L  568
            L
Sbjct  102  L  102



>emb|CDY56501.1| BnaAnng14360D [Brassica napus]
Length=973

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 6/65 (9%)
 Frame = +2

Query  383  TFASAFRSLRCSVPRWSHGVDWK-SPASLTAQIRSAAPVLNDFHRKIATIASE-NPFKGI  556
            T + AFRSL    PRWSH +  + S   L++ IR+A+PVL+   R  +++ASE +PFKGI
Sbjct  42   TSSPAFRSL----PRWSHCLHSRPSLFRLSSHIRTASPVLDRLERNFSSMASEHHPFKGI  97

Query  557  FTSLP  571
            FT+LP
Sbjct  98   FTTLP  102



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +2

Query  401  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            RS   S+PR SH   +  P  + +QIR+ +PVL+   R  +++ASE+P+KGIFT+LP
Sbjct  40   RSFVTSLPRLSHSKPF--PLRIGSQIRAVSPVLDRLQRTFSSMASEHPYKGIFTTLP  94



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  401  RSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            RS   S+PR SH +  K     L +QIR+ +PVL+   R  +++ASE+PFKGIFT+LP
Sbjct  41   RSFLTSLPRLSHCLHSKPFQIRLGSQIRAVSPVLDRLQRTFSSMASEHPFKGIFTTLP  98



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 6/67 (9%)
 Frame = +2

Query  374  RPLTFASAFRSLRCSVPRWSHGVDWKS-PASLTAQIRSAAPVLNDFHRKIATIASENPFK  550
            R    +  FRSL    PRWSH +  +S P  +  QIR+ +PVL    +  +T+A E+PFK
Sbjct  54   RSFGASPGFRSL----PRWSHCLHRRSIPLRVGPQIRAVSPVLERLEKTFSTMA-EHPFK  108

Query  551  GIFTSLP  571
            GIFTSLP
Sbjct  109  GIFTSLP  115



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +2

Query  401  RSLRCSVPRWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            RS   S+PR++    + S  SL   I +  P +  FHR IAT+++ENPFKG  TSLP
Sbjct  40   RSFFSSIPRFNRRFHYTSYRSLRPHISAVTPGIERFHRTIATMSNENPFKGNLTSLP  96



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +2

Query  401  RSLRCSVP--RWSHGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSLP  571
            RS    +P  R      W+SP    A+IRS+A V+  F RK+AT+A+EN FK + TSLP
Sbjct  60   RSCSSYIPGSRVGLSTSWRSPIGPRARIRSSAAVIERFDRKMATVATENVFKDVLTSLP  118



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  434  HGVDWKSPASLTAQIRSAAPVLNDFHRKIATIASENPFKGIFTSL  568
            H  DW+SP S  AQIRS+A V   F R+ AT+A+ N ++ I TSL
Sbjct  67   HFGDWRSPLSHRAQIRSSAAVAERFERRFATMATRNSYESILTSL  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515