BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G10

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07428.1|  unnamed protein product                                168   4e-47   Coffea canephora [robusta coffee]
ref|XP_009598116.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       164   2e-45   
gb|EYU21873.1|  hypothetical protein MIMGU_mgv1a0218291mg               156   7e-45   Erythranthe guttata [common monkey flower]
ref|XP_009803495.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       161   2e-44   Nicotiana sylvestris
gb|EYU36767.1|  hypothetical protein MIMGU_mgv1a022586mg                159   2e-43   Erythranthe guttata [common monkey flower]
ref|XP_011083484.1|  PREDICTED: protein BASIC PENTACYSTEINE6            158   2e-43   Sesamum indicum [beniseed]
gb|ADV59385.1|  GAGA-binding transcriptional activator                  158   3e-43   Nicotiana tabacum [American tobacco]
ref|NP_001268020.1|  GAGA-binding transcriptional activator BBR/B...    153   2e-41   Vitis vinifera
ref|XP_006577804.1|  PREDICTED: uncharacterized protein LOC100783...    151   1e-40   Glycine max [soybeans]
gb|KHN45906.1|  Protein BASIC PENTACYSTEINE6                            151   1e-40   Glycine soja [wild soybean]
ref|XP_007136066.1|  hypothetical protein PHAVU_009G015000g             151   1e-40   Phaseolus vulgaris [French bean]
ref|XP_010105257.1|  hypothetical protein L484_019400                   149   7e-40   Morus notabilis
ref|NP_001242458.1|  uncharacterized protein LOC100783502               148   2e-39   
gb|ADV59376.1|  GAGA-binding transcriptional activator                  146   3e-39   Triphysaria pusilla
ref|XP_006280751.1|  hypothetical protein CARUB_v10026720mg             147   8e-39   Capsella rubella
ref|XP_010442173.1|  PREDICTED: protein BASIC PENTACYSTEINE6            146   8e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006581036.1|  PREDICTED: uncharacterized protein LOC100809...    146   9e-39   Glycine max [soybeans]
ref|XP_007222527.1|  hypothetical protein PRUPE_ppa008316mg             146   1e-38   Prunus persica
ref|XP_009610156.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       145   2e-38   
ref|XP_010052611.1|  PREDICTED: protein BASIC PENTACYSTEINE6            145   2e-38   Eucalyptus grandis [rose gum]
ref|XP_006473610.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    145   4e-38   Citrus sinensis [apfelsine]
emb|CDY70566.1|  BnaC06g42740D                                          145   4e-38   Brassica napus [oilseed rape]
ref|XP_006473611.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    144   4e-38   Citrus sinensis [apfelsine]
gb|KDO84770.1|  hypothetical protein CISIN_1g018368mg                   145   4e-38   Citrus sinensis [apfelsine]
gb|KDO84771.1|  hypothetical protein CISIN_1g018368mg                   144   4e-38   Citrus sinensis [apfelsine]
ref|XP_009104251.1|  PREDICTED: protein BASIC PENTACYSTEINE6            144   5e-38   Brassica rapa
emb|CDY69457.1|  BnaCnng63620D                                          144   5e-38   Brassica napus [oilseed rape]
ref|XP_008387967.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       144   6e-38   Malus domestica [apple tree]
ref|XP_006435127.1|  hypothetical protein CICLE_v10001400mg             144   7e-38   
ref|XP_002865511.1|  GAGA-binding transcriptional activator             144   8e-38   
ref|XP_006435130.1|  hypothetical protein CICLE_v10001400mg             144   2e-37   
ref|NP_001266214.1|  GAGA-binding transcriptional activator             142   2e-37   Solanum lycopersicum
ref|XP_002510492.1|  conserved hypothetical protein                     142   2e-37   Ricinus communis
ref|NP_568605.1|  basic pentacysteine 6                                 142   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009335373.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       142   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_010530298.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       142   4e-37   
ref|XP_010494188.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       142   5e-37   Camelina sativa [gold-of-pleasure]
ref|NP_001275364.1|  protein BASIC PENTACYSTEINE6-like                  141   5e-37   Solanum tuberosum [potatoes]
ref|XP_006402604.1|  hypothetical protein EUTSA_v10006075mg             142   5e-37   Eutrema salsugineum [saltwater cress]
gb|KDP36958.1|  hypothetical protein JCGZ_08249                         141   6e-37   Jatropha curcas
ref|XP_011028963.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       141   6e-37   Populus euphratica
gb|ADV59345.1|  GAGA-binding transcriptional activator                  141   7e-37   Populus trichocarpa [western balsam poplar]
ref|XP_002301996.2|  hypothetical protein POPTR_0002s02820g             141   8e-37   Populus trichocarpa [western balsam poplar]
ref|XP_004291398.1|  PREDICTED: protein BASIC PENTACYSTEINE6            140   2e-36   Fragaria vesca subsp. vesca
emb|CBI19813.3|  unnamed protein product                                133   3e-36   Vitis vinifera
ref|NP_001242497.1|  uncharacterized protein LOC100809369               140   3e-36   Glycine max [soybeans]
ref|XP_008377168.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       139   5e-36   Malus domestica [apple tree]
ref|XP_009337671.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       139   5e-36   Pyrus x bretschneideri [bai li]
ref|XP_008444782.1|  PREDICTED: protein BASIC PENTACYSTEINE6            139   6e-36   Cucumis melo [Oriental melon]
ref|XP_004152657.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       139   7e-36   Cucumis sativus [cucumbers]
ref|XP_007017722.1|  Basic pentacysteine 6                              137   4e-35   Theobroma cacao [chocolate]
gb|ABG57061.1|  GAGA-binding transcriptional activator                  136   6e-35   Cardamine pratensis [cuckoo flower]
ref|XP_010539043.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    136   9e-35   Tarenaya hassleriana [spider flower]
gb|ADV59370.1|  GAGA-binding transcriptional activator                  135   1e-34   Cichorium intybus [radicchio]
ref|XP_002306908.1|  hypothetical protein POPTR_0005s25720g             135   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_003589387.1|  GAGA-binding transcriptional activator             134   2e-34   Medicago truncatula
gb|ADV59404.1|  GAGA-binding transcriptional activator                  134   3e-34   Cardamine hirsuta
ref|XP_011045135.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       134   3e-34   Populus euphratica
gb|KHG09159.1|  basic pentacysteine6 -like protein                      134   3e-34   Gossypium arboreum [tree cotton]
gb|KJB14435.1|  hypothetical protein B456_002G124900                    134   3e-34   Gossypium raimondii
gb|ABC25623.1|  GAGA-binding transcriptional activator                  133   6e-34   Olimarabidopsis pumila
ref|XP_010481981.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    133   7e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008221307.1|  PREDICTED: protein BASIC PENTACYSTEINE6            133   1e-33   Prunus mume [ume]
ref|XP_006280750.1|  hypothetical protein CARUB_v10026720mg             132   3e-33   Capsella rubella
dbj|BAB10493.1|  unnamed protein product                                130   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138858.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    127   5e-32   Brassica rapa
ref|NP_001078690.1|  basic pentacysteine 6                              127   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670883.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       125   1e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009138854.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    123   3e-30   Brassica rapa
ref|XP_004499229.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       123   4e-30   Cicer arietinum [garbanzo]
gb|ADV59374.1|  GAGA-binding transcriptional activator                  121   1e-29   Triphysaria pusilla
gb|ADV59377.1|  GAGA-binding transcriptional activator                  120   3e-29   Triphysaria pusilla
gb|ABL10371.1|  GAGA-binding transcriptional activator                  117   4e-28   Medicago truncatula
ref|XP_010263912.1|  PREDICTED: protein BASIC PENTACYSTEINE6            115   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_009138860.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    115   3e-27   Brassica rapa
gb|KJB14434.1|  hypothetical protein B456_002G124900                    112   3e-26   Gossypium raimondii
ref|XP_010919161.1|  PREDICTED: barley B recombinant-like protein D     108   7e-25   Elaeis guineensis
ref|XP_008803316.1|  PREDICTED: barley B recombinant-like protein...    108   1e-24   Phoenix dactylifera
ref|XP_009116705.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    107   2e-24   Brassica rapa
emb|CDY41183.1|  BnaA09g38320D                                          107   2e-24   Brassica napus [oilseed rape]
ref|XP_008803315.1|  PREDICTED: barley B recombinant-like protein...    108   2e-24   Phoenix dactylifera
ref|XP_008779916.1|  PREDICTED: barley B recombinant-like protein...    107   4e-24   
ref|XP_008779943.1|  PREDICTED: barley B recombinant-like protein...    107   4e-24   
ref|XP_010933934.1|  PREDICTED: barley B recombinant-like protein D     107   4e-24   Elaeis guineensis
emb|CDX89057.1|  BnaA04g01290D                                          105   2e-23   
ref|XP_008776328.1|  PREDICTED: barley B recombinant-like protein...    105   2e-23   Phoenix dactylifera
ref|XP_009116701.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    104   2e-23   Brassica rapa
emb|CDX71826.1|  BnaC08g30480D                                          103   5e-23   
ref|XP_010271440.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    103   5e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010271438.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    103   6e-23   
ref|XP_010539045.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    101   4e-22   Tarenaya hassleriana [spider flower]
ref|XP_002278754.1|  PREDICTED: protein BASIC PENTACYSTEINE6 isof...  95.1    2e-21   Vitis vinifera
ref|XP_003634376.1|  PREDICTED: protein BASIC PENTACYSTEINE6 isof...  94.4    4e-21   Vitis vinifera
ref|XP_010940930.1|  PREDICTED: barley B recombinant-like protein D   96.7    2e-20   Elaeis guineensis
ref|XP_008803317.1|  PREDICTED: barley B recombinant-like protein...  95.9    3e-20   
emb|CDY42683.1|  BnaC04g22230D                                        94.4    1e-19   Brassica napus [oilseed rape]
ref|XP_010664774.1|  PREDICTED: protein BASIC PENTACYSTEINE6 isof...  89.7    4e-19   Vitis vinifera
ref|XP_010664775.1|  PREDICTED: protein BASIC PENTACYSTEINE6 isof...  89.4    4e-19   Vitis vinifera
ref|XP_010664772.1|  PREDICTED: protein BASIC PENTACYSTEINE6 isof...  89.0    6e-19   Vitis vinifera
ref|XP_009398067.1|  PREDICTED: barley B recombinant-like protein D   91.3    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI37978.3|  unnamed protein product                              89.7    2e-18   Vitis vinifera
ref|XP_008776335.1|  PREDICTED: barley B recombinant-like protein...  89.0    6e-18   
ref|XP_006852993.1|  hypothetical protein AMTR_s00185p00053640        87.8    7e-18   
ref|NP_001268018.1|  GAGA-binding transcriptional activator BBR/B...  88.6    9e-18   Vitis vinifera
ref|XP_006423509.1|  hypothetical protein CICLE_v10028887mg           88.2    1e-17   Citrus clementina [clementine]
ref|XP_006487267.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     87.8    2e-17   Citrus sinensis [apfelsine]
gb|ADV59380.1|  GAGA-binding transcriptional activator                87.0    3e-17   Helianthus annuus
ref|XP_009399386.1|  PREDICTED: barley B recombinant-like protein...  86.3    8e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010555253.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     85.1    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_009389696.1|  PREDICTED: barley B recombinant-like protein...  85.1    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009389670.1|  PREDICTED: barley B recombinant-like protein...  85.5    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010531487.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     84.0    4e-16   Tarenaya hassleriana [spider flower]
emb|CDY15905.1|  BnaA04g12060D                                        82.4    1e-15   Brassica napus [oilseed rape]
ref|XP_009140266.1|  PREDICTED: protein BASIC PENTACYSTEINE4          82.4    1e-15   Brassica rapa
ref|XP_011088552.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...  81.3    3e-15   
ref|XP_006404565.1|  hypothetical protein EUTSA_v10000273mg           81.3    3e-15   Eutrema salsugineum [saltwater cress]
ref|XP_007042009.1|  GAGA-motif binding transcriptional activator...  80.5    6e-15   
ref|XP_009789611.1|  PREDICTED: barley B recombinant-like protein D   80.5    6e-15   Nicotiana sylvestris
ref|XP_009611977.1|  PREDICTED: barley B recombinant-like protein D   80.1    7e-15   Nicotiana tomentosiformis
ref|XP_010416867.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     79.7    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010429023.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     79.7    1e-14   Camelina sativa [gold-of-pleasure]
emb|CDY70283.1|  BnaCnng67580D                                        79.3    1e-14   Brassica napus [oilseed rape]
ref|XP_010472104.1|  PREDICTED: protein BASIC PENTACYSTEINE4          79.3    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010908702.1|  PREDICTED: barley B recombinant-like protein...  79.7    1e-14   
ref|XP_006411681.1|  hypothetical protein EUTSA_v10025867mg           79.3    1e-14   Eutrema salsugineum [saltwater cress]
ref|XP_010908697.1|  PREDICTED: barley B recombinant-like protein...  79.3    2e-14   Elaeis guineensis
ref|XP_002880369.1|  ATBPC4/BBR/BPC4/BPC4                             79.0    2e-14   
ref|XP_006294544.1|  hypothetical protein CARUB_v10023579mg           79.0    2e-14   Capsella rubella
ref|XP_010908700.1|  PREDICTED: barley B recombinant-like protein...  79.3    2e-14   Elaeis guineensis
ref|XP_011099810.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like     79.0    2e-14   Sesamum indicum [beniseed]
gb|AAR25824.1|  basic pentacysteine 4                                 79.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565503.1|  basic pentacysteine 4                               79.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526572.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     78.6    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_006294545.1|  hypothetical protein CARUB_v10023579mg           79.0    3e-14   
ref|XP_009399389.1|  PREDICTED: barley B recombinant-like protein...  78.2    5e-14   
ref|XP_007042011.1|  GAGA-motif binding transcriptional activator...  77.4    6e-14   
gb|KJB11168.1|  hypothetical protein B456_001G243700                  76.6    8e-14   Gossypium raimondii
gb|EYU20522.1|  hypothetical protein MIMGU_mgv1a010119mg              77.4    8e-14   Erythranthe guttata [common monkey flower]
ref|XP_002513008.1|  conserved hypothetical protein                   77.0    1e-13   
ref|XP_004290338.1|  PREDICTED: protein BASIC PENTACYSTEINE4          77.0    1e-13   Fragaria vesca subsp. vesca
gb|KJB11170.1|  hypothetical protein B456_001G243700                  77.0    1e-13   Gossypium raimondii
ref|XP_011088547.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...  76.6    1e-13   Sesamum indicum [beniseed]
ref|NP_001266243.1|  GAGA-binding transcriptional activator           76.3    2e-13   Solanum lycopersicum
emb|CDX72731.1|  BnaC07g47530D                                        75.9    2e-13   
ref|NP_001275213.1|  barley B recombinant-like protein D-like         76.3    2e-13   Solanum tuberosum [potatoes]
ref|XP_009101921.1|  PREDICTED: protein BASIC PENTACYSTEINE5-like     75.9    2e-13   Brassica rapa
emb|CDY22406.1|  BnaA06g37280D                                        75.9    2e-13   Brassica napus [oilseed rape]
ref|XP_010095680.1|  hypothetical protein L484_012253                 75.9    3e-13   Morus notabilis
ref|XP_010645040.1|  PREDICTED: GAGA-binding transcriptional acti...  75.1    4e-13   Vitis vinifera
ref|XP_009418729.1|  PREDICTED: barley B recombinant-like protein D   75.9    4e-13   
gb|KJB11171.1|  hypothetical protein B456_001G243700                  73.2    1e-12   Gossypium raimondii
ref|XP_002305467.1|  hypothetical protein POPTR_0004s17060g           74.3    1e-12   Populus trichocarpa [western balsam poplar]
gb|ABK93737.1|  unknown                                               74.3    1e-12   Populus trichocarpa [western balsam poplar]
emb|CDP01919.1|  unnamed protein product                              74.3    1e-12   Coffea canephora [robusta coffee]
ref|XP_010431840.1|  PREDICTED: LOW QUALITY PROTEIN: protein BASI...  73.9    1e-12   
gb|KHG11898.1|  basic pentacysteine4 -like protein                    73.9    1e-12   Gossypium arboreum [tree cotton]
ref|XP_004230934.1|  PREDICTED: protein BASIC PENTACYSTEINE5-like     73.9    1e-12   Solanum lycopersicum
gb|ADV59368.1|  GAGA-binding transcriptional activator                73.6    1e-12   Artemisia annua [sweet Annie]
gb|KDP27630.1|  hypothetical protein JCGZ_19635                       73.6    2e-12   Jatropha curcas
gb|ADV59381.1|  GAGA-binding transcriptional activator                72.8    2e-12   Helianthus annuus
ref|XP_008236825.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...  73.2    3e-12   Prunus mume [ume]
ref|XP_008236826.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...  72.8    3e-12   Prunus mume [ume]
ref|XP_007201267.1|  hypothetical protein PRUPE_ppa008471mg           73.2    4e-12   Prunus persica
ref|XP_007201266.1|  hypothetical protein PRUPE_ppa008471mg           72.8    4e-12   Prunus persica
ref|XP_009804621.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     72.4    5e-12   Nicotiana sylvestris
ref|XP_002868871.1|  hypothetical protein ARALYDRAFT_327841           73.6    6e-12   
ref|XP_004148546.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     72.0    6e-12   Cucumis sativus [cucumbers]
ref|XP_004172323.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     72.4    7e-12   
ref|NP_001274818.1|  protein BASIC PENTACYSTEINE4-like                72.0    7e-12   Solanum tuberosum [potatoes]
emb|CDO96980.1|  unnamed protein product                              72.0    7e-12   Coffea canephora [robusta coffee]
ref|XP_006359607.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     72.0    7e-12   
ref|XP_009379565.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  72.0    8e-12   Pyrus x bretschneideri [bai li]
ref|XP_008448032.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     71.6    9e-12   Cucumis melo [Oriental melon]
ref|XP_009378461.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  71.2    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_009378460.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  71.2    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_009627340.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  70.5    2e-11   Nicotiana tomentosiformis
ref|XP_009378459.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  71.2    2e-11   
ref|XP_009627338.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  70.9    2e-11   Nicotiana tomentosiformis
gb|ABK96608.1|  unknown                                               70.9    2e-11   Populus trichocarpa x Populus deltoides
ref|XP_011037231.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     70.9    2e-11   Populus euphratica
gb|ABU63290.1|  GAGA-motif binding transcriptional activator          70.1    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190957.1|  basic pentacysteine 5                            69.7    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ABU63289.1|  GAGA-motif binding transcriptional activator          70.1    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ABU63288.1|  GAGA-motif binding transcriptional activator          69.7    3e-11   Cardamine pratensis [cuckoo flower]
emb|CAB38811.1|  putative protein                                     70.9    4e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EMS63619.1|  hypothetical protein TRIUR3_11677                     70.5    4e-11   Triticum urartu
ref|NP_001078691.1|  basic pentacysteine 6                            69.3    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109516.1|  PREDICTED: protein BASIC PENTACYSTEINE5-like     69.3    5e-11   Brassica rapa
ref|XP_008382361.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...  69.7    5e-11   
ref|XP_004964426.1|  PREDICTED: barley B recombinant-like protein...  69.7    6e-11   Setaria italica
ref|XP_002313754.1|  hypothetical protein POPTR_0009s12820g           69.3    6e-11   
ref|XP_008365900.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  69.7    7e-11   
ref|XP_008365901.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  69.3    7e-11   Malus domestica [apple tree]
ref|XP_006655749.1|  PREDICTED: barley B recombinant-like protein...  69.3    9e-11   Oryza brachyantha
ref|XP_006379265.1|  hypothetical protein POPTR_0009s12820g           68.9    1e-10   Populus trichocarpa [western balsam poplar]
gb|EAY99518.1|  hypothetical protein OsI_21488                        67.8    1e-10   Oryza sativa Indica Group [Indian rice]
dbj|BAK06066.1|  predicted protein                                    68.6    1e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05756.1|  predicted protein                                    68.6    1e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY12110.1|  BnaC03g60260D                                        67.8    1e-10   Brassica napus [oilseed rape]
ref|NP_195602.5|  basic pentacysteine 5                               67.4    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444881.1|  PREDICTED: protein BASIC PENTACYSTEINE5-like     67.0    2e-10   Camelina sativa [gold-of-pleasure]
ref|NP_001141822.1|  BBR/BPC transcription factor                     67.8    2e-10   Zea mays [maize]
gb|EPS70368.1|  hypothetical protein M569_04392                       66.6    2e-10   Genlisea aurea
gb|AGT17153.1|  basic pentacysteine 6                                 67.4    3e-10   Saccharum hybrid cultivar R570
gb|EAZ35708.1|  hypothetical protein OsJ_19997                        67.0    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011047142.1|  PREDICTED: protein BASIC PENTACYSTEINE4          67.0    5e-10   Populus euphratica
ref|XP_009379566.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  66.2    5e-10   Pyrus x bretschneideri [bai li]
ref|NP_001056691.1|  Os06g0130600                                     66.6    7e-10   
emb|CDY42593.1|  BnaC01g00050D                                        65.5    9e-10   Brassica napus [oilseed rape]
ref|XP_009378464.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  65.5    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_010028660.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...  65.1    2e-09   Eucalyptus grandis [rose gum]
gb|ABR17349.1|  unknown                                               64.7    3e-09   Picea sitchensis
gb|ADV59364.1|  GAGA-binding transcriptional activator                64.7    3e-09   Picea sitchensis
ref|XP_002437754.1|  hypothetical protein SORBIDRAFT_10g002020        64.3    4e-09   Sorghum bicolor [broomcorn]
gb|EYU40418.1|  hypothetical protein MIMGU_mgv1a012572mg              63.2    4e-09   Erythranthe guttata [common monkey flower]
gb|ADV59358.1|  GAGA-binding transcriptional activator                63.9    4e-09   Pinus taeda
ref|XP_008382362.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...  63.9    5e-09   
gb|ADV59357.1|  GAGA-binding transcriptional activator                63.9    5e-09   Pinus taeda
ref|XP_010028658.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...  63.9    5e-09   Eucalyptus grandis [rose gum]
ref|XP_003532442.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  63.9    5e-09   Glycine max [soybeans]
ref|XP_009137623.1|  PREDICTED: protein BASIC PENTACYSTEINE5-like     63.2    8e-09   Brassica rapa
ref|XP_003557130.1|  PREDICTED: barley B recombinant-like protein D   63.5    9e-09   Brachypodium distachyon [annual false brome]
emb|CDY41951.1|  BnaA01g05230D                                        62.8    9e-09   Brassica napus [oilseed rape]
ref|XP_003525427.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  62.8    1e-08   Glycine max [soybeans]
gb|ADE76107.1|  unknown                                               60.8    5e-08   Picea sitchensis
gb|ABC25620.1|  GAGA-binding transcriptional activator                56.2    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010667727.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     59.3    2e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007159983.1|  hypothetical protein PHAVU_002G283200g           57.8    7e-07   Phaseolus vulgaris [French bean]
gb|AET05031.2|  GAGA-binding transcriptional activator BBR/BPC6-l...  57.4    1e-06   Medicago truncatula
ref|XP_003630555.1|  GAGA-binding transcriptional activator BBR/B...  57.4    1e-06   
gb|ADV59402.1|  GAGA-binding transcriptional activator                57.0    1e-06   Lotus japonicus
emb|CDX82011.1|  BnaC08g35900D                                        53.5    6e-06   
ref|XP_004503784.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...  53.9    1e-05   Cicer arietinum [garbanzo]
ref|XP_006844102.1|  hypothetical protein AMTR_s00006p00254090        53.5    2e-05   Amborella trichopoda
gb|AFB34871.1|  hypothetical protein UMN_6093_01                      48.1    2e-04   Pinus mugo [mountain pine]
gb|EOS76789.1|  hypothetical protein C819_01404                       49.7    4e-04   Lachnospiraceae bacterium 10-1
gb|ADV59362.1|  GAGA-binding transcriptional activator                49.3    5e-04   Physcomitrella patens
gb|ABR18188.1|  unknown                                               49.3    6e-04   Picea sitchensis
gb|AFB34868.1|  hypothetical protein UMN_6093_01                      46.6    8e-04   Pinus cembra [Arve]



>emb|CDP07428.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   168 bits (425),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D GHRENGRHK PQGQWLMQHQP+MKQIM IMAERDAAIQERNLALSEKKAALAERD AI
Sbjct  3    DSGHRENGRHKPPQGQWLMQHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAERDMAI  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            LQRD+AIAERNNAIMERDNAIATLQY E+S+N+G+MSPCPPGC
Sbjct  63   LQRDSAIAERNNAIMERDNAIATLQYRENSINSGNMSPCPPGC  105



>ref|XP_009598116.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598120.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598126.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598131.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598139.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598144.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598150.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598160.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598169.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598173.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598182.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
Length=332

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D GH ENGRHK PQGQW +QHQP+MKQIM IMAERDAAIQERNLALSEK+A LAERD AI
Sbjct  3    DSGHHENGRHKPPQGQWFLQHQPSMKQIMAIMAERDAAIQERNLALSEKRATLAERDMAI  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            LQRD+AIAERN+AIMERDNAIATLQY E+SMN+G+MSPCPPGC
Sbjct  63   LQRDSAIAERNSAIMERDNAIATLQYQENSMNSGNMSPCPPGC  105



>gb|EYU21873.1| hypothetical protein MIMGU_mgv1a0218291mg, partial [Erythranthe 
guttata]
Length=136

 Score =   156 bits (395),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 2/105 (2%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D GHRENGRHK PQGQWLMQ QP+MKQIMG MAERDAAIQERNLA+SEKK ALAERD AI
Sbjct  3    DSGHRENGRHKPPQGQWLMQQQPSMKQIMGFMAERDAAIQERNLAISEKKTALAERDMAI  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHESSMNTG--SMSPCPPGC  569
            LQRD+AIAERNNAIMERDNAIATLQY E+++N+   +MSPCPPG 
Sbjct  63   LQRDSAIAERNNAIMERDNAIATLQYRENAINSSNNNMSPCPPGL  107



>ref|XP_009803495.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803496.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803498.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803499.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803500.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803501.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803502.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803503.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803504.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803505.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803506.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803507.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
Length=333

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D GH EN RHK PQGQW MQHQP+MKQIM IM ERDAAIQERNLALSEK+AALAERD AI
Sbjct  3    DSGHHENARHKPPQGQWFMQHQPSMKQIMAIMGERDAAIQERNLALSEKRAALAERDMAI  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            LQRD+AIAERN+AIMERDNAIATLQY E+SMN+G+MSPCPPGC
Sbjct  63   LQRDSAIAERNSAIMERDNAIATLQYRENSMNSGNMSPCPPGC  105



>gb|EYU36767.1| hypothetical protein MIMGU_mgv1a022586mg, partial [Erythranthe 
guttata]
Length=341

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 2/105 (2%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D GHRENGRHK PQGQWLMQ QP+MKQIMG MAERDAAIQERNLA+SEKK ALAERD AI
Sbjct  3    DSGHRENGRHKPPQGQWLMQQQPSMKQIMGFMAERDAAIQERNLAISEKKTALAERDMAI  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHESSMNTG--SMSPCPPGC  569
            LQRD+AIAERNNAIMERDNAIATLQY E+++N+   +MSPCPPGC
Sbjct  63   LQRDSAIAERNNAIMERDNAIATLQYRENAINSSNNNMSPCPPGC  107



>ref|XP_011083484.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083485.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083486.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083487.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083488.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083489.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083490.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083491.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083492.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083493.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083494.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
Length=323

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D GHRENGRHK P  QWLMQHQP+MKQIM IMAERDAAIQERNLA+SEKKAALAERD AI
Sbjct  3    DSGHRENGRHKQPHSQWLMQHQPSMKQIMAIMAERDAAIQERNLAISEKKAALAERDMAI  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            LQRD+AIAERNNAIMERDNAIATLQ+ E++MN  + SPCPPGC
Sbjct  63   LQRDSAIAERNNAIMERDNAIATLQFRENAMNNSNTSPCPPGC  105



>gb|ADV59385.1| GAGA-binding transcriptional activator [Nicotiana tabacum]
Length=333

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D G+ EN RHK PQGQW MQHQP+MKQIM IM ERDAAIQERNLALSEK+AALAERD AI
Sbjct  3    DSGNHENARHKPPQGQWFMQHQPSMKQIMAIMGERDAAIQERNLALSEKRAALAERDMAI  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            LQRD+AIAERN+AIMERDNAIATLQY E+SMN+G+MSPCPPGC
Sbjct  63   LQRDSAIAERNSAIMERDNAIATLQYRENSMNSGNMSPCPPGC  105



>ref|NP_001268020.1| GAGA-binding transcriptional activator BBR/BPC6-like [Vitis vinifera]
 ref|XP_010664073.1| PREDICTED: GAGA-binding transcriptional activator BBR/BPC6-like 
isoform X1 [Vitis vinifera]
 gb|ACC64529.1| GAGA-binding transcriptional activator BBR/BPC6-like [Vitis vinifera]
 gb|ACC64530.1| GAGA-binding transcriptional activator BBR/BPC6-like [Vitis vinifera]
Length=337

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 94/110 (85%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKLP-----QGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MD+G HRENGRHK         QWLMQHQPTMKQIM IMAERD A+QERNLALSEKKAA+
Sbjct  1    MDEGGHRENGRHKADPYKAVHSQWLMQHQPTMKQIMAIMAERDTAVQERNLALSEKKAAV  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRDTAIAERNNAIMERDNAIATLQY E+S+N G+MSPCPPGC
Sbjct  61   AERDMAFLQRDTAIAERNNAIMERDNAIATLQYRENSLNGGNMSPCPPGC  110



>ref|XP_006577804.1| PREDICTED: uncharacterized protein LOC100783502 isoform X1 [Glycine 
max]
 ref|XP_006577805.1| PREDICTED: uncharacterized protein LOC100783502 isoform X2 [Glycine 
max]
Length=338

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 94/111 (85%), Gaps = 7/111 (6%)
 Frame = +3

Query  258  MDD-GHRENGRHKLP------QGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaa  416
            MDD GHRENGRHK        QGQWLMQHQP+MKQIM IMAERDAAIQERNLA+SEKKAA
Sbjct  1    MDDAGHRENGRHKAADQYKSAQGQWLMQHQPSMKQIMAIMAERDAAIQERNLAISEKKAA  60

Query  417  laeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
             AERD A +QRD AIAERNNAI+ERDNAIATLQY E+S+++GSM  CPPGC
Sbjct  61   YAERDMAFMQRDAAIAERNNAILERDNAIATLQYRETSLSSGSMPSCPPGC  111



>gb|KHN45906.1| Protein BASIC PENTACYSTEINE6 [Glycine soja]
Length=338

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 94/111 (85%), Gaps = 7/111 (6%)
 Frame = +3

Query  258  MDD-GHRENGRHKLP------QGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaa  416
            MDD GHRENGRHK        QGQWLMQHQP+MKQIM IMAERDAAIQERNLA+SEKKAA
Sbjct  1    MDDAGHRENGRHKAADQYKSAQGQWLMQHQPSMKQIMAIMAERDAAIQERNLAISEKKAA  60

Query  417  laeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
             AERD A +QRD AIAERNNAI+ERDNAIATLQY E+S+++GSM  CPPGC
Sbjct  61   YAERDMAFMQRDAAIAERNNAILERDNAIATLQYRETSLSSGSMPSCPPGC  111



>ref|XP_007136066.1| hypothetical protein PHAVU_009G015000g [Phaseolus vulgaris]
 gb|ESW08060.1| hypothetical protein PHAVU_009G015000g [Phaseolus vulgaris]
Length=337

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 93/110 (85%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDD-GHRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDD GHRENGRHK       QGQWLMQHQP+MKQIM IMAERDAAIQERNLA+SEKKAA 
Sbjct  1    MDDAGHRENGRHKADQFKSAQGQWLMQHQPSMKQIMAIMAERDAAIQERNLAISEKKAAY  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRD AIAERNNAI+ERDNA ATLQY E+S+++GSM  CPPGC
Sbjct  61   AERDMAFLQRDAAIAERNNAILERDNAFATLQYRETSLSSGSMPSCPPGC  110



>ref|XP_010105257.1| hypothetical protein L484_019400 [Morus notabilis]
 gb|EXC04192.1| hypothetical protein L484_019400 [Morus notabilis]
Length=337

 Score =   149 bits (377),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQW+MQHQP+MKQIM +MAERDAAIQERNLAL+EKKAAL
Sbjct  1    MDDGGHRENGRHKGDQYKTAQGQWMMQHQPSMKQIMALMAERDAAIQERNLALAEKKAAL  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRD AIAERNNAIMERDNA+ATLQY E+S++ G+MS CPPGC
Sbjct  61   AERDMAFLQRDAAIAERNNAIMERDNAVATLQYRENSLSNGNMSSCPPGC  110



>ref|NP_001242458.1| uncharacterized protein LOC100783502 [Glycine max]
 gb|ACU18145.1| unknown [Glycine max]
Length=338

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 93/111 (84%), Gaps = 7/111 (6%)
 Frame = +3

Query  258  MDD-GHRENGRHKLP------QGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaa  416
            MDD GHRENGRHK        Q QWLMQHQP+MKQIM IMAERDAAIQERNLA+SEKKAA
Sbjct  1    MDDAGHRENGRHKAADQYKSAQRQWLMQHQPSMKQIMAIMAERDAAIQERNLAISEKKAA  60

Query  417  laeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
             AERD A +QRD AIAERNNAI+ERDNAIATLQY E+S+++GSM  CPPGC
Sbjct  61   YAERDMAFMQRDAAIAERNNAILERDNAIATLQYRETSLSSGSMPSCPPGC  111



>gb|ADV59376.1| GAGA-binding transcriptional activator [Triphysaria pusilla]
Length=279

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 89/103 (86%), Gaps = 2/103 (2%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D+GHRENGRHK PQ QWLM HQP+MK IM IMAERDAAIQERNLALSEKK ALAERD AI
Sbjct  3    DNGHRENGRHKQPQSQWLMHHQPSMKHIMSIMAERDAAIQERNLALSEKKTALAERDMAI  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            LQRD+AI +RNNAIMERDNA  TLQY E+S+N  S +PCPPGC
Sbjct  63   LQRDSAINDRNNAIMERDNAFTTLQYRETSIN--SNTPCPPGC  103



>ref|XP_006280751.1| hypothetical protein CARUB_v10026720mg [Capsella rubella]
 gb|EOA13649.1| hypothetical protein CARUB_v10026720mg [Capsella rubella]
Length=343

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 93/108 (86%), Gaps = 4/108 (4%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HRENGRHK  QGQW+MQHQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD 
Sbjct  1    MDDGGHRENGRHKAAQGQWMMQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAIAERDM  60

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGS---MSPCPPGC  569
            A LQRDTAIAERNNAIMERD+A+  LQY E+SM T +   MS CPPGC
Sbjct  61   AFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAASANMSACPPGC  108



>ref|XP_010442173.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Camelina sativa]
Length=342

 Score =   146 bits (369),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 93/108 (86%), Gaps = 4/108 (4%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HRENGRHK  QGQW+MQHQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD 
Sbjct  1    MDDGGHRENGRHKAAQGQWMMQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAIAERDM  60

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGS---MSPCPPGC  569
            A LQRDTAIAERNNAIMERD+A+  LQY E+SM T +   MS CPPGC
Sbjct  61   AFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAAAANMSACPPGC  108



>ref|XP_006581036.1| PREDICTED: uncharacterized protein LOC100809369 isoform X1 [Glycine 
max]
 ref|XP_006581037.1| PREDICTED: uncharacterized protein LOC100809369 isoform X2 [Glycine 
max]
 ref|XP_006581038.1| PREDICTED: uncharacterized protein LOC100809369 isoform X3 [Glycine 
max]
 ref|XP_006581039.1| PREDICTED: uncharacterized protein LOC100809369 isoform X4 [Glycine 
max]
 ref|XP_006581040.1| PREDICTED: uncharacterized protein LOC100809369 isoform X5 [Glycine 
max]
 ref|XP_006581041.1| PREDICTED: uncharacterized protein LOC100809369 isoform X6 [Glycine 
max]
 ref|XP_006581042.1| PREDICTED: uncharacterized protein LOC100809369 isoform X7 [Glycine 
max]
 gb|KHN09107.1| Protein BASIC PENTACYSTEINE6 [Glycine soja]
Length=337

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 94/111 (85%), Gaps = 7/111 (6%)
 Frame = +3

Query  258  MDD-GHRENGRHKLP------QGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaa  416
            MDD GHRENGRHK        QGQWLMQHQP+MKQIM ++AERDAAIQERNLA+SEKKAA
Sbjct  1    MDDAGHRENGRHKAADQYKSAQGQWLMQHQPSMKQIMAMIAERDAAIQERNLAISEKKAA  60

Query  417  laeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
             AERD A +QRD AIAERNNA++ERDNAIATLQY E+S+++GSM  CPPGC
Sbjct  61   YAERDMAYMQRDAAIAERNNAMLERDNAIATLQYRETSLSSGSMPSCPPGC  111



>ref|XP_007222527.1| hypothetical protein PRUPE_ppa008316mg [Prunus persica]
 gb|EMJ23726.1| hypothetical protein PRUPE_ppa008316mg [Prunus persica]
Length=337

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 88/108 (81%), Gaps = 5/108 (5%)
 Frame = +3

Query  261  DDGHRENGR-----HKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalae  425
            D GHRENGR     +K  QGQWLMQHQP+MKQIM IM ERDAAIQERNLA SEKKAAL E
Sbjct  3    DSGHRENGRIKAEQYKAAQGQWLMQHQPSMKQIMAIMGERDAAIQERNLAFSEKKAALQE  62

Query  426  RDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            RD A LQRD AIAERN AIMERDNAIA LQY E+S+N G++S CPPGC
Sbjct  63   RDMAFLQRDAAIAERNTAIMERDNAIANLQYRENSLNNGNVSSCPPGC  110



>ref|XP_009610156.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009610157.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009798749.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009798750.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009798751.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 gb|AII99808.1| GAGA-binding transcriptional activator [Nicotiana tabacum]
Length=327

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D GHR+NGRHK PQGQWLMQHQP+MKQIM IMAERDAAIQERNLALSEKKAALAERD AI
Sbjct  3    DSGHRDNGRHKPPQGQWLMQHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAERDMAI  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHESSMNTG  542
            LQRD+AIAERNNAIMERDNAIATLQY ESS++ G
Sbjct  63   LQRDSAIAERNNAIMERDNAIATLQYRESSISGG  96



>ref|XP_010052611.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 ref|XP_010052612.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 ref|XP_010052613.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 ref|XP_010052615.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 ref|XP_010052616.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 ref|XP_010052617.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 gb|KCW76693.1| hypothetical protein EUGRSUZ_D01054 [Eucalyptus grandis]
 gb|KCW76694.1| hypothetical protein EUGRSUZ_D01054 [Eucalyptus grandis]
Length=323

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 93/110 (85%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       Q QWLMQHQP+MKQIMGIMAERDAA+QERNLALSEKKAA+
Sbjct  1    MDDGGHRENGRHKADHYKNAQSQWLMQHQPSMKQIMGIMAERDAALQERNLALSEKKAAI  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A  QRD AIAERNNA +ERDNAIATLQY E+S+ +G++S CPPGC
Sbjct  61   AERDIAFHQRDMAIAERNNAYLERDNAIATLQYRENSLTSGNISSCPPGC  110



>ref|XP_006473610.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Citrus 
sinensis]
Length=357

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 101/132 (77%), Gaps = 10/132 (8%)
 Frame = +3

Query  201  LSLIKSWK*RW*LSRSQF*---MDDG-HRENGRHKL-----PQGQWLMQHQPTMKQIMGI  353
            +S+   W     L+ S F    MDDG HRENGRHK       QGQWLM HQP+MKQIM I
Sbjct  1    MSIFFCWVAYLLLANSTFCASQMDDGGHRENGRHKADQYKAAQGQWLMHHQPSMKQIMTI  60

Query  354  MAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSM  533
            MAERDAA+QERNLA SEKKAA+AERD A LQRDTAIAERNNAI+ERDNAIA+LQY E+S+
Sbjct  61   MAERDAALQERNLATSEKKAAIAERDMAFLQRDTAIAERNNAILERDNAIASLQYRENSL  120

Query  534  NTGSMSPCPPGC  569
              G+MS CPPGC
Sbjct  121  G-GNMSSCPPGC  131



>emb|CDY70566.1| BnaC06g42740D [Brassica napus]
Length=339

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HR+NGRHK PQGQW+MQHQP+MKQ+M I+AERDAAIQERNLA+SE+K+A+AERD 
Sbjct  1    MDDGGHRDNGRHKTPQGQWMMQHQPSMKQVMSIIAERDAAIQERNLAISERKSAVAERDM  60

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGS-----MSPCPPGC  569
            A LQRDTAIAERNNAIMERD+A++ LQY E+SM T S      + CPPGC
Sbjct  61   AFLQRDTAIAERNNAIMERDSALSALQYRENSMATPSAVSNMAAACPPGC  110



>ref|XP_006473611.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Citrus 
sinensis]
 ref|XP_006473612.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X3 [Citrus 
sinensis]
Length=335

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 93/110 (85%), Gaps = 7/110 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLM HQP+MKQIM IMAERDAA+QERNLA SEKKAA+
Sbjct  1    MDDGGHRENGRHKADQYKAAQGQWLMHHQPSMKQIMTIMAERDAALQERNLATSEKKAAI  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRDTAIAERNNAI+ERDNAIA+LQY E+S+  G+MS CPPGC
Sbjct  61   AERDMAFLQRDTAIAERNNAILERDNAIASLQYRENSLG-GNMSSCPPGC  109



>gb|KDO84770.1| hypothetical protein CISIN_1g018368mg [Citrus sinensis]
Length=357

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 101/132 (77%), Gaps = 10/132 (8%)
 Frame = +3

Query  201  LSLIKSWK*RW*LSRSQF*---MDDG-HRENGRHKL-----PQGQWLMQHQPTMKQIMGI  353
            +S+   W     L+ S F    MDDG HRENGRHK       QGQWLM HQP+MKQIM I
Sbjct  1    MSIFFCWVAYLLLANSTFCASQMDDGGHRENGRHKADQYKAAQGQWLMHHQPSMKQIMTI  60

Query  354  MAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSM  533
            MAERDAA+QERNLA SEKKAA+AERD A LQRDTAIAERNNAI+ERDNAIA+LQY E+S+
Sbjct  61   MAERDAALQERNLATSEKKAAIAERDMAFLQRDTAIAERNNAILERDNAIASLQYRENSL  120

Query  534  NTGSMSPCPPGC  569
              G+MS CPPGC
Sbjct  121  G-GNMSSCPPGC  131



>gb|KDO84771.1| hypothetical protein CISIN_1g018368mg [Citrus sinensis]
 gb|KDO84772.1| hypothetical protein CISIN_1g018368mg [Citrus sinensis]
Length=335

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 93/110 (85%), Gaps = 7/110 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLM HQP+MKQIM IMAERDAA+QERNLA SEKKAA+
Sbjct  1    MDDGGHRENGRHKADQYKAAQGQWLMHHQPSMKQIMTIMAERDAALQERNLATSEKKAAI  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRDTAIAERNNAI+ERDNAIA+LQY E+S+  G+MS CPPGC
Sbjct  61   AERDMAFLQRDTAIAERNNAILERDNAIASLQYRENSLG-GNMSSCPPGC  109



>ref|XP_009104251.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Brassica rapa]
 gb|ABP96709.1| GAGA-binding transcriptional activator [Brassica rapa subsp. 
pekinensis]
 gb|ABP96710.1| GAGA-binding transcriptional activator [Brassica rapa subsp. 
pekinensis]
Length=341

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HR+NGRHK PQGQW+MQHQP+MKQ+M I+AERDAAIQERNLA+SE+K+A+AERD 
Sbjct  1    MDDGGHRDNGRHKAPQGQWMMQHQPSMKQVMSIIAERDAAIQERNLAISERKSAVAERDM  60

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGS-----MSPCPPGC  569
            A LQRDTAIAERNNAIMERD+A++ LQY E+SM T S      + CPPGC
Sbjct  61   AFLQRDTAIAERNNAIMERDSALSALQYRENSMATPSAVSNMAAACPPGC  110



>emb|CDY69457.1| BnaCnng63620D [Brassica napus]
Length=325

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HR+NGRHK PQGQW+MQHQP+MKQ+M I+AERDAAIQERNLA+SE+K+A+AERD 
Sbjct  1    MDDGGHRDNGRHKAPQGQWMMQHQPSMKQVMSIIAERDAAIQERNLAISERKSAVAERDM  60

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGS-----MSPCPPGC  569
            A LQRDTAIAERNNAIMERD+A++ LQY E+SM T S      + CPPGC
Sbjct  61   AFLQRDTAIAERNNAIMERDSALSALQYRENSMATPSAVSNMAAACPPGC  110



>ref|XP_008387967.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Malus domestica]
Length=340

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 93/110 (85%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLM +QP+MKQIM IM ERDAAIQERNLA SEKKAAL
Sbjct  1    MDDGGHRENGRHKADQYKAAQGQWLMHNQPSMKQIMAIMGERDAAIQERNLAFSEKKAAL  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRD AIAERN+AIMERDNAIATLQY ++S+N+G++S CPPGC
Sbjct  61   AERDMAFLQRDAAIAERNSAIMERDNAIATLQYRDNSLNSGNVSSCPPGC  110



>ref|XP_006435127.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 ref|XP_006435128.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 ref|XP_006435129.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 ref|XP_006435131.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 gb|ESR48367.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 gb|ESR48368.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 gb|ESR48369.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 gb|ESR48371.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
Length=335

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 7/110 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLM HQP+MKQIM IMAERDAA+QERNLA+SEKKAA+
Sbjct  1    MDDGGHRENGRHKADQYKAAQGQWLMHHQPSMKQIMTIMAERDAALQERNLAISEKKAAI  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRDTAIAERNNAI+ERDNAIA+LQY E+S+  G+MS CPPGC
Sbjct  61   AERDMAFLQRDTAIAERNNAILERDNAIASLQYRENSLG-GNMSSCPPGC  109



>ref|XP_002865511.1| GAGA-binding transcriptional activator [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41770.1| GAGA-binding transcriptional activator [Arabidopsis lyrata subsp. 
lyrata]
Length=332

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 93/109 (85%), Gaps = 5/109 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKLP-QGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRD  431
            MDDG HRENGRHK   QGQWLMQHQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD
Sbjct  1    MDDGGHRENGRHKAAAQGQWLMQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERD  60

Query  432  TAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGS---MSPCPPGC  569
             A LQRDTAIAERNNAIMERD+A+  LQY E+SM T +   MS CPPGC
Sbjct  61   MAFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAAATNMSACPPGC  109



>ref|XP_006435130.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 gb|ESR48370.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
Length=395

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 7/110 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLM HQP+MKQIM IMAERDAA+QERNLA+SEKKAA+
Sbjct  61   MDDGGHRENGRHKADQYKAAQGQWLMHHQPSMKQIMTIMAERDAALQERNLAISEKKAAI  120

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRDTAIAERNNAI+ERDNAIA+LQY E+S+  G+MS CPPGC
Sbjct  121  AERDMAFLQRDTAIAERNNAILERDNAIASLQYRENSLG-GNMSSCPPGC  169



>ref|NP_001266214.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
 ref|XP_010320046.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320047.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320048.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320049.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320050.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320051.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320052.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320053.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320054.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 gb|ADV59391.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
 gb|ADV59392.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
Length=323

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D G+R+NGRHK PQGQWLMQHQP+MKQIM IMAERDAAIQERNLALSEKKAALAERD AI
Sbjct  3    DSGNRDNGRHKPPQGQWLMQHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAERDMAI  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSM  548
            LQRD+AIAERNNAIMERDNA ATLQY E+SM  G +
Sbjct  63   LQRDSAIAERNNAIMERDNAFATLQYRETSMTAGQI  98



>ref|XP_002510492.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52679.1| conserved hypothetical protein [Ricinus communis]
Length=339

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 94/111 (85%), Gaps = 7/111 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLMQ QP+MKQIM IMAERDAAI ERN+A+SEKKAA+
Sbjct  1    MDDGGHRENGRHKADQYKTAQGQWLMQAQPSMKQIMAIMAERDAAIHERNMAISEKKAAI  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSM-SPCPPGC  569
            AERD A LQRD+AIAERNNAIMERDNAIATLQY E+S+ +G+M S CPPGC
Sbjct  61   AERDMAFLQRDSAIAERNNAIMERDNAIATLQYRENSIPSGNMPSSCPPGC  111



>ref|NP_568605.1| basic pentacysteine 6 [Arabidopsis thaliana]
 sp|Q8L999.1|BPC6_ARATH RecName: Full=Protein BASIC PENTACYSTEINE6; Short=AtBPC6; AltName: 
Full=GAGA-binding transcriptional activator BBR/BPC6 [Arabidopsis 
thaliana]
 gb|AAM67342.1| unknown [Arabidopsis thaliana]
 gb|AAR25825.1| basic pentacysteine 6 [Arabidopsis thaliana]
 dbj|BAD93808.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABD85145.1| At5g42520 [Arabidopsis thaliana]
 dbj|BAE99281.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABL67948.1| GAGA-binding transcriptional activator [Arabidopsis thaliana]
 gb|ABL67949.1| GAGA-binding transcriptional activator [Arabidopsis thaliana]
 gb|AED94820.1| basic pentacysteine 6 [Arabidopsis thaliana]
Length=342

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 93/109 (85%), Gaps = 5/109 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKLP-QGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRD  431
            MDDG HRENGRHK   QGQWLMQHQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD
Sbjct  1    MDDGGHRENGRHKAAVQGQWLMQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERD  60

Query  432  TAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT---GSMSPCPPGC  569
             A LQRDTAIAERNNAIMERD+A+  LQY E+SM T    +MS CPPGC
Sbjct  61   MAFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAPAANMSACPPGC  109



>ref|XP_009335373.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Pyrus x bretschneideri]
 ref|XP_009350033.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Pyrus x bretschneideri]
Length=340

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLM +QP+MKQIM IM ERDAAIQERNLA SEKKAAL
Sbjct  1    MDDGGHRENGRHKADQYKAAQGQWLMHNQPSMKQIMAIMGERDAAIQERNLAFSEKKAAL  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRD AIAERN+AIMERD+AIATLQY ++S+N+G++S CPPGC
Sbjct  61   AERDMAFLQRDAAIAERNSAIMERDSAIATLQYRDNSLNSGNVSSCPPGC  110



>ref|XP_010530298.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530299.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530300.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530301.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530302.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530303.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530304.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530305.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530309.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530310.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530311.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530312.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530313.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530315.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530316.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
Length=332

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 92/112 (82%), Gaps = 8/112 (7%)
 Frame = +3

Query  258  MDDG-HRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       Q QWLMQHQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+
Sbjct  1    MDDGGHRENGRHKADQYKTAQSQWLMQHQPSMKQVMAIIAERDAAIQERNLAISEKKAAI  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT--GSMSPCPPGC  569
            AERD A LQRDTAIAERNNAIMERDNA+A LQY E+SM T  G  S CPPGC
Sbjct  61   AERDMAFLQRDTAIAERNNAIMERDNALAALQYRENSMATAAGMSSSCPPGC  112



>ref|XP_010494188.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Camelina sativa]
Length=342

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 92/108 (85%), Gaps = 4/108 (4%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HRENGRHK  QGQW+MQHQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD 
Sbjct  1    MDDGGHRENGRHKAAQGQWMMQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAIAERDM  60

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGS---MSPCPPGC  569
            A LQRDTAIAERNNAIMERD+A+  LQY E+SM T +   MS  PPGC
Sbjct  61   AFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAAGANMSAGPPGC  108



>ref|NP_001275364.1| protein BASIC PENTACYSTEINE6-like [Solanum tuberosum]
 ref|XP_006342016.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342018.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X3 [Solanum 
tuberosum]
 gb|ADV59397.1| GAGA-binding transcriptional activator [Solanum tuberosum]
Length=323

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D G+R+NGRHK PQGQWLMQHQP+MKQIM IMAERDAAIQERNLALSEKKAALAERD AI
Sbjct  3    DSGNRDNGRHKPPQGQWLMQHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAERDMAI  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSM  548
            LQRD+AIAERNNAIMERDNAIATLQY E++M  G +
Sbjct  63   LQRDSAIAERNNAIMERDNAIATLQYRENAMTGGQI  98



>ref|XP_006402604.1| hypothetical protein EUTSA_v10006075mg [Eutrema salsugineum]
 gb|ESQ44057.1| hypothetical protein EUTSA_v10006075mg [Eutrema salsugineum]
Length=346

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 91/110 (83%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HRENGRHK  QGQW+MQHQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD 
Sbjct  1    MDDGGHRENGRHKAAQGQWMMQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERDM  60

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSM-----NTGSMSPCPPGC  569
            A LQRDTAIAERNNAIMERD+A+  LQY E+SM        +M  CPPGC
Sbjct  61   AFLQRDTAIAERNNAIMERDSALTALQYRENSMATAAAAVANMGACPPGC  110



>gb|KDP36958.1| hypothetical protein JCGZ_08249 [Jatropha curcas]
Length=337

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLMQ QP+MKQIM IMAERDAAI ERN+A+SEKKAA+
Sbjct  1    MDDGGHRENGRHKADQYKTAQGQWLMQAQPSMKQIMAIMAERDAAIHERNMAISEKKAAI  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A +QRD AIAERNNAI++RD+AIATLQY E+S+  G+MS CPPGC
Sbjct  61   AERDMAFIQRDAAIAERNNAILDRDSAIATLQYRENSLTGGNMSSCPPGC  110



>ref|XP_011028963.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Populus euphratica]
 ref|XP_011028964.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Populus euphratica]
Length=336

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 6/109 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLMQ QP+MKQIMGIMAERDAAI ERN+ALSEKKAA+
Sbjct  1    MDDGGHRENGRHKADQYKTAQGQWLMQPQPSMKQIMGIMAERDAAIHERNMALSEKKAAI  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPG  566
            AERD A LQRD+AIAERNNA++ERDNAIATLQY E+S+ +G+++ CPPG
Sbjct  61   AERDMAYLQRDSAIAERNNALLERDNAIATLQYRENSLPSGNITTCPPG  109



>gb|ADV59345.1| GAGA-binding transcriptional activator [Populus trichocarpa]
 gb|ADV59346.1| GAGA-binding transcriptional activator [Populus trichocarpa]
Length=336

 Score =   141 bits (356),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 92/109 (84%), Gaps = 6/109 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLMQ QP+MKQIM IMAERDAAI ERN+ALSEKKAA+
Sbjct  1    MDDGGHRENGRHKADQYKTAQGQWLMQPQPSMKQIMAIMAERDAAIHERNMALSEKKAAI  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPG  566
             ERD A LQRD+AIAERNNA++ERDNAIATLQY E+S+ +G+M+ CPPG
Sbjct  61   TERDMAFLQRDSAIAERNNALLERDNAIATLQYRENSLPSGNMTTCPPG  109



>ref|XP_002301996.2| hypothetical protein POPTR_0002s02820g [Populus trichocarpa]
 gb|EEE81269.2| hypothetical protein POPTR_0002s02820g [Populus trichocarpa]
Length=336

 Score =   141 bits (355),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 6/109 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLMQ QP+MKQIM IMAERDAAI ERN+ALSEKKAA+
Sbjct  1    MDDGGHRENGRHKADQYKTAQGQWLMQPQPSMKQIMAIMAERDAAIHERNMALSEKKAAI  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPG  566
            AERD A LQRD+AIAERNNA++ERDNAIATLQY E+S+ +G+M+ CPPG
Sbjct  61   AERDMAFLQRDSAIAERNNALLERDNAIATLQYRENSLPSGNMTTCPPG  109



>ref|XP_004291398.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Fragaria vesca subsp. 
vesca]
Length=380

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 95/116 (82%), Gaps = 10/116 (9%)
 Frame = +3

Query  252  F*MDDG-HRENGR-----HKLPQGQWLMQHQP---TMKQIMGIMAERDAAIQERNlalse  404
            + MDDG HRENGR     +K  QGQWLMQHQP   +MKQIM +MAERDAAIQERNLA SE
Sbjct  38   YLMDDGGHRENGRLKAEQYKAAQGQWLMQHQPHQPSMKQIMALMAERDAAIQERNLAFSE  97

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHE-SSMNTGSMSPCPPGC  569
            KKAALAERD A LQRD AIAERNNAIMERDNAIATLQY E SS+ +G++S CPPGC
Sbjct  98   KKAALAERDMAFLQRDAAIAERNNAIMERDNAIATLQYRENSSLTSGNLSSCPPGC  153



>emb|CBI19813.3| unnamed protein product [Vitis vinifera]
Length=109

 Score =   133 bits (335),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 86/107 (80%), Gaps = 6/107 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHKLP-----QGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MD+G HRENGRHK         QWLMQHQPTMKQIM IMAERD A+QERNLALSEKKAA+
Sbjct  1    MDEGGHRENGRHKADPYKAVHSQWLMQHQPTMKQIMAIMAERDTAVQERNLALSEKKAAV  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCP  560
            AERD A LQRDTAIAERNNAIMERDNAIATLQY E+S+N    S  P
Sbjct  61   AERDMAFLQRDTAIAERNNAIMERDNAIATLQYRENSLNATLTSSNP  107



>ref|NP_001242497.1| uncharacterized protein LOC100809369 [Glycine max]
 gb|ACU17970.1| unknown [Glycine max]
Length=336

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 93/111 (84%), Gaps = 8/111 (7%)
 Frame = +3

Query  258  MDD-GHRENGRHKLP------QGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaa  416
            MDD GHRENGRHK        QGQWLMQHQP+MKQIM ++AERDAAIQERNLA+SEKKAA
Sbjct  1    MDDAGHRENGRHKAADQYKSAQGQWLMQHQPSMKQIMAMIAERDAAIQERNLAISEKKAA  60

Query  417  laeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
             AERD A +QRD AIAERNNA++ERD AIATLQY E+S+++GSM  CPPGC
Sbjct  61   YAERDMAYMQRDAAIAERNNAMLERD-AIATLQYRETSLSSGSMPSCPPGC  110



>ref|XP_008377168.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Malus domestica]
 ref|XP_008377169.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Malus domestica]
 ref|XP_008377170.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Malus domestica]
Length=339

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLM +QP+MKQ+M IM+ERDAAIQERNLA SEKKAAL
Sbjct  1    MDDGGHRENGRHKADQYKAAQGQWLMHNQPSMKQVMAIMSERDAAIQERNLAFSEKKAAL  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRD AIAERN+A+MERD+AIATL Y ++S+N+G++S CPPGC
Sbjct  61   AERDMAFLQRDAAIAERNSAMMERDSAIATLHYRDNSLNSGNVSSCPPGC  110



>ref|XP_009337671.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Pyrus x bretschneideri]
 ref|XP_009337672.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Pyrus x bretschneideri]
 ref|XP_009337673.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Pyrus x bretschneideri]
Length=339

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLM +QP+MKQ+M IM+ERDAAIQERNLA SEKKAAL
Sbjct  1    MDDGGHRENGRHKADQYKAAQGQWLMHNQPSMKQVMAIMSERDAAIQERNLAFSEKKAAL  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRD AIAERN+AIMERD+AIATL Y ++S+N+G+ S CPPGC
Sbjct  61   AERDMAFLQRDAAIAERNSAIMERDSAIATLHYRDNSLNSGNGSSCPPGC  110



>ref|XP_008444782.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Cucumis melo]
Length=338

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 89/108 (82%), Gaps = 7/108 (6%)
 Frame = +3

Query  261  DDGHRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalae  425
            D GHRENGRHK       QGQW+MQHQP+MKQIM IMAERDAAIQERNLALSEKKAALAE
Sbjct  3    DSGHRENGRHKPDQYKSAQGQWMMQHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAE  62

Query  426  RDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            RD A LQRD AIAERNNA++ERDNAIATLQY E+S+N      CPPGC
Sbjct  63   RDMAYLQRDAAIAERNNALLERDNAIATLQYRENSINNN--LSCPPGC  108



>ref|XP_004152657.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Cucumis sativus]
 ref|XP_004165561.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Cucumis sativus]
 gb|KGN62663.1| hypothetical protein Csa_2G365700 [Cucumis sativus]
Length=338

 Score =   139 bits (349),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 92/108 (85%), Gaps = 7/108 (6%)
 Frame = +3

Query  261  DDGHRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalae  425
            D GHRENGRHK       QGQW+MQHQP+MKQIM IMAERDAAIQERNLALSEKKAALAE
Sbjct  3    DSGHRENGRHKPDQYKSAQGQWMMQHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAE  62

Query  426  RDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            RD A LQRD AIAERNNA++ERDNAIATLQY E+S+N  ++S CPPGC
Sbjct  63   RDMAYLQRDAAIAERNNALLERDNAIATLQYRENSINN-NLS-CPPGC  108



>ref|XP_007017722.1| Basic pentacysteine 6 [Theobroma cacao]
 gb|EOY14947.1| Basic pentacysteine 6 [Theobroma cacao]
Length=336

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 89/108 (82%), Gaps = 6/108 (6%)
 Frame = +3

Query  261  DDGHRENGR-----HKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalae  425
            D GHRENGR     ++  QGQWLM HQP+MKQIM IMAERDAAIQERNLALSEKKAA+AE
Sbjct  3    DSGHRENGRLKTDQYRTAQGQWLM-HQPSMKQIMAIMAERDAAIQERNLALSEKKAAIAE  61

Query  426  RDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            RD A LQRD AIAERN+AI ERDNAIA LQY E+S+ TG+M  CPPGC
Sbjct  62   RDMAFLQRDAAIAERNSAIAERDNAIANLQYRENSLATGNMPSCPPGC  109



>gb|ABG57061.1| GAGA-binding transcriptional activator [Cardamine pratensis]
 gb|ABG57062.1| GAGA-binding transcriptional activator [Cardamine pratensis]
Length=342

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 91/109 (83%), Gaps = 5/109 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HRENGRHK PQGQWLMQHQP+MKQ+M I+AER AAIQERNLA+SEKKAA+AERD 
Sbjct  1    MDDGGHRENGRHKAPQGQWLMQHQPSMKQVMSIIAERGAAIQERNLAISEKKAAIAERDM  60

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHE----SSMNTGSMSPCPPGC  569
            A LQRDTAIAERNNAIMERD+A+  LQY E    ++    +MS CPPGC
Sbjct  61   AFLQRDTAIAERNNAIMERDSALTALQYRENSMVNAAAAANMSACPPGC  109



>ref|XP_010539043.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539044.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Tarenaya 
hassleriana]
Length=345

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 89/111 (80%), Gaps = 7/111 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       Q QWL QHQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+
Sbjct  1    MDDGGHRENGRHKADQYKTAQSQWLTQHQPSMKQVMAIIAERDAAIQERNLAISEKKAAV  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSM-NTGSMSPCPPGC  569
            AERD A LQRDTAIAERNNA+MERDNA+  LQY ESSM  T +MS C  GC
Sbjct  61   AERDMAFLQRDTAIAERNNAVMERDNALVALQYRESSMVTTATMSSCTAGC  111



>gb|ADV59370.1| GAGA-binding transcriptional activator [Cichorium intybus]
Length=329

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 90/111 (81%), Gaps = 8/111 (7%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAI  440
            D GHRENGR K PQG+WLMQ QP+MKQIM IMAERDAAIQERNLA+SEKKAALAERD A+
Sbjct  3    DSGHRENGRQKPPQGRWLMQRQPSMKQIMTIMAERDAAIQERNLAISEKKAALAERDMAL  62

Query  441  LQRDTAIAERNNAIMERDNAIATLQYHE--------SSMNTGSMSPCPPGC  569
            LQRD+AIAERN AIMERDNAI TLQY E        S+ +  + +PCPPGC
Sbjct  63   LQRDSAIAERNTAIMERDNAITTLQYRENSMNNNNNSNNSNNTPAPCPPGC  113



>ref|XP_002306908.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 ref|XP_006383735.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 ref|XP_006383736.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 ref|XP_006383737.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 gb|EEE93904.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 gb|ERP61532.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 gb|ERP61533.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 gb|ERP61534.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
Length=335

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 89/109 (82%), Gaps = 6/109 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWLMQ QP+MKQIM IMAERDAAI ERN+ALSEKKAA+
Sbjct  1    MDDGVHRENGRHKADQYKTAQGQWLMQPQPSMKQIMAIMAERDAAIHERNMALSEKKAAV  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPG  566
            AERD A LQRD+AIAERNNA++ERDNAIATLQY E+S  + + S  PPG
Sbjct  61   AERDMAFLQRDSAIAERNNALLERDNAIATLQYRENSFASANTSSSPPG  109



>ref|XP_003589387.1| GAGA-binding transcriptional activator [Medicago truncatula]
 gb|AES59638.1| GAGA-binding transcriptional activator BBR/BPC6-like protein 
[Medicago truncatula]
Length=340

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 92/113 (81%), Gaps = 11/113 (10%)
 Frame = +3

Query  258  MDDGHRENGRHKL-----PQGQWLMQ---HQ-PTMKQIMGIMAERDAAIQERNlalsekk  410
            MDD  RENGRHK       QGQWLMQ   HQ P+MKQIM IMAERDAAIQERNLALSEKK
Sbjct  1    MDD--RENGRHKADQYKSAQGQWLMQQHQHQHPSMKQIMSIMAERDAAIQERNLALSEKK  58

Query  411  aalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AALAERD A LQRDTAIAERNNA+MERDNAIATLQ+ E+++  G MS CPPGC
Sbjct  59   AALAERDMAFLQRDTAIAERNNALMERDNAIATLQFRENALANGGMSSCPPGC  111



>gb|ADV59404.1| GAGA-binding transcriptional activator [Cardamine hirsuta]
 gb|ADV59405.1| GAGA-binding transcriptional activator [Cardamine hirsuta]
Length=343

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 92/110 (84%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQ-WLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRD  431
            MDDG HRENGRHK PQGQ WLMQHQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD
Sbjct  1    MDDGGHRENGRHKAPQGQQWLMQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERD  60

Query  432  TAILQRDTAIAERNNAIMERDNAIATLQYHE----SSMNTGSMSPCPPGC  569
             A LQRDTAIAERNNAIMERD+A+  LQY E    ++    +MS CPPGC
Sbjct  61   MAFLQRDTAIAERNNAIMERDSALTALQYRENSMVNAAAAANMSACPPGC  110



>ref|XP_011045135.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Populus euphratica]
 ref|XP_011045136.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Populus euphratica]
Length=335

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 91/109 (83%), Gaps = 6/109 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHK-----LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGRHK       QGQWL+Q QP+MKQIMGIMAERDAAI E+N+ALSEKKAA+
Sbjct  1    MDDGVHRENGRHKADEYKTAQGQWLVQPQPSMKQIMGIMAERDAAIHEKNMALSEKKAAI  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPG  566
            AERD A+LQRD+AIAERNNA++ERDNAIATLQY E+S  + + S  PPG
Sbjct  61   AERDMALLQRDSAIAERNNALLERDNAIATLQYRENSFASANTSSSPPG  109



>gb|KHG09159.1| basic pentacysteine6 -like protein [Gossypium arboreum]
Length=336

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 7/109 (6%)
 Frame = +3

Query  258  MDDG-HRENGR-----HKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGR     ++  QGQWLM HQP+MKQIM IMAERDAAIQERNLALSEKKAA+
Sbjct  1    MDDGGHRENGRLKADQYRTAQGQWLM-HQPSMKQIMAIMAERDAAIQERNLALSEKKAAI  59

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPG  566
            AERD A LQRD AIAERNNAI ERDNAIA LQY E+S+ +G++S CPPG
Sbjct  60   AERDMAFLQRDAAIAERNNAIAERDNAIANLQYRENSLASGNISSCPPG  108



>gb|KJB14435.1| hypothetical protein B456_002G124900 [Gossypium raimondii]
 gb|KJB14436.1| hypothetical protein B456_002G124900 [Gossypium raimondii]
 gb|KJB14439.1| hypothetical protein B456_002G124900 [Gossypium raimondii]
 gb|KJB14440.1| hypothetical protein B456_002G124900 [Gossypium raimondii]
Length=336

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 91/109 (83%), Gaps = 7/109 (6%)
 Frame = +3

Query  258  MDDG-HRENGR-----HKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HRENGR     ++  QGQWLM HQP+MKQIM IMAERDAAIQERNLALSEKKAA+
Sbjct  1    MDDGGHRENGRLKADQYRTAQGQWLM-HQPSMKQIMAIMAERDAAIQERNLALSEKKAAI  59

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPG  566
            AERD A LQRD AIAERNNAI ERDNAIA LQY E+S+ +G++S CPPG
Sbjct  60   AERDMAFLQRDAAIAERNNAIAERDNAIANLQYRENSLASGNISSCPPG  108



>gb|ABC25623.1| GAGA-binding transcriptional activator [Olimarabidopsis pumila]
 gb|ABC25624.1| GAGA-binding transcriptional activator [Olimarabidopsis pumila]
Length=338

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 90/108 (83%), Gaps = 7/108 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HR   RHK  QGQW+MQHQP+MKQ+M ++AERDAAIQERNLA+SEKKAA+AERD 
Sbjct  1    MDDGGHR---RHKAAQGQWMMQHQPSMKQVMSMIAERDAAIQERNLAISEKKAAVAERDM  57

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGS---MSPCPPGC  569
            A LQRDTAIAERNNAIMERD+A+  LQY E+SM T +   MS CPPGC
Sbjct  58   AFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAAATNMSVCPPGC  105



>ref|XP_010481981.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Camelina 
sativa]
 ref|XP_010481982.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Camelina 
sativa]
Length=340

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 89/106 (84%), Gaps = 2/106 (2%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HRENGRHK   GQW+MQHQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD 
Sbjct  1    MDDGGHRENGRHKAAPGQWMMQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAIAERDM  60

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSP-CPPGC  569
            A LQRDTAIAERNNAIMERD+A+  LQY E+SM T + +    PGC
Sbjct  61   AFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAAAANMSAPGC  106



>ref|XP_008221307.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Prunus mume]
Length=331

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 86/108 (80%), Gaps = 11/108 (10%)
 Frame = +3

Query  261  DDGHRENGR-----HKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalae  425
            D GHRENGR     +K  QGQWLMQHQP+MKQIM IMAERDAA+QERNLA SEKKAAL E
Sbjct  3    DSGHRENGRIKAEQYKAAQGQWLMQHQPSMKQIMAIMAERDAALQERNLAFSEKKAALHE  62

Query  426  RDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            RD A       IAERN+AIMERDNAIATLQY E+S+N G++S CPPGC
Sbjct  63   RDMAF------IAERNSAIMERDNAIATLQYRENSLNNGNVSSCPPGC  104



>ref|XP_006280750.1| hypothetical protein CARUB_v10026720mg [Capsella rubella]
 gb|EOA13648.1| hypothetical protein CARUB_v10026720mg [Capsella rubella]
Length=339

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 89/108 (82%), Gaps = 8/108 (7%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HRENGRHK  QGQ    HQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD 
Sbjct  1    MDDGGHRENGRHKAAQGQ----HQPSMKQVMSIIAERDAAIQERNLAISEKKAAIAERDM  56

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGS---MSPCPPGC  569
            A LQRDTAIAERNNAIMERD+A+  LQY E+SM T +   MS CPPGC
Sbjct  57   AFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAASANMSACPPGC  104



>dbj|BAB10493.1| unnamed protein product [Arabidopsis thaliana]
Length=301

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 85/97 (88%), Gaps = 2/97 (2%)
 Frame = +3

Query  258  MDDG-HRENGRHKLP-QGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRD  431
            MDDG HRENGRHK   QGQWLMQHQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD
Sbjct  1    MDDGGHRENGRHKAAVQGQWLMQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERD  60

Query  432  TAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTG  542
             A LQRDTAIAERNNAIMERD+A+  LQY E+SM T 
Sbjct  61   MAFLQRDTAIAERNNAIMERDSALTALQYRENSMVTA  97



>ref|XP_009138858.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Brassica 
rapa]
 ref|XP_009138859.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Brassica 
rapa]
Length=305

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (89%), Gaps = 2/96 (2%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQ-PTMKQIMGIMAERDAAIQERNlalsekkaalaeRD  431
            MDDG HR+NGRHK PQGQW+MQHQ P+MKQ+M I+AERD AIQERNLA+SE+K+A+AERD
Sbjct  1    MDDGGHRDNGRHKAPQGQWMMQHQQPSMKQVMSIIAERDTAIQERNLAVSERKSAVAERD  60

Query  432  TAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
             A LQRDTAIAERNNAIMERD+A+  LQY ++SM T
Sbjct  61   MAFLQRDTAIAERNNAIMERDSALTALQYRDNSMAT  96



>ref|NP_001078690.1| basic pentacysteine 6 [Arabidopsis thaliana]
 gb|AED94821.1| basic pentacysteine 6 [Arabidopsis thaliana]
Length=338

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 89/109 (82%), Gaps = 9/109 (8%)
 Frame = +3

Query  258  MDDG-HRENGRHKLP-QGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRD  431
            MDDG HRENGRHK   QGQ    HQP+MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD
Sbjct  1    MDDGGHRENGRHKAAVQGQ----HQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERD  56

Query  432  TAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT---GSMSPCPPGC  569
             A LQRDTAIAERNNAIMERD+A+  LQY E+SM T    +MS CPPGC
Sbjct  57   MAFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAPAANMSACPPGC  105



>ref|XP_010670883.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Beta vulgaris subsp. 
vulgaris]
Length=334

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = +3

Query  258  MDD-GHRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDD GHRENGRHK      P  QWLMQ   +MK IM IMAERDAAIQERN+A++EK  AL
Sbjct  1    MDDAGHRENGRHKPEMYKPPHSQWLMQQPQSMKHIMSIMAERDAAIQERNMAINEKNKAL  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
             ERD AI+QRDTA+ ERN A+MERDNA+A LQ+ ++S+N G  + CPPGC
Sbjct  61   EERDLAIMQRDTAMQERNEALMERDNALAALQFRQNSINGGGSNTCPPGC  110



>ref|XP_009138854.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009138855.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009138856.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009138857.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
Length=306

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 85/97 (88%), Gaps = 3/97 (3%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQ-WLMQHQ-PTMKQIMGIMAERDAAIQERNlalsekkaalaeR  428
            MDDG HR+NGRHK PQGQ W+MQHQ P+MKQ+M I+AERD AIQERNLA+SE+K+A+AER
Sbjct  1    MDDGGHRDNGRHKAPQGQQWMMQHQQPSMKQVMSIIAERDTAIQERNLAVSERKSAVAER  60

Query  429  DTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
            D A LQRDTAIAERNNAIMERD+A+  LQY ++SM T
Sbjct  61   DMAFLQRDTAIAERNNAIMERDSALTALQYRDNSMAT  97



>ref|XP_004499229.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Cicer arietinum]
Length=338

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 82/110 (75%), Gaps = 8/110 (7%)
 Frame = +3

Query  258  MDDGHRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaala  422
            MDD  REN RHK       QGQWLMQHQP+MKQIM IMAERD AIQERNLALSEKKAA  
Sbjct  1    MDD--RENARHKADQYKSAQGQWLMQHQPSMKQIMAIMAERDQAIQERNLALSEKKAAXX  58

Query  423  eRDTAILQRDTAIAERNNAIMERDNAIA-TLQYHESSMNTGSMSPCPPGC  569
                   QRDTAIAERNNA+MERDNAIA TLQ+ E+++  G M  CPPGC
Sbjct  59   XXXXXXXQRDTAIAERNNALMERDNAIATTLQFRENALANGGMLSCPPGC  108



>gb|ADV59374.1| GAGA-binding transcriptional activator [Triphysaria pusilla]
Length=293

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 85/105 (81%), Gaps = 5/105 (5%)
 Frame = +3

Query  258  MDD-GHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MD+  +REN RHK PQGQWL+QHQP+MK I+ IMAERDAAIQERNLA+SEKK+ALAERD 
Sbjct  1    MDNRANRENERHKPPQGQWLLQHQPSMKHIITIMAERDAAIQERNLAISEKKSALAERDM  60

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AILQRD AIAERNNAI E +NAIATL YHE++    +   CP  C
Sbjct  61   AILQRDAAIAERNNAIKELENAIATLHYHENT----TTPHCPSSC  101



>gb|ADV59377.1| GAGA-binding transcriptional activator [Triphysaria pusilla]
Length=293

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 85/105 (81%), Gaps = 5/105 (5%)
 Frame = +3

Query  258  MDD-GHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MD+  +REN RHK PQGQWL+QHQP+MK I+ IMAERDAAIQERNLA+SEKK+ALAERD 
Sbjct  1    MDNRANRENERHKPPQGQWLLQHQPSMKHIITIMAERDAAIQERNLAISEKKSALAERDM  60

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AILQRD AIAERN+AI E +NAIATL YHE++    +   CP  C
Sbjct  61   AILQRDAAIAERNDAIKELENAIATLHYHENT----TTPHCPSSC  101



>gb|ABL10371.1| GAGA-binding transcriptional activator [Medicago truncatula]
 gb|ABL10372.1| GAGA-binding transcriptional activator [Medicago truncatula]
Length=318

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +3

Query  318  QHQ-PTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERD  494
            QHQ P+MKQIM IMAERDAAIQERNLALSEKKAALAERD A LQRDTAIAERNNA+MERD
Sbjct  5    QHQHPSMKQIMSIMAERDAAIQERNLALSEKKAALAERDMAFLQRDTAIAERNNALMERD  64

Query  495  NAIATLQYHESSMNTGSMSPCPPGC  569
            NAIATLQ+ E+++  G MS CPPGC
Sbjct  65   NAIATLQFRENALANGGMSSCPPGC  89



>ref|XP_010263912.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263913.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263915.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263916.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263917.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263918.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263919.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263920.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263921.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263922.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263923.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263924.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
Length=329

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 8/110 (7%)
 Frame = +3

Query  258  MDDG-HRENGRHK----LPQGQWLM-QHQPTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG  RENGRHK        QW++ QHQ  MKQ+M +MAERDAAIQERN+AL+EKKAAL
Sbjct  1    MDDGSQRENGRHKDQYKTVHSQWMIPQHQ--MKQVMALMAERDAAIQERNVALAEKKAAL  58

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AERD A LQRD AIAERNNA+MERDNAIA L+Y E++++   +  CPPGC
Sbjct  59   AERDMAFLQRDAAIAERNNALMERDNAIAALEYRENALSGSGVPTCPPGC  108



>ref|XP_009138860.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X3 [Brassica 
rapa]
Length=301

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 4/95 (4%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HR+NGRHK PQGQ     QP+MKQ+M I+AERD AIQERNLA+SE+K+A+AERD 
Sbjct  1    MDDGGHRDNGRHKAPQGQ---HQQPSMKQVMSIIAERDTAIQERNLAVSERKSAVAERDM  57

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
            A LQRDTAIAERNNAIMERD+A+  LQY ++SM T
Sbjct  58   AFLQRDTAIAERNNAIMERDSALTALQYRDNSMAT  92



>gb|KJB14434.1| hypothetical protein B456_002G124900 [Gossypium raimondii]
 gb|KJB14437.1| hypothetical protein B456_002G124900 [Gossypium raimondii]
 gb|KJB14438.1| hypothetical protein B456_002G124900 [Gossypium raimondii]
Length=326

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 81/104 (78%), Gaps = 7/104 (7%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDT  434
            MDDG HRENGR K  Q      ++    QIM IMAERDAAIQERNLALSEKKAA+AERD 
Sbjct  1    MDDGGHRENGRLKADQ------YRTAQGQIMAIMAERDAAIQERNLALSEKKAAIAERDM  54

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPG  566
            A LQRD AIAERNNAI ERDNAIA LQY E+S+ +G++S CPPG
Sbjct  55   AFLQRDAAIAERNNAIAERDNAIANLQYRENSLASGNISSCPPG  98



>ref|XP_010919161.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010919162.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010919163.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
Length=350

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 84/114 (74%), Gaps = 12/114 (11%)
 Frame = +3

Query  261  DDGHRENGRHKLPQ-----GQWLM-QHQP----TMKQIMGIMAERDAAIQERNlalsekk  410
            D G RENGRHK  Q      QW+M QHQ     T+K IM IMAERD AIQERN+AL+EKK
Sbjct  3    DSGQRENGRHKTDQYKQVHTQWMMPQHQLKENHTIK-IMTIMAERDNAIQERNIALAEKK  61

Query  411  aalaeRDTAILQRDTAIAERNNAIMERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            AALAERD AILQRD AI+ERNNAIMERDNAIA LQY  E+ +N    S CPPGC
Sbjct  62   AALAERDMAILQRDAAISERNNAIMERDNAIAALQYARENGLNGNGASACPPGC  115



>ref|XP_008803316.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
Length=427

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 82/113 (73%), Gaps = 10/113 (9%)
 Frame = +3

Query  261  DDGHRENGRHKLPQ-----GQWLM-QHQPTMKQ---IMGIMAERDAAIQERNlalsekka  413
            + G RENGRHK  Q      QW+M Q+Q    Q    M IM+ERD AIQE N+AL+EKKA
Sbjct  76   NSGQRENGRHKTDQYKQVHTQWMMPQYQLKENQTIKFMAIMSERDNAIQEHNIALAEKKA  135

Query  414  alaeRDTAILQRDTAIAERNNAIMERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            ALAERD AILQRDTAIAERNNAIMERDNAIA LQY  E+ MNT   + CPPGC
Sbjct  136  ALAERDVAILQRDTAIAERNNAIMERDNAIAALQYARENGMNTNGATACPPGC  188



>ref|XP_009116705.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Brassica 
rapa]
 ref|XP_009116706.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Brassica 
rapa]
Length=296

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 7/101 (7%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQP------TMKQIMGIMAERDAAIQERNlalsekkaa  416
            MDDG HR+NG HK   G+W+MQ         +MKQ+M I+AERDAAIQERNLA+SEKKAA
Sbjct  1    MDDGGHRDNGWHKASHGKWMMQQHQPQQHQPSMKQVMSIIAERDAAIQERNLAISEKKAA  60

Query  417  laeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
            +AERD A LQRDTAIAERNNAIMERD+A+A LQY +SSM+T
Sbjct  61   VAERDMAFLQRDTAIAERNNAIMERDSALAALQYRDSSMST  101



>emb|CDY41183.1| BnaA09g38320D [Brassica napus]
Length=296

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 7/101 (7%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQP------TMKQIMGIMAERDAAIQERNlalsekkaa  416
            MDDG HR+NG HK   G+W+MQ         +MKQ+M I+AERDAAIQERNLA+SEKKAA
Sbjct  1    MDDGGHRDNGWHKASHGKWMMQQHQPQQHQPSMKQVMSIIAERDAAIQERNLAISEKKAA  60

Query  417  laeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
            +AERD A LQRDTAIAERNNAIMERD+A+A LQY +SSM+T
Sbjct  61   VAERDMAFLQRDTAIAERNNAIMERDSALAALQYRDSSMST  101



>ref|XP_008803315.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
Length=445

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 82/113 (73%), Gaps = 10/113 (9%)
 Frame = +3

Query  261  DDGHRENGRHKLPQ-----GQWLM-QHQPTMKQ---IMGIMAERDAAIQERNlalsekka  413
            + G RENGRHK  Q      QW+M Q+Q    Q    M IM+ERD AIQE N+AL+EKKA
Sbjct  94   NSGQRENGRHKTDQYKQVHTQWMMPQYQLKENQTIKFMAIMSERDNAIQEHNIALAEKKA  153

Query  414  alaeRDTAILQRDTAIAERNNAIMERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            ALAERD AILQRDTAIAERNNAIMERDNAIA LQY  E+ MNT   + CPPGC
Sbjct  154  ALAERDVAILQRDTAIAERNNAIMERDNAIAALQYARENGMNTNGATACPPGC  206



>ref|XP_008779916.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779922.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779926.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779932.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779939.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
Length=387

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 85/116 (73%), Gaps = 13/116 (11%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQ-----GQWLM-QHQP----TMKQIMGIMAERDAAIQERNlalse  404
            MDDG  REN RHK  Q      QW+M QHQ     T+K IM IMAERD AIQERN+AL+E
Sbjct  37   MDDGGQRENVRHKTDQYKQVHAQWMMPQHQLKENHTIK-IMAIMAERDNAIQERNIALAE  95

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            KKAALAERD AILQRD AIAERNNAIMERDNAIA LQY  E+ +N    S CPPGC
Sbjct  96   KKAALAERDMAILQRDAAIAERNNAIMERDNAIAALQYARENGLNGNGASACPPGC  151



>ref|XP_008779943.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779949.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779953.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779960.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779965.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779971.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779973.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
Length=351

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 85/116 (73%), Gaps = 13/116 (11%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQ-----GQWLM-QHQP----TMKQIMGIMAERDAAIQERNlalse  404
            MDDG  REN RHK  Q      QW+M QHQ     T+K IM IMAERD AIQERN+AL+E
Sbjct  1    MDDGGQRENVRHKTDQYKQVHAQWMMPQHQLKENHTIK-IMAIMAERDNAIQERNIALAE  59

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            KKAALAERD AILQRD AIAERNNAIMERDNAIA LQY  E+ +N    S CPPGC
Sbjct  60   KKAALAERDMAILQRDAAIAERNNAIMERDNAIAALQYARENGLNGNGASACPPGC  115



>ref|XP_010933934.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
Length=350

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 79/113 (70%), Gaps = 10/113 (9%)
 Frame = +3

Query  261  DDGHRENGRHKLPQ-----GQWLM-QHQPTMKQ---IMGIMAERDAAIQERNlalsekka  413
            D G RENGRHK  Q      QW+M QHQ    Q    M IMAERD AIQERN+AL+EKKA
Sbjct  3    DSGQRENGRHKTDQYKQVHAQWMMPQHQLKENQTIKFMAIMAERDNAIQERNIALAEKKA  62

Query  414  alaeRDTAILQRDTAIAERNNAIMERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            ALAERD AILQRD AI ERN+AIMERDNAIA LQY  E+ MN      CPPGC
Sbjct  63   ALAERDMAILQRDAAITERNSAIMERDNAIAALQYARENGMNANGAPACPPGC  115



>emb|CDX89057.1| BnaA04g01290D [Brassica napus]
Length=312

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 6/100 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQ-----PTMKQIMGIMAERDAAIQERNlalsekkaal  419
            MDDG HR+NGRHK PQGQ  M        P+MKQ+M I+AERDAAIQERNLA+SE+K+A+
Sbjct  1    MDDGGHRDNGRHKAPQGQQWMMQHQQQHQPSMKQVMSIIAERDAAIQERNLAVSERKSAV  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
            AERD A LQRDTAIAERNNAIMERD+A+  LQY ++SM T
Sbjct  61   AERDMAFLQRDTAIAERNNAIMERDSALTALQYRDNSMAT  100



>ref|XP_008776328.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776329.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776330.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776331.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776332.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776333.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776334.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
Length=343

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 86/116 (74%), Gaps = 13/116 (11%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQ-----GQWLM-QHQ----PTMKQIMGIMAERDAAIQERNlalse  404
            MDDG HRENGRHK  Q      QW+M QHQ     TMK +M IMAERD+AI ERNLA+SE
Sbjct  1    MDDGRHRENGRHKPDQFKSVHTQWMMPQHQMKDHQTMK-LMAIMAERDSAIHERNLAISE  59

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            KKAALAERD AILQRD AIAERNNAIMERDNAIA LQY  E+ MN    + C PGC
Sbjct  60   KKAALAERDMAILQRDAAIAERNNAIMERDNAIAALQYARETGMNGNGGNGCSPGC  115



>ref|XP_009116701.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009116702.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009116703.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009116704.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
Length=297

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 82/102 (80%), Gaps = 8/102 (8%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQG-QWLMQHQP------TMKQIMGIMAERDAAIQERNlalsekka  413
            MDDG HR+NG HK   G QW+MQ         +MKQ+M I+AERDAAIQERNLA+SEKKA
Sbjct  1    MDDGGHRDNGWHKASHGKQWMMQQHQPQQHQPSMKQVMSIIAERDAAIQERNLAISEKKA  60

Query  414  alaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
            A+AERD A LQRDTAIAERNNAIMERD+A+A LQY +SSM+T
Sbjct  61   AVAERDMAFLQRDTAIAERNNAIMERDSALAALQYRDSSMST  102



>emb|CDX71826.1| BnaC08g30480D [Brassica napus]
Length=301

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 82/102 (80%), Gaps = 8/102 (8%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQG-QWLMQHQP------TMKQIMGIMAERDAAIQERNlalsekka  413
            MDDG HR+NG HK   G QW+MQ         +MKQ+M I+AERDAAIQERNLA+SEKKA
Sbjct  1    MDDGGHRDNGWHKASHGKQWMMQQHQPQQHQPSMKQVMSIIAERDAAIQERNLAISEKKA  60

Query  414  alaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
            ALAERD A LQRDTAIAERNNAIMERD+A+A LQ+ +SSM+T
Sbjct  61   ALAERDMAFLQRDTAIAERNNAIMERDSALAALQFRDSSMST  102



>ref|XP_010271440.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Nelumbo 
nucifera]
Length=321

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +3

Query  294  LPQGQWLMQHQPTMKQ-IMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAER  470
            +PQ Q    H  T+KQ IM I AERDAAIQERN+A SEKK ALAERD A LQRD AIAER
Sbjct  9    IPQHQMKEHHALTVKQQIMAIAAERDAAIQERNMAFSEKKVALAERDMAFLQRDAAIAER  68

Query  471  NNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            NNAI+ERDNAIA L+Y ES+MN      CPPGC
Sbjct  69   NNAIIERDNAIAALEYRESAMNGSGTPTCPPGC  101



>ref|XP_010271438.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271439.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Nelumbo 
nucifera]
Length=322

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +3

Query  294  LPQGQWLMQHQPTMKQ-IMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAER  470
            +PQ Q    H  T+KQ IM I AERDAAIQERN+A SEKK ALAERD A LQRD AIAER
Sbjct  10   IPQHQMKEHHALTVKQQIMAIAAERDAAIQERNMAFSEKKVALAERDMAFLQRDAAIAER  69

Query  471  NNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            NNAI+ERDNAIA L+Y ES+MN      CPPGC
Sbjct  70   NNAIIERDNAIAALEYRESAMNGSGTPTCPPGC  102



>ref|XP_010539045.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Tarenaya 
hassleriana]
Length=314

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +3

Query  333  MKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATL  512
            MKQ+M I+AERDAAIQERNLA+SEKKAA+AERD A LQRDTAIAERNNA+MERDNA+  L
Sbjct  1    MKQVMAIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAVMERDNALVAL  60

Query  513  QYHESSM-NTGSMSPCPPGC  569
            QY ESSM  T +MS C  GC
Sbjct  61   QYRESSMVTTATMSSCTAGC  80



>ref|XP_002278754.1| PREDICTED: protein BASIC PENTACYSTEINE6 isoform X5 [Vitis vinifera]
Length=106

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 6/96 (6%)
 Frame = +3

Query  267  GHRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRD  431
            G RE  R K+      Q QWLMQ Q TM+Q+M I+AERDAAIQERNLALSEKKA LA+RD
Sbjct  3    GDREIRREKVHPHGTTQNQWLMQPQ-TMEQLMAILAERDAAIQERNLALSEKKAVLAQRD  61

Query  432  TAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
             AIL+RD AI ER+NA++ERDN I+TL+Y  +SMN+
Sbjct  62   LAILERDAAIVERDNALLERDNVISTLRYRGNSMNS  97



>ref|XP_003634376.1| PREDICTED: protein BASIC PENTACYSTEINE6 isoform X4 [Vitis vinifera]
 ref|XP_010664776.1| PREDICTED: protein BASIC PENTACYSTEINE6 isoform X4 [Vitis vinifera]
 ref|XP_010664777.1| PREDICTED: protein BASIC PENTACYSTEINE6 isoform X4 [Vitis vinifera]
 emb|CBI19811.3| unnamed protein product [Vitis vinifera]
Length=107

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 6/96 (6%)
 Frame = +3

Query  267  GHRENGRHKL-----PQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRD  431
            G RE  R K+      Q QWLMQ Q TM+Q+M I+AERDAAIQERNLALSEKKA LA+RD
Sbjct  3    GDREIRREKVHPHGTTQNQWLMQPQ-TMEQLMAILAERDAAIQERNLALSEKKAVLAQRD  61

Query  432  TAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
             AIL+RD AI ER+NA++ERDN I+TL+Y  +SMN+
Sbjct  62   LAILERDAAIVERDNALLERDNVISTLRYRGNSMNS  97



>ref|XP_010940930.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940931.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940932.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940933.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940934.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940935.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940936.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
Length=342

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 83/116 (72%), Gaps = 13/116 (11%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQ-----GQWLM-QHQ----PTMKQIMGIMAERDAAIQERNlalse  404
            MDDG HRENGR K  Q      QW+M QHQ     TMK +M IMAERD+AI +RNLA+SE
Sbjct  1    MDDGRHRENGRPKPDQFKSVHAQWMMPQHQMKDHQTMK-LMAIMAERDSAIHDRNLAISE  59

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            KKAALAERD AILQRD AI ERNNA +ERDNAIA LQY  E+ MN    + C PGC
Sbjct  60   KKAALAERDMAILQRDAAIVERNNAFLERDNAIAALQYARETGMNGNGGNGCSPGC  115



>ref|XP_008803317.1| PREDICTED: barley B recombinant-like protein D isoform X3 [Phoenix 
dactylifera]
Length=342

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  306  QWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIM  485
            Q+ ++   T+K  M IM+ERD AIQE N+AL+EKKAALAERD AILQRDTAIAERNNAIM
Sbjct  16   QYQLKENQTIK-FMAIMSERDNAIQEHNIALAEKKAALAERDVAILQRDTAIAERNNAIM  74

Query  486  ERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            ERDNAIA LQY  E+ MNT   + CPPGC
Sbjct  75   ERDNAIAALQYARENGMNTNGATACPPGC  103



>emb|CDY42683.1| BnaC04g22230D [Brassica napus]
Length=320

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 6/100 (6%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQWLMQHQPTMKQ-----IMGIMAERDAAIQERNlalsekkaal  419
            MDDG HR+NGRHK PQGQW+MQ Q   +Q     +M I+AERDAAIQERNLA+SE+K+A+
Sbjct  1    MDDGGHRDNGRHKAPQGQWMMQQQQQQQQPSMKQVMSIIAERDAAIQERNLAISERKSAV  60

Query  420  aeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
            AERD A LQRDTAIAERNNAIMERD+A+  LQY ++SM T
Sbjct  61   AERDMAFLQRDTAIAERNNAIMERDSALTALQYRDNSMAT  100



>ref|XP_010664774.1| PREDICTED: protein BASIC PENTACYSTEINE6 isoform X2 [Vitis vinifera]
Length=129

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +3

Query  309  WLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIME  488
            WLMQ Q TM+Q+M I+AERDAAIQERNLALSEKKA LA+RD AIL+RD AI ER+NA++E
Sbjct  45   WLMQPQ-TMEQLMAILAERDAAIQERNLALSEKKAVLAQRDLAILERDAAIVERDNALLE  103

Query  489  RDNAIATLQYHESSMNT  539
            RDN I+TL+Y  +SMN+
Sbjct  104  RDNVISTLRYRGNSMNS  120



>ref|XP_010664775.1| PREDICTED: protein BASIC PENTACYSTEINE6 isoform X3 [Vitis vinifera]
Length=122

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +3

Query  309  WLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIME  488
            WLMQ Q TM+Q+M I+AERDAAIQERNLALSEKKA LA+RD AIL+RD AI ER+NA++E
Sbjct  45   WLMQPQ-TMEQLMAILAERDAAIQERNLALSEKKAVLAQRDLAILERDAAIVERDNALLE  103

Query  489  RDNAIATLQYHESSMNT  539
            RDN I+TL+Y  +SMN+
Sbjct  104  RDNVISTLRYRGNSMNS  120



>ref|XP_010664772.1| PREDICTED: protein BASIC PENTACYSTEINE6 isoform X1 [Vitis vinifera]
 ref|XP_010664773.1| PREDICTED: protein BASIC PENTACYSTEINE6 isoform X1 [Vitis vinifera]
Length=130

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +3

Query  309  WLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIME  488
            WLMQ Q TM+Q+M I+AERDAAIQERNLALSEKKA LA+RD AIL+RD AI ER+NA++E
Sbjct  45   WLMQPQ-TMEQLMAILAERDAAIQERNLALSEKKAVLAQRDLAILERDAAIVERDNALLE  103

Query  489  RDNAIATLQYHESSMNT  539
            RDN I+TL+Y  +SMN+
Sbjct  104  RDNVISTLRYRGNSMNS  120



>ref|XP_009398067.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398068.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398069.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398070.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398071.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
Length=345

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 80/113 (71%), Gaps = 13/113 (12%)
 Frame = +3

Query  258  MDD-GHRENGRHKLPQ-----GQWLMQHQPTMKQ--IMGIMAERDAAIQERNlalsekka  413
            MD+ GHRENGRHK  Q      QW+M H    +   I  +MAER+ A+QER++A+SEKKA
Sbjct  1    MDEIGHRENGRHKNDQYKTAHAQWMMPHHQLKENQTIKLLMAEREKALQERDMAISEKKA  60

Query  414  alaeRDTAILQRDTAIAERNNAIMERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            ALAERDTA LQRD AIAERNNAI+ERD+AIA L+Y  E+ M+      C PGC
Sbjct  61   ALAERDTAYLQRDAAIAERNNAILERDDAIAALEYARENCMSNN----CAPGC  109



>emb|CBI37978.3| unnamed protein product [Vitis vinifera]
Length=248

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 15/106 (14%)
 Frame = +3

Query  258  MDDG-HRENGRHKL-----PQGQWLM--------QHQPTM-KQIMGIMAERDAAIQERNl  392
            MDDG  RENGRHKL     PQ  W M        Q+  TM K+++ I+AERD AI+ERN+
Sbjct  1    MDDGGQRENGRHKLDYYKGPQNPWNMMPQHHLKEQNALTMNKKVVNILAERDNAIRERNI  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESS  530
            ALSEKKAAL ERD A++QRD AI+ER+NA++ERDNAIA L+Y ESS
Sbjct  61   ALSEKKAALEERDEALMQRDAAISERDNALLERDNAIAALRYRESS  106



>ref|XP_008776335.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008776336.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008776337.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
Length=319

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 72/93 (77%), Gaps = 4/93 (4%)
 Frame = +3

Query  294  LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERN  473
            +PQ Q  M+   TMK +M IMAERD+AI ERNLA+SEKKAALAERD AILQRD AIAERN
Sbjct  2    MPQHQ--MKDHQTMK-LMAIMAERDSAIHERNLAISEKKAALAERDMAILQRDAAIAERN  58

Query  474  NAIMERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            NAIMERDNAIA LQY  E+ MN    + C PGC
Sbjct  59   NAIMERDNAIAALQYARETGMNGNGGNGCSPGC  91



>ref|XP_006852993.1| hypothetical protein AMTR_s00185p00053640 [Amborella trichopoda]
 gb|ERN14460.1| hypothetical protein AMTR_s00185p00053640 [Amborella trichopoda]
Length=197

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 74/117 (63%), Gaps = 15/117 (13%)
 Frame = +3

Query  258  MDDGHRENGRHK-------LPQGQW-----LMQHQPTMKQIMGIMAERDAAIQERNlals  401
            MD+G RENGRHK       L   QW      M+  P  K +M +MAERDAAIQERN ALS
Sbjct  1    MDEGQRENGRHKPDQYKAMLGHSQWNAPQQSMKDHPAFK-LMALMAERDAAIQERNAALS  59

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQY-HESSMNTGSMSPCPPGC  569
            +K+AALAERD AI QRD A AERN A+ ERD AIA L+Y  +  M TG     PPG 
Sbjct  60   DKRAALAERDLAISQRDAAYAERNTALQERDAAIAALEYARDYGMGTGQPQ-GPPGA  115



>ref|NP_001268018.1| GAGA-binding transcriptional activator BBR/BPC4-like [Vitis vinifera]
 ref|XP_010645037.1| PREDICTED: GAGA-binding transcriptional activator BBR/BPC4-like 
isoform X1 [Vitis vinifera]
 gb|ACC64527.1| GAGA-binding transcriptional activator BBR/BPC4-like [Vitis vinifera]
 gb|ACC64528.1| GAGA-binding transcriptional activator BBR/BPC4-like [Vitis vinifera]
Length=307

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 79/108 (73%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDG-HRENGRHKL-----PQGQWLM--------QHQPTM-KQIMGIMAERDAAIQERNl  392
            MDDG  RENGRHKL     PQ  W M        Q+  TM K+++ I+AERD AI+ERN+
Sbjct  1    MDDGGQRENGRHKLDYYKGPQNPWNMMPQHHLKEQNALTMNKKVVNILAERDNAIRERNI  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            ALSEKKAAL ERD A++QRD AI+ER+NA++ERDNAIA L+Y ES ++
Sbjct  61   ALSEKKAALEERDEALMQRDAAISERDNALLERDNAIAALRYRESVIS  108



>ref|XP_006423509.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
 ref|XP_006423510.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
 ref|XP_006423511.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
 gb|ESR36749.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
 gb|ESR36750.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
 gb|ESR36751.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
Length=311

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 15/112 (13%)
 Frame = +3

Query  258  MDDGHRENGRHKL-----PQGQWLMQHQPTMKQ----------IMGIMAERDAAIQERNl  392
            MDDGH ENGR+K+        QW M  Q  MK+          IM I+AERDAAI+ERN+
Sbjct  1    MDDGHHENGRYKMEYYKGTHAQWNMMPQHQMKEPNNALVMNKKIMAILAERDAAIRERNI  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSM  548
            AL+EK+ AL  RD A+ +RD A+AER++A+M RD+A+A LQY E++ N  S+
Sbjct  61   ALTEKREALETRDQALEERDKALAERDDALMARDSALAALQYREAAANFSSV  112



>ref|XP_006487267.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Citrus sinensis]
 gb|KDO42318.1| hypothetical protein CISIN_1g021524mg [Citrus sinensis]
Length=311

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 15/112 (13%)
 Frame = +3

Query  258  MDDGHRENGRHKL-----PQGQWLMQHQPTMKQ----------IMGIMAERDAAIQERNl  392
            MDDGH ENGR+K+        QW M  Q  MK+          IM I+AERDAAI+ERN+
Sbjct  1    MDDGHHENGRYKMEYYKGTHAQWNMMPQHQMKEPNNALVMNKKIMAILAERDAAIRERNI  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSM  548
            AL+EK+ AL  RD A+ +RD A+AER++A+M RD+A+A LQY E++ N  S+
Sbjct  61   ALTEKREALETRDQALEERDKALAERDDALMARDSALAALQYREAAANFSSV  112



>gb|ADV59380.1| GAGA-binding transcriptional activator [Helianthus annuus]
Length=308

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 15/109 (14%)
 Frame = +3

Query  258  MDD-GHRENGRHKL-------PQG----QWLMQHQPTM---KQIMGIMAERDAAIQERNl  392
            MDD GHRENGRH++       PQ     Q+ M+ Q  M   ++IM I++ERD AI+ER+ 
Sbjct  1    MDDAGHRENGRHRIDYYKGVHPQWNVMPQYQMKDQNAMMMNRKIMHIVSERDTAIEERDR  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNT  539
            AL EKKAAL ERD AI QRDTAIA+RN+AI ERDNAIA L++ E++MN+
Sbjct  61   ALLEKKAALEERDMAIQQRDTAIADRNDAIRERDNAIAALRFQETTMNS  109



>ref|XP_009399386.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399387.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399388.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=341

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 75/112 (67%), Gaps = 11/112 (10%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQ-----GQWLM--QHQPTMKQIMGIMAERDAAIQERNlalsekka  413
            MD+G  R NGR+K  Q      QW+    H    + I  IMAERD A+QER+LA+SEKKA
Sbjct  1    MDEGGQRGNGRYKTDQYKPSHAQWMAPQHHLKENQTIKLIMAERDKALQERDLAISEKKA  60

Query  414  alaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AL ERD A LQRD AIAERNNAI+ERDNAIA+L+Y   +   G  + C PGC
Sbjct  61   ALVERDMAYLQRDAAIAERNNAIVERDNAIASLEY---ARENGMSASCGPGC  109



>ref|XP_010555253.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Tarenaya hassleriana]
 ref|XP_010555254.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Tarenaya hassleriana]
Length=295

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 64/83 (77%), Gaps = 2/83 (2%)
 Frame = +3

Query  294  LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAE  467
            +PQ Q   QH   +  K+IM I+AERDAAIQERN ALS K+ ALA RD A+ QRD A++E
Sbjct  27   MPQHQMKEQHNALVMNKKIMSILAERDAAIQERNEALSAKREALAARDEALQQRDKALSE  86

Query  468  RNNAIMERDNAIATLQYHESSMN  536
            R+NA+MERDNAIA LQY E+S+N
Sbjct  87   RDNALMERDNAIAALQYRENSLN  109



>ref|XP_009389696.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389702.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389709.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389715.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=346

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (69%), Gaps = 11/112 (10%)
 Frame = +3

Query  258  MDD-GHRENGRHKLPQ-----GQWLM-QHQPTMKQ-IMGIMAERDAAIQERNlalsekka  413
            MDD G RENGRHK  Q      QW++ QHQ    Q I  +MAER+ A+QER++A++EKKA
Sbjct  1    MDDVGQRENGRHKTDQYRTAHAQWMLPQHQLKENQTIKLLMAEREKALQERDMAITEKKA  60

Query  414  alaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AL ERD A LQRD A+AERN+AI+ERDNAI  L+Y   +  +G+   C  GC
Sbjct  61   ALVERDMAYLQRDAAVAERNSAIIERDNAIGALEYARENGMSGN---CATGC  109



>ref|XP_009389670.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389675.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389682.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389688.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=367

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (69%), Gaps = 11/112 (10%)
 Frame = +3

Query  258  MDD-GHRENGRHKLPQ-----GQWLM-QHQPTMKQ-IMGIMAERDAAIQERNlalsekka  413
            MDD G RENGRHK  Q      QW++ QHQ    Q I  +MAER+ A+QER++A++EKKA
Sbjct  22   MDDVGQRENGRHKTDQYRTAHAQWMLPQHQLKENQTIKLLMAEREKALQERDMAITEKKA  81

Query  414  alaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSPCPPGC  569
            AL ERD A LQRD A+AERN+AI+ERDNAI  L+Y   +  +G+   C  GC
Sbjct  82   ALVERDMAYLQRDAAVAERNSAIIERDNAIGALEYARENGMSGN---CATGC  130



>ref|XP_010531487.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Tarenaya hassleriana]
 ref|XP_010531488.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Tarenaya hassleriana]
Length=296

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 73/110 (66%), Gaps = 17/110 (15%)
 Frame = +3

Query  258  MDDGHR-ENGRHK--------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQER  386
            MD G + ENG++K              +PQ Q   QH   +  K+IM I+AERDAA+QER
Sbjct  1    MDSGGQCENGKYKPNYYKGTHSMTWNMMPQHQIKEQHNALVMNKKIMSILAERDAAVQER  60

Query  387  NlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            N ALS K+ ALA RD A+ QRD A++ER+NA+MERDNA+A LQY  SS+N
Sbjct  61   NEALSAKREALAARDEALQQRDKALSERDNALMERDNALAALQYRGSSLN  110



>emb|CDY15905.1| BnaA04g12060D [Brassica napus]
Length=286

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +3

Query  294  LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAE  467
            LP  Q   QH   +  K+IM I+AERDAA+ ERN A+S K  ALA RD A+LQRD A+AE
Sbjct  24   LPHHQIKEQHNALVMNKKIMSILAERDAAVHERNQAVSAKLEALAARDQALLQRDKALAE  83

Query  468  RNNAIMERDNAIATLQYHESSMN  536
            R+ A++ERDNA A LQ+HE+S+N
Sbjct  84   RDKALIERDNAFAALQHHENSLN  106



>ref|XP_009140266.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Brassica rapa]
Length=286

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +3

Query  294  LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAE  467
            LP  Q   QH   +  K+IM I+AERDAA+ ERN A+S K  ALA RD A+LQRD A+AE
Sbjct  24   LPHHQIKEQHNALVMNKKIMSILAERDAAVHERNQAVSAKIEALAARDQALLQRDKALAE  83

Query  468  RNNAIMERDNAIATLQYHESSMN  536
            R+ A++ERDNA A LQ+HE+S+N
Sbjct  84   RDKALIERDNAFAALQHHENSLN  106



>ref|XP_011088552.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X2 [Sesamum indicum]
Length=305

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 69/101 (68%), Gaps = 9/101 (9%)
 Frame = +3

Query  261  DDGHRENGRHKLPQGQWLMQHQPTMKQ---------IMGIMAERDAAIQERNlalsekka  413
            ++G RE+ RH++   +W M  Q   K+         I  +  ERDAAIQER+ AL+EKK 
Sbjct  3    ENGQRESRRHRVDYYKWNMISQYQTKEQNAYHVNAKISMLCDERDAAIQERDRALAEKKV  62

Query  414  alaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            AL ERD AI QRD AIA+R+NA+ ERDNAIA LQ+HES+MN
Sbjct  63   ALNERDVAIQQRDAAIADRDNALRERDNAIAALQFHESTMN  103



>ref|XP_006404565.1| hypothetical protein EUTSA_v10000273mg [Eutrema salsugineum]
 gb|ESQ46018.1| hypothetical protein EUTSA_v10000273mg [Eutrema salsugineum]
Length=291

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 69/106 (65%), Gaps = 16/106 (15%)
 Frame = +3

Query  267  GHRENGRHK--------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlal  398
            G  ENGR+K              +PQ Q   QH   +  K+IM I+AERDAA+QERN A+
Sbjct  5    GQYENGRYKPDHLKGAQSTMWNMMPQHQIKEQHNALVMNKKIMSILAERDAAVQERNQAV  64

Query  399  sekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            S K+ A+A RD A+ QRD A++ER+ A++ERD A A LQ+HE+S+N
Sbjct  65   SAKREAVAARDEALQQRDKALSERDKALIERDTAFAALQHHENSLN  110



>ref|XP_007042009.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
 ref|XP_007042010.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
 ref|XP_007042012.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
 gb|EOX97840.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
 gb|EOX97841.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
 gb|EOX97843.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
Length=310

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 73/105 (70%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHKLPQGQ-----WLMQHQPTMKQ----------IMGIMAERDAAIQERNlals  401
            G +E+GR+KL   +     W M  Q  MK+          IM I+AERDAAI+ERN+A+S
Sbjct  5    GQQESGRYKLDYYKGAHTPWNMMPQHHMKEQNNALVMNKKIMSILAERDAAIRERNIAIS  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            EKK ALA RD A+ QRD A+AER++A+M+RDNA+A LQY E++MN
Sbjct  65   EKKEALAARDEALQQRDKALAERDSALMDRDNALAVLQYRENAMN  109



>ref|XP_009789611.1| PREDICTED: barley B recombinant-like protein D [Nicotiana sylvestris]
 gb|ADV59384.1| GAGA-binding transcriptional activator [Nicotiana tabacum]
Length=301

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  330  TMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIAT  509
            T+K  M IMAERDAAI+ERN+AL E+K A AERD A+LQRD A+AERN AI ERD+AIA 
Sbjct  8    TIKTYMAIMAERDAAIRERNMALEERKRAFAERDMAMLQRDAALAERNAAIQERDDAIAA  67

Query  510  LQYHESSMNTGSMSPCPPG  566
            L+  ESS+N  ++ P  PG
Sbjct  68   LRLGESSINDNNVVPDSPG  86



>ref|XP_009611977.1| PREDICTED: barley B recombinant-like protein D [Nicotiana tomentosiformis]
Length=301

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  330  TMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIAT  509
            T+K  M IMAERDAAI+ERN+AL E+K A AERD A+LQRD A+AERN AI ERD+AIA 
Sbjct  8    TIKTYMAIMAERDAAIRERNMALEERKRAFAERDMAMLQRDAALAERNAAIQERDDAIAA  67

Query  510  LQYHESSMNTGSMSPCPPG  566
            L+  ESS+N  ++ P  PG
Sbjct  68   LRLGESSINDNNVVPDSPG  86



>ref|XP_010416867.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Camelina sativa]
Length=295

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 68/105 (65%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHK-------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlals  401
            G  +NGR K             +PQ Q   QH   +  K+IM I+AERDAAI ERN A+S
Sbjct  5    GQYDNGRFKPDYLKGAQSVWNMMPQHQIKEQHNALVMNKKIMSILAERDAAIHERNQAVS  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             KK A+A RD A+ QRD A++ER+ A++ERDNA A LQ+HE+S+N
Sbjct  65   AKKEAVAARDEALQQRDKALSERDKALIERDNAYAALQHHENSLN  109



>ref|XP_010429023.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Camelina sativa]
Length=297

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 68/105 (65%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHK-------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlals  401
            G  +NGR K             +PQ Q   QH   +  K+IM I+AERDAAI ERN A+S
Sbjct  5    GQYDNGRFKPDYLKGAQSMWNMMPQHQIKEQHNALVMNKKIMSILAERDAAIHERNQAVS  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             KK A+A RD A+ QRD A++ER+ A++ERDNA A LQ+HE+S+N
Sbjct  65   AKKEAIAARDEALQQRDKALSERDKALIERDNAYAALQHHENSLN  109



>emb|CDY70283.1| BnaCnng67580D [Brassica napus]
Length=284

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 2/83 (2%)
 Frame = +3

Query  294  LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAE  467
            LP  Q   QH   +  K+IM I+AERDAA+ ERN A+S K  ALA RD A+ QRD A+AE
Sbjct  24   LPHHQIKEQHNALVMNKKIMSILAERDAAVHERNQAVSAKMEALAARDQALQQRDKALAE  83

Query  468  RNNAIMERDNAIATLQYHESSMN  536
            R+ A++ERDNA A LQ+HE+S+N
Sbjct  84   RDKALIERDNAFAALQHHENSLN  106



>ref|XP_010472104.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Camelina sativa]
Length=295

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 68/105 (65%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHK-------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlals  401
            G  +NGR K             +PQ Q   QH   +  K+IM I+AERDAAI ERN A+S
Sbjct  5    GQYDNGRFKPDYLKGAQSMWNMMPQHQIKEQHNALVMNKKIMSILAERDAAIHERNQAVS  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             KK A+A RD A+ QRD A++ER+ A++ERDNA A LQ+HE+S+N
Sbjct  65   AKKEAVAARDEALQQRDKALSERDKALIERDNAYAALQHHENSLN  109



>ref|XP_010908702.1| PREDICTED: barley B recombinant-like protein D isoform X3 [Elaeis 
guineensis]
 ref|XP_010908703.1| PREDICTED: barley B recombinant-like protein D isoform X3 [Elaeis 
guineensis]
 ref|XP_010908704.1| PREDICTED: barley B recombinant-like protein D isoform X3 [Elaeis 
guineensis]
Length=320

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = +3

Query  294  LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERN  473
            +PQ Q  M+   TMK +M IMAERD+AI ERNLA+SEKKAALAERD AILQRD AI ERN
Sbjct  2    MPQHQ--MKDHQTMK-LMAIMAERDSAIHERNLAISEKKAALAERDMAILQRDAAIMERN  58

Query  474  NAIMERDNAIATLQ-YHESSMNTGSMSPCPPGC  569
            NAIM RDNAIA LQ   E+ +N    + C PGC
Sbjct  59   NAIMGRDNAIAALQCARENGVNGNGGNGCSPGC  91



>ref|XP_006411681.1| hypothetical protein EUTSA_v10025867mg [Eutrema salsugineum]
 gb|ESQ53134.1| hypothetical protein EUTSA_v10025867mg [Eutrema salsugineum]
Length=295

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 70/105 (67%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHK-------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlals  401
            G  ENGR+K             +PQ Q   QH   +  K+IM I+AERDAA++ERN A++
Sbjct  5    GQYENGRYKPDYYKGTESVWNMMPQHQIKEQHNALVMNKKIMSILAERDAAVKERNEAVA  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             KK ALA RD A+ QRD A++ER+NAIMER++A+  LQY E+++N
Sbjct  65   AKKEALAARDEALEQRDKALSERDNAIMERESALNALQYRENNLN  109



>ref|XP_010908697.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Elaeis 
guineensis]
 ref|XP_010908698.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Elaeis 
guineensis]
 ref|XP_010908699.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Elaeis 
guineensis]
Length=327

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = +3

Query  294  LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERN  473
            +PQ Q  M+   TMK +M IMAERD+AI ERNLA+SEKKAALAERD AILQRD AI ERN
Sbjct  9    MPQHQ--MKDHQTMK-LMAIMAERDSAIHERNLAISEKKAALAERDMAILQRDAAIMERN  65

Query  474  NAIMERDNAIATLQ-YHESSMNTGSMSPCPPGC  569
            NAIM RDNAIA LQ   E+ +N    + C PGC
Sbjct  66   NAIMGRDNAIAALQCARENGVNGNGGNGCSPGC  98



>ref|XP_002880369.1| ATBPC4/BBR/BPC4/BPC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56628.1| ATBPC4/BBR/BPC4/BPC4 [Arabidopsis lyrata subsp. lyrata]
Length=296

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 68/105 (65%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHK-------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlals  401
            G  +NGR K             +PQ Q   QH   +  K+IM I+AERDAA+ ERN A+S
Sbjct  5    GQYDNGRFKPDYFKGAQSMWNMMPQHQIKEQHNALVMNKKIMSILAERDAAVHERNQAVS  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             KK A+A RD A+ QRD A++ER+ A++ERDNA A LQ+HE+S+N
Sbjct  65   AKKEAVAARDEALQQRDKALSERDKALIERDNAYAALQHHENSLN  109



>ref|XP_006294544.1| hypothetical protein CARUB_v10023579mg [Capsella rubella]
 gb|EOA27442.1| hypothetical protein CARUB_v10023579mg [Capsella rubella]
Length=294

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 68/105 (65%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHK-------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlals  401
            G  +NGR K             +PQ Q   QH   +  K+IM I+AERDAA+ ERN A+S
Sbjct  5    GQYDNGRFKPDYLKGAQSMWNMMPQHQIKEQHNALVMNKKIMSILAERDAAVHERNQAVS  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             KK A+A RD A+ QRD A++ER+ A++ERDNA A LQ+HE+S+N
Sbjct  65   AKKEAVAARDEALQQRDKALSERDKALIERDNAYAALQHHENSLN  109



>ref|XP_010908700.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Elaeis 
guineensis]
 ref|XP_010908701.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Elaeis 
guineensis]
Length=322

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = +3

Query  294  LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERN  473
            +PQ Q  M+   TMK +M IMAERD+AI ERNLA+SEKKAALAERD AILQRD AI ERN
Sbjct  4    MPQHQ--MKDHQTMK-LMAIMAERDSAIHERNLAISEKKAALAERDMAILQRDAAIMERN  60

Query  474  NAIMERDNAIATLQ-YHESSMNTGSMSPCPPGC  569
            NAIM RDNAIA LQ   E+ +N    + C PGC
Sbjct  61   NAIMGRDNAIAALQCARENGVNGNGGNGCSPGC  93



>ref|XP_011099810.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Sesamum indicum]
 ref|XP_011099811.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Sesamum indicum]
Length=296

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +3

Query  330  TMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIAT  509
            T+K  M I AERDAAI+ERN+AL E+K A AERD A+LQRD AIAERN AI ERD AIA+
Sbjct  7    TIKTFMAITAERDAAIRERNMALEERKRAFAERDMAMLQRDAAIAERNAAIQERDEAIAS  66

Query  510  LQYHESSMNTGSMSP  554
            L++ E SMN  S  P
Sbjct  67   LRFREGSMNDNSTIP  81



>gb|AAR25824.1| basic pentacysteine 4 [Arabidopsis thaliana]
Length=296

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +3

Query  294  LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAE  467
            +PQ Q   QH   +  K+IM I+AERDAA+ ERN A+S KK A+A RD A+ QRD A++E
Sbjct  27   IPQHQIKEQHNALVMNKKIMSILAERDAAVHERNQAVSAKKEAVAARDEALQQRDKALSE  86

Query  468  RNNAIMERDNAIATLQYHESSMN  536
            R+ A++ERDNA A LQ+HE+S+N
Sbjct  87   RDKALIERDNAYAALQHHENSLN  109



>ref|NP_565503.1| basic pentacysteine 4 [Arabidopsis thaliana]
 ref|NP_850012.1| basic pentacysteine 4 [Arabidopsis thaliana]
 sp|Q8S8C6.1|BPC4_ARATH RecName: Full=Protein BASIC PENTACYSTEINE4; Short=AtBPC4 [Arabidopsis 
thaliana]
 gb|AAM15408.1| expressed protein [Arabidopsis thaliana]
 gb|AAM61121.1| unknown [Arabidopsis thaliana]
 gb|ABG48465.1| At2g21240 [Arabidopsis thaliana]
 dbj|BAF00970.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH19851.1| AT2G21240 [Arabidopsis thaliana]
 gb|AEC07147.1| basic pentacysteine 4 [Arabidopsis thaliana]
 gb|AEC07148.1| basic pentacysteine 4 [Arabidopsis thaliana]
Length=296

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +3

Query  294  LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAE  467
            +PQ Q   QH   +  K+IM I+AERDAA+ ERN A+S KK A+A RD A+ QRD A++E
Sbjct  27   IPQHQIKEQHNALVMNKKIMSILAERDAAVHERNQAVSAKKEAVAARDEALQQRDKALSE  86

Query  468  RNNAIMERDNAIATLQYHESSMN  536
            R+ A++ERDNA A LQ+HE+S+N
Sbjct  87   RDKALIERDNAYAALQHHENSLN  109



>ref|XP_010526572.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Tarenaya hassleriana]
 ref|XP_010526573.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Tarenaya hassleriana]
Length=280

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 15/104 (14%)
 Frame = +3

Query  267  GHRENGRHK-------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlals  401
            G  ENGR+K             +PQ Q   QH   +  K+IM I+AERDAAI ERN A+S
Sbjct  5    GQYENGRYKPDYYKGAHSMWNLMPQHQIKEQHNALVMNKKIMSILAERDAAIHERNEAIS  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSM  533
             K  ALA RD A+ QRD A++ER+NA+M+RDNA+A LQY E+ +
Sbjct  65   AKGEALAARDDALQQRDKALSERDNALMQRDNALAALQYGENHL  108



>ref|XP_006294545.1| hypothetical protein CARUB_v10023579mg, partial [Capsella rubella]
 gb|EOA27443.1| hypothetical protein CARUB_v10023579mg, partial [Capsella rubella]
Length=336

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 68/105 (65%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHK-------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlals  401
            G  +NGR K             +PQ Q   QH   +  K+IM I+AERDAA+ ERN A+S
Sbjct  47   GQYDNGRFKPDYLKGAQSMWNMMPQHQIKEQHNALVMNKKIMSILAERDAAVHERNQAVS  106

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             KK A+A RD A+ QRD A++ER+ A++ERDNA A LQ+HE+S+N
Sbjct  107  AKKEAVAARDEALQQRDKALSERDKALIERDNAYAALQHHENSLN  151



>ref|XP_009399389.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=317

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 3/73 (4%)
 Frame = +3

Query  351  IMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESS  530
            IMAERD A+QER+LA+SEKKAAL ERD A LQRD AIAERNNAI+ERDNAIA+L+Y   +
Sbjct  16   IMAERDKALQERDLAISEKKAALVERDMAYLQRDAAIAERNNAIVERDNAIASLEY---A  72

Query  531  MNTGSMSPCPPGC  569
               G  + C PGC
Sbjct  73   RENGMSASCGPGC  85



>ref|XP_007042011.1| GAGA-motif binding transcriptional activator isoform 3 [Theobroma 
cacao]
 gb|EOX97842.1| GAGA-motif binding transcriptional activator isoform 3 [Theobroma 
cacao]
Length=285

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            K+IM I+AERDAAI+ERN+A+SEKK ALA RD A+ QRD A+AER++A+M+RDNA+A LQ
Sbjct  18   KKIMSILAERDAAIRERNIAISEKKEALAARDEALQQRDKALAERDSALMDRDNALAVLQ  77

Query  516  YHESSMN  536
            Y E++MN
Sbjct  78   YRENAMN  84



>gb|KJB11168.1| hypothetical protein B456_001G243700 [Gossypium raimondii]
 gb|KJB11169.1| hypothetical protein B456_001G243700 [Gossypium raimondii]
 gb|KJB11173.1| hypothetical protein B456_001G243700 [Gossypium raimondii]
Length=240

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 71/105 (68%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHKLPQGQ-----WLMQHQPTMKQ----------IMGIMAERDAAIQERNlals  401
            G  ENGR+KL + +     W M  Q  +K+          IM I+AERDAAIQERN+A+S
Sbjct  5    GQLENGRYKLDRYKGAHPPWNMMPQHHVKEQSNALVMNKKIMSILAERDAAIQERNIAIS  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            E+K ALA RD A+ QRD A+AER++A++ERDNA+A LQ  ES+ N
Sbjct  65   ERKEALAARDEALQQRDKALAERDSALIERDNALAVLQCRESAKN  109



>gb|EYU20522.1| hypothetical protein MIMGU_mgv1a010119mg [Erythranthe guttata]
Length=321

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  321  HQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNA  500
            H   +K  M I AERDAAI+ERN+AL E+K A AERD A+LQRD AIAERN+AI ERD A
Sbjct  5    HHLGIKTFMAITAERDAAIRERNMALEERKRAFAERDMAMLQRDAAIAERNSAIQERDEA  64

Query  501  IATLQYHESSMNTGSMSPCPP  563
            IA+L++ ES MN  S +   P
Sbjct  65   IASLRFRESPMNHNSTNTNIP  85



>ref|XP_002513008.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49511.1| conserved hypothetical protein [Ricinus communis]
Length=314

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            K+IM I+AERDAAIQERN+AL+EKK AL  RD A+ QR+ A+AER+ A+MERDNA+A +Q
Sbjct  43   KKIMAILAERDAAIQERNMALAEKKEALVARDEALQQREKALAERDKALMERDNALAAIQ  102

Query  516  YHESSMN  536
            Y E++MN
Sbjct  103  YRENAMN  109



>ref|XP_004290338.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458302.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Fragaria vesca subsp. 
vesca]
Length=310

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 66/107 (62%), Gaps = 14/107 (13%)
 Frame = +3

Query  258  MDDGHRENGRHKLPQGQ-----WLMQHQPTMKQ---------IMGIMAERDAAIQERNla  395
            MDDG  ENGRHK    +     W M  Q  +K+         IM I+AERDAAI+ERN A
Sbjct  1    MDDGRHENGRHKPDYYRGAPSPWNMTAQQQVKEPNALVMNKKIMSIIAERDAAIRERNAA  60

Query  396  lsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            +SEK  ALA RD A+ QRD A ++R+ A+MERDNA A     ++SMN
Sbjct  61   ISEKNEALAARDEALRQRDEAFSQRDTALMERDNAFAAFHIRDNSMN  107



>gb|KJB11170.1| hypothetical protein B456_001G243700 [Gossypium raimondii]
 gb|KJB11172.1| hypothetical protein B456_001G243700 [Gossypium raimondii]
Length=310

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 71/105 (68%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHKLPQGQ-----WLMQHQPTMKQ----------IMGIMAERDAAIQERNlals  401
            G  ENGR+KL + +     W M  Q  +K+          IM I+AERDAAIQERN+A+S
Sbjct  5    GQLENGRYKLDRYKGAHPPWNMMPQHHVKEQSNALVMNKKIMSILAERDAAIQERNIAIS  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            E+K ALA RD A+ QRD A+AER++A++ERDNA+A LQ  ES+ N
Sbjct  65   ERKEALAARDEALQQRDKALAERDSALIERDNALAVLQCRESAKN  109



>ref|XP_011088547.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Sesamum indicum]
 ref|XP_011088549.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Sesamum indicum]
 ref|XP_011088550.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Sesamum indicum]
 ref|XP_011088551.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Sesamum indicum]
Length=308

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 69/104 (66%), Gaps = 12/104 (12%)
 Frame = +3

Query  261  DDGHRENGRH-----KLPQGQWLMQHQPTMKQIMGIMA-------ERDAAIQERNlalse  404
            ++G RE+ RH     K+P    + Q+Q   +    + A       ERDAAIQER+ AL+E
Sbjct  3    ENGQRESRRHRVDYYKVPPWNMISQYQTKEQNAYHVNAKISMLCDERDAAIQERDRALAE  62

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            KK AL ERD AI QRD AIA+R+NA+ ERDNAIA LQ+HES+MN
Sbjct  63   KKVALNERDVAIQQRDAAIADRDNALRERDNAIAALQFHESTMN  106



>ref|NP_001266243.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
 gb|ADV59387.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
 gb|ADV59388.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
Length=300

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  330  TMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIAT  509
            T+K  M IMAERDAAI+ERN+AL E+K A AERD A+LQRD A+AERN  I ER++AIA 
Sbjct  8    TIKTYMAIMAERDAAIRERNMALEERKRAFAERDMAMLQRDAALAERNALIQERNDAIAA  67

Query  510  LQYHESSMNTGSMSPCPPG  566
            L+  +SS N  +M P  PG
Sbjct  68   LRLQDSSTNDNNMVPDSPG  86



>emb|CDX72731.1| BnaC07g47530D [Brassica napus]
Length=269

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +3

Query  294  LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAE  467
            +PQ Q   QH   +  K+IM I+AERDAA++ERN AL+ K+ ALA RD A+ QRD AI+E
Sbjct  2    MPQHQIKEQHNALVMNKKIMSILAERDAAVKERNEALAAKQEALAARDEALQQRDLAISE  61

Query  468  RNNAIMERDNAIATLQYHESSMN  536
            R+NAIMER+NA+  LQ+ E+ +N
Sbjct  62   RDNAIMERENALTALQHRENHLN  84



>ref|NP_001275213.1| barley B recombinant-like protein D-like [Solanum tuberosum]
 gb|ADV59396.1| GAGA-binding transcriptional activator [Solanum tuberosum]
Length=300

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +3

Query  330  TMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIAT  509
            T+K  M IMAERDAAI+ERN+AL E+K A AERD A+LQRD A+AERN  I ER++AIA 
Sbjct  8    TIKTYMAIMAERDAAIRERNMALEERKRAFAERDMAMLQRDAALAERNALIQERNDAIAA  67

Query  510  LQYHESSMNTGSMSPCPPG  566
            L+  +SS N  +M P  PG
Sbjct  68   LRLQDSSTNDNNMVPDSPG  86



>ref|XP_009101921.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
Length=262

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +3

Query  294  LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAE  467
            +PQ Q   QH   +  K+IM I+AERDAA++ERN AL+ K+ ALA RD A+ QRD AI+E
Sbjct  2    MPQHQIKEQHNALVMNKKIMSILAERDAAVKERNEALAAKQEALAARDEALQQRDLAISE  61

Query  468  RNNAIMERDNAIATLQYHESSMN  536
            R+NAIMER+NA+  LQ+ E+ +N
Sbjct  62   RDNAIMERENALTALQHRENHLN  84



>emb|CDY22406.1| BnaA06g37280D [Brassica napus]
Length=262

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +3

Query  294  LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAE  467
            +PQ Q   QH   +  K+IM I+AERDAA++ERN AL+ K+ ALA RD A+ QRD AI+E
Sbjct  2    MPQHQIKEQHNALVMNKKIMSILAERDAAVKERNEALAAKQEALAARDEALQQRDLAISE  61

Query  468  RNNAIMERDNAIATLQYHESSMN  536
            R+NAIMER+NA+  LQ+ E+ +N
Sbjct  62   RDNAIMERENALTALQHRENHLN  84



>ref|XP_010095680.1| hypothetical protein L484_012253 [Morus notabilis]
 gb|EXB61819.1| hypothetical protein L484_012253 [Morus notabilis]
Length=312

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 72/108 (67%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDGHR-ENGRHKL-----PQGQWLM--QHQPTM-------KQIMGIMAERDAAIQERNl  392
            MDD  + E GRHK+         W M  QHQ          K+IM I+AERDAAI+ERN+
Sbjct  1    MDDSRQHETGRHKVEYYRGAHSPWNMMTQHQVKEPNALVMNKKIMSIIAERDAAIRERNV  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            ALSEK  ALAERD A+ QRD A+A+R++A+MERDNAIA LQ   +SMN
Sbjct  61   ALSEKNEALAERDEALRQRDQALAQRDSALMERDNAIAALQIRNNSMN  108



>ref|XP_010645040.1| PREDICTED: GAGA-binding transcriptional activator BBR/BPC4-like 
isoform X2 [Vitis vinifera]
Length=282

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +3

Query  294  LPQGQWLMQHQPTM-KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAER  470
            +PQ     Q+  TM K+++ I+AERD AI+ERN+ALSEKKAAL ERD A++QRD AI+ER
Sbjct  2    MPQHHLKEQNALTMNKKVVNILAERDNAIRERNIALSEKKAALEERDEALMQRDAAISER  61

Query  471  NNAIMERDNAIATLQYHES  527
            +NA++ERDNAIA L+Y ES
Sbjct  62   DNALLERDNAIAALRYRES  80



>ref|XP_009418729.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
Length=346

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 76/119 (64%), Gaps = 20/119 (17%)
 Frame = +3

Query  258  MDDGHRENGRHK------------LPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlals  401
            +D GHR++ RHK            +PQ Q  M+  P +K I+ ++AERD+AIQER LA+S
Sbjct  2    VDGGHRQHKRHKPAQFRSIHNKQIMPQNQ--MKDHPALK-IIALIAERDSAIQERELAIS  58

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQY-HESSMN----TGSMSPCPP  563
            EK AALAE D A+ +RD A A+R+NAIMERDNAIA L+Y  E S N     G  S C P
Sbjct  59   EKTAALAELDMALKERDAAFAKRDNAIMERDNAIAALRYAREKSYNGYNEQGCCSWCTP  117



>gb|KJB11171.1| hypothetical protein B456_001G243700 [Gossypium raimondii]
Length=219

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            K+IM I+AERDAAIQERN+A+SE+K ALA RD A+ QRD A+AER++A++ERDNA+A LQ
Sbjct  22   KKIMSILAERDAAIQERNIAISERKEALAARDEALQQRDKALAERDSALIERDNALAVLQ  81

Query  516  YHESSMN  536
              ES+ N
Sbjct  82   CRESAKN  88



>ref|XP_002305467.1| hypothetical protein POPTR_0004s17060g [Populus trichocarpa]
 gb|ABV53914.1| GAGA-motif binding transcriptional activator [Populus trichocarpa]
 gb|EEE85978.1| hypothetical protein POPTR_0004s17060g [Populus trichocarpa]
Length=317

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 69/109 (63%), Gaps = 17/109 (16%)
 Frame = +3

Query  261  DDGHRENGRHKL-------PQGQWLMQHQPTMKQ----------IMGIMAERDAAIQERN  389
            D G  +NGR+K+       P   W M  +  +K+          IM I+ ERD AI+ERN
Sbjct  3    DGGQHQNGRYKIDYYKTAHPHPPWNMMPRNQVKEQTNALVMNKKIMTILIERDDAIRERN  62

Query  390  lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            LA +EKK ALA RD AI QR+ A+AER+ A+MERDNA+A +QY E++MN
Sbjct  63   LAFAEKKEALAARDEAIQQREKALAERDKALMERDNALAAIQYRENAMN  111



>gb|ABK93737.1| unknown [Populus trichocarpa]
Length=317

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 69/109 (63%), Gaps = 17/109 (16%)
 Frame = +3

Query  261  DDGHRENGRHKL-------PQGQWLMQHQPTMKQ----------IMGIMAERDAAIQERN  389
            D G  +NGR+K+       P   W M  +  +K+          IM I+ ERD AI+ERN
Sbjct  3    DGGQHQNGRYKIDYYKTAHPHPPWNMMPRNQVKEQTNALVMNKKIMTILIERDDAIRERN  62

Query  390  lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            LA +EKK ALA RD AI QR+ A+AER+ A+MERDNA+A +QY E++MN
Sbjct  63   LAFAEKKEALAARDEAIQQREKALAERDKALMERDNALAAIQYRENAMN  111



>emb|CDP01919.1| unnamed protein product [Coffea canephora]
Length=323

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  HRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQR  449
            H  NG    P    +  +  ++K  M I AERDAAIQERN+AL E+K A +ERD A+LQR
Sbjct  11   HFRNGLLVSPAWLVMDHNHFSIKTYMAITAERDAAIQERNMALEERKRAFSERDMAMLQR  70

Query  450  DTAIAERNNAIMERDNAIATLQYHESSMN  536
            D AIAERN+AI ERD AIA LQ  + S+N
Sbjct  71   DAAIAERNSAIQERDEAIAALQIRDCSVN  99



>ref|XP_010431840.1| PREDICTED: LOW QUALITY PROTEIN: protein BASIC PENTACYSTEINE5-like 
[Camelina sativa]
Length=293

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 68/105 (65%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHK-------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlals  401
            G  ENGR K              PQ Q   QH   +  ++IM I+AE+DAA++E+N A++
Sbjct  5    GQYENGRFKPDHYKGTQSVWNMTPQHQIKEQHNALVMNRKIMSILAEKDAAVKEKNEAVA  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             KK ALA RD A+ QRD A++ER+NAIMER++A+  LQY E+++N
Sbjct  65   AKKEALAARDEALEQRDKALSERDNAIMERESALKALQYRENNLN  109



>gb|KHG11898.1| basic pentacysteine4 -like protein [Gossypium arboreum]
Length=310

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 71/105 (68%), Gaps = 15/105 (14%)
 Frame = +3

Query  267  GHRENGRHKLPQGQ-----WLMQHQPTMKQ----------IMGIMAERDAAIQERNlals  401
            G  ENGR+KL + +     W M  Q  +K+          IM I+AERDAAI+ERN+A+S
Sbjct  5    GQLENGRYKLDRYKGAHPPWNMMPQHHVKEQSNALVMNKKIMSILAERDAAIRERNIAVS  64

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            E+K ALA RD A+ QRD A+AER++A++ERDNA+A LQ  E++ N
Sbjct  65   ERKEALAARDEALQQRDKALAERDSALIERDNALAVLQCRENAKN  109



>ref|XP_004230934.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Solanum lycopersicum]
 ref|XP_010315340.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Solanum lycopersicum]
Length=313

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 69/112 (62%), Gaps = 16/112 (14%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQ-----WLMQHQPTMK---------QIMGIMAERDAAIQERNl  392
            MDDG  REN RH++   +     W +     MK         +I  + AERDAA++ERN 
Sbjct  1    MDDGGQRENRRHRMDYSKGCYAPWNVVPPYQMKDQEAFIMNTKIRMVFAERDAAVEERNR  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSM  548
            A+ EKK A AERD AI QRDTA AER+ AI ERDNAIA L + ES+ N GS+
Sbjct  61   AVIEKKEAYAERDFAIQQRDTAFAERDTAIKERDNAIAALHFLESTTN-GSL  111



>gb|ADV59368.1| GAGA-binding transcriptional activator [Artemisia annua]
Length=285

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  330  TMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIAT  509
            ++K  M IMAERDAAI+ERNLAL E+K A AERD A+LQRD A+AERN+ + ERD AIAT
Sbjct  7    SIKTFMAIMAERDAAIRERNLALDERKRAFAERDLAMLQRDAALAERNSVMQERDEAIAT  66

Query  510  LQYHESSMNTGSMS  551
            L++  + MN   MS
Sbjct  67   LRFRGNFMNENIMS  80



>gb|KDP27630.1| hypothetical protein JCGZ_19635 [Jatropha curcas]
Length=318

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            K+IM I+AERD AI+ERN+A++E++ ALA RD A+ QR+ A+AER+ A+MERDNA+A +Q
Sbjct  45   KKIMAILAERDTAIKERNMAIAERREALAARDEALQQREKALAERDKALMERDNALAAIQ  104

Query  516  YHESSMN  536
            Y E+ MN
Sbjct  105  YRENGMN  111



>gb|ADV59381.1| GAGA-binding transcriptional activator [Helianthus annuus]
Length=270

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +3

Query  330  TMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIAT  509
            T+K  M IMAERDAAIQERNLAL E+K A AERD A+LQRD A+AERN A+ ERD AI+T
Sbjct  7    TIKTFMAIMAERDAAIQERNLALEERKRAFAERDMAMLQRDAALAERNTAMQERDEAIST  66

Query  510  LQYHESSMNTGSMS  551
            +++  + +N   +S
Sbjct  67   IRFRSNFINENMIS  80



>ref|XP_008236825.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Prunus mume]
Length=329

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 68/108 (63%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDGHR-ENGRHKL-----PQGQWLMQHQPTMKQ---------IMGIMAERDAAIQERNl  392
            MDDG + ENGRHK+         W M  Q   K+         IM I+AERDAAI+ERN 
Sbjct  19   MDDGRQHENGRHKMDYYRGAASPWNMATQQQAKEPNALVMNKKIMSIIAERDAAIRERNA  78

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            ALSEK  ALA RD A+ QRD A+A+R+ A+MERDNA A L   ++++N
Sbjct  79   ALSEKNEALAARDEALRQRDEALAQRDTAMMERDNAFAALHMRDNAVN  126



>ref|XP_008236826.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X2 [Prunus mume]
Length=311

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 68/108 (63%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDGHR-ENGRHKL-----PQGQWLMQHQPTMKQ---------IMGIMAERDAAIQERNl  392
            MDDG + ENGRHK+         W M  Q   K+         IM I+AERDAAI+ERN 
Sbjct  1    MDDGRQHENGRHKMDYYRGAASPWNMATQQQAKEPNALVMNKKIMSIIAERDAAIRERNA  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            ALSEK  ALA RD A+ QRD A+A+R+ A+MERDNA A L   ++++N
Sbjct  61   ALSEKNEALAARDEALRQRDEALAQRDTAMMERDNAFAALHMRDNAVN  108



>ref|XP_007201267.1| hypothetical protein PRUPE_ppa008471mg [Prunus persica]
 gb|EMJ02466.1| hypothetical protein PRUPE_ppa008471mg [Prunus persica]
Length=330

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDGHR-ENGRHKL-----PQGQWLMQHQPTMKQ---------IMGIMAERDAAIQERNl  392
            MDDG + ENGRHK+         W M  Q   K+         IM I+AERDAAI+ERN 
Sbjct  20   MDDGRQHENGRHKMDYYRGAASPWNMATQQQAKEPNALVMNKKIMSIIAERDAAIRERNA  79

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            AL+EK  ALA RD A+ QRD A+A+R+ A+MERDNA A L   ++++N
Sbjct  80   ALTEKNEALAARDEALRQRDEALAQRDTAMMERDNAFAALHMRDNAVN  127



>ref|XP_007201266.1| hypothetical protein PRUPE_ppa008471mg [Prunus persica]
 gb|EMJ02465.1| hypothetical protein PRUPE_ppa008471mg [Prunus persica]
Length=311

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDGHR-ENGRHKL-----PQGQWLMQHQPTMKQ---------IMGIMAERDAAIQERNl  392
            MDDG + ENGRHK+         W M  Q   K+         IM I+AERDAAI+ERN 
Sbjct  1    MDDGRQHENGRHKMDYYRGAASPWNMATQQQAKEPNALVMNKKIMSIIAERDAAIRERNA  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            AL+EK  ALA RD A+ QRD A+A+R+ A+MERDNA A L   ++++N
Sbjct  61   ALTEKNEALAARDEALRQRDEALAQRDTAMMERDNAFAALHMRDNAVN  108



>ref|XP_009804621.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Nicotiana sylvestris]
 ref|XP_009804622.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Nicotiana sylvestris]
Length=313

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 66/108 (61%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQ-----WLMQHQPTMK---------QIMGIMAERDAAIQERNl  392
            MDDG  RE+ RH++   +     W +     MK         +I  + AERDAA++ER+ 
Sbjct  1    MDDGGRRESRRHRMDCSKGGHAPWNVVPPYQMKDQEAFIMNTKIRMLFAERDAAVEERDR  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            A+ EK   L ERD AI QRDTAIAER+ AI ERDNAIA L + ES+MN
Sbjct  61   AVIEKNTVLTERDLAIQQRDTAIAERDTAIKERDNAIAALHFQESTMN  108



>ref|XP_002868871.1| hypothetical protein ARALYDRAFT_327841 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45130.1| hypothetical protein ARALYDRAFT_327841 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 67/104 (64%), Gaps = 14/104 (13%)
 Frame = +3

Query  267  GHRENGRHK------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalse  404
            G  ENGR+K            +PQ Q   QH   +  K+IM I+AERDAA++E N A++ 
Sbjct  19   GQYENGRYKPDYNKGTQSVNMMPQHQIKEQHNALVMNKKIMSILAERDAAVKEINEAVAA  78

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             K ALA RD A+ QRD A++ER+NAIME ++A+  L+Y E+++N
Sbjct  79   TKEALAARDEALEQRDKALSERDNAIMETESALNALRYRENNLN  122



>ref|XP_004148546.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis sativus]
 gb|KGN43188.1| hypothetical protein Csa_7G007860 [Cucumis sativus]
Length=313

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDGHR-ENGRHKL-----PQGQWLMQ-----HQPTM----KQIMGIMAERDAAIQERNl  392
            MDDG + ENGRHKL         W M       +P      K+IM I+AERDAAI+ERNL
Sbjct  1    MDDGRQHENGRHKLDYFRGSSSPWNMVPPNHVKEPNALVMNKKIMSIIAERDAAIRERNL  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            ALSEKK ALA RD A+ QRD A+ +R++A+MERDNA+A L+  +++ N
Sbjct  61   ALSEKKEALAARDEALRQRDEALVQRDSALMERDNALAALEIRDNASN  108



>ref|XP_004172323.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis sativus]
Length=337

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDGHR-ENGRHKL-----PQGQWLMQ-----HQPTM----KQIMGIMAERDAAIQERNl  392
            MDDG + ENGRHKL         W M       +P      K+IM I+AERDAAI+ERNL
Sbjct  25   MDDGRQHENGRHKLDYFRGSSSPWNMVPPNHVKEPNALVMNKKIMSIIAERDAAIRERNL  84

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            ALSEKK ALA RD A+ QRD A+ +R++A+MERDNA+A L+  +++ N
Sbjct  85   ALSEKKEALAARDEALRQRDEALVQRDSALMERDNALAALEIRDNASN  132



>ref|NP_001274818.1| protein BASIC PENTACYSTEINE4-like [Solanum tuberosum]
 gb|ADV59398.1| GAGA-binding transcriptional activator [Solanum tuberosum]
Length=313

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 69/112 (62%), Gaps = 16/112 (14%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQ-----WLMQHQPTMK---------QIMGIMAERDAAIQERNl  392
            MDDG  REN RH++   +     W +     MK         +I  + AERDAA++ER+ 
Sbjct  1    MDDGGQRENRRHRMDYSKGGYAPWNVVPPYQMKDQEAFIMNTKIRMVFAERDAAVEERDR  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSM  548
            A+ EKK A AERD AI QRDTA AER+ A+ ERDNAIA L + ES+ N GS+
Sbjct  61   AVIEKKEAYAERDFAIQQRDTAFAERDTAVKERDNAIAALHFLESTTN-GSL  111



>emb|CDO96980.1| unnamed protein product [Coffea canephora]
Length=312

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  351  IMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESS  530
            ++AERDAAI+ER+ ALSEK+AAL ERD+AI QRDTAI+ER++A+ ERDNAIA LQ+ ES+
Sbjct  47   LLAERDAAIEERDRALSEKRAALDERDSAIQQRDTAISERDHALRERDNAIAALQFQEST  106

Query  531  MN  536
            MN
Sbjct  107  MN  108



>ref|XP_006359607.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Solanum tuberosum]
Length=313

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 69/112 (62%), Gaps = 16/112 (14%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQ-----------WLMQHQPTM---KQIMGIMAERDAAIQERNl  392
            MDDG  REN RH++   +           + M+ Q       +I  + AERDAA++ER+ 
Sbjct  1    MDDGGQRENRRHRMDYSKGGYAPWNVVPPYQMKDQEAFIMNTKIRMVFAERDAAVEERDR  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMNTGSM  548
            A+ EKK A AERD AI QRDTA AER+ A+ ERDNAIA L + ES+ N GS+
Sbjct  61   AVIEKKEAYAERDFAIQQRDTAFAERDTAVKERDNAIAALHFLESTTN-GSL  111



>ref|XP_009379565.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Pyrus 
x bretschneideri]
Length=311

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 16/109 (15%)
 Frame = +3

Query  258  MDDGHR-ENGRHKL--------PQGQWLMQHQPTM-------KQIMGIMAERDAAIQERN  389
            MDDG + ENGRHK+        P    + Q Q          K+IM I+AERDAAI+ERN
Sbjct  1    MDDGRQHENGRHKMDYYRGGTAPPWNMMAQQQAKEPNALVMNKKIMSIIAERDAAIRERN  60

Query  390  lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             AL+EK  ALA RD A+ QRD A+A+R++A+MERDNA A L   ++++N
Sbjct  61   AALAEKNEALAARDEALRQRDEALAQRDSAMMERDNAYAALHSRDNAVN  109



>ref|XP_008448032.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448033.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448034.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448035.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448036.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448037.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448038.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448039.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
Length=313

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 73/108 (68%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDGHR-ENGRHKLPQGQ-----WLMQ-----HQPTM----KQIMGIMAERDAAIQERNl  392
            MDDG + ENGRHKL   +     W M       +P      K+IM I+AERDAAI+ERNL
Sbjct  1    MDDGRQHENGRHKLDYFRGSPSPWNMVPPNHVKEPNALVMNKKIMSIIAERDAAIRERNL  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            ALSEKK ALA RD A+ QRD A+ +R++A+MERDNA+A L+  +++ N
Sbjct  61   ALSEKKDALAARDEALRQRDEALVQRDSALMERDNALAALEIRDNASN  108



>ref|XP_009378461.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009378462.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009378463.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Pyrus 
x bretschneideri]
Length=311

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 70/109 (64%), Gaps = 16/109 (15%)
 Frame = +3

Query  258  MDDGHR-ENGRHKLPQGQ------WLMQHQPTMKQ---------IMGIMAERDAAIQERN  389
            MDDG + ENGRHK+   +      W M  Q   K+         IM I+A+RDAAI+ERN
Sbjct  1    MDDGRQHENGRHKMDYYRGGVASPWNMMTQQQAKEPNALVMNKKIMSIIADRDAAIRERN  60

Query  390  lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             AL+EK  ALA RD A+ QRD A+A+R++A+MERDNA A L   ++++N
Sbjct  61   AALAEKNEALAARDEALRQRDEALAQRDSALMERDNAYAALHSRDNAVN  109



>ref|XP_009378460.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Pyrus 
x bretschneideri]
Length=337

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 70/109 (64%), Gaps = 16/109 (15%)
 Frame = +3

Query  258  MDDGHR-ENGRHKLPQGQ------WLMQHQPTMKQ---------IMGIMAERDAAIQERN  389
            MDDG + ENGRHK+   +      W M  Q   K+         IM I+A+RDAAI+ERN
Sbjct  27   MDDGRQHENGRHKMDYYRGGVASPWNMMTQQQAKEPNALVMNKKIMSIIADRDAAIRERN  86

Query  390  lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             AL+EK  ALA RD A+ QRD A+A+R++A+MERDNA A L   ++++N
Sbjct  87   AALAEKNEALAARDEALRQRDEALAQRDSALMERDNAYAALHSRDNAVN  135



>ref|XP_009627340.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=274

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 67/108 (62%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQ-----WLMQHQPTMK---------QIMGIMAERDAAIQERNl  392
            MDDG  RE+ RH++   +     W +     MK         +I  + AERDAA++ER+ 
Sbjct  1    MDDGGRRESRRHRMDCSKGGHAPWNVVPPYQMKDQEAFIMNTKIRMLCAERDAAVEERDR  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            A+ EK   LAERD AI QRDTAIAER+ AI ERDNAIA L + ES+MN
Sbjct  61   AVIEKNTVLAERDLAIQQRDTAIAERDTAIKERDNAIAALLFQESTMN  108



>ref|XP_009378459.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Pyrus 
x bretschneideri]
Length=338

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 70/109 (64%), Gaps = 16/109 (15%)
 Frame = +3

Query  258  MDDGHR-ENGRHKLPQGQ------WLMQHQPTMKQ---------IMGIMAERDAAIQERN  389
            MDDG + ENGRHK+   +      W M  Q   K+         IM I+A+RDAAI+ERN
Sbjct  28   MDDGRQHENGRHKMDYYRGGVASPWNMMTQQQAKEPNALVMNKKIMSIIADRDAAIRERN  87

Query  390  lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             AL+EK  ALA RD A+ QRD A+A+R++A+MERDNA A L   ++++N
Sbjct  88   AALAEKNEALAARDEALRQRDEALAQRDSALMERDNAYAALHSRDNAVN  136



>ref|XP_009627338.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009627339.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=306

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 67/108 (62%), Gaps = 15/108 (14%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQ-----WLMQHQPTMK---------QIMGIMAERDAAIQERNl  392
            MDDG  RE+ RH++   +     W +     MK         +I  + AERDAA++ER+ 
Sbjct  1    MDDGGRRESRRHRMDCSKGGHAPWNVVPPYQMKDQEAFIMNTKIRMLCAERDAAVEERDR  60

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            A+ EK   LAERD AI QRDTAIAER+ AI ERDNAIA L + ES+MN
Sbjct  61   AVIEKNTVLAERDLAIQQRDTAIAERDTAIKERDNAIAALLFQESTMN  108



>gb|ABK96608.1| unknown [Populus trichocarpa x Populus deltoides]
Length=322

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 72/116 (62%), Gaps = 23/116 (20%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQ------------WLM--QHQ--------PTMKQIMGIMAERD  368
            MDDG   +NGR+K+   +            W M  QHQ           K+IM I+ ERD
Sbjct  1    MDDGGQHQNGRYKMDYYKAAHPHPHPHPPAWNMMSQHQVKEQTNALAMNKKIMTILIERD  60

Query  369  AAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             AI+ERNLAL+EKK ALA RD AI QR+ A+ ER+ A+MERDNA+A +QY E++MN
Sbjct  61   DAIRERNLALAEKKEALAARDEAIQQREKALVERDKALMERDNALAAIQYRENAMN  116



>ref|XP_011037231.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Populus euphratica]
 ref|XP_011037232.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Populus euphratica]
Length=317

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 69/109 (63%), Gaps = 17/109 (16%)
 Frame = +3

Query  261  DDGHRENGRHKL-------PQGQWLMQHQPTMKQ----------IMGIMAERDAAIQERN  389
            D G  +NGR+K+       P   W M  +  MK+          IM I+ ERD AI+ERN
Sbjct  3    DGGQHQNGRYKIDYYKTAHPHPPWNMMPRNQMKEQTNALVMNKKIMTILIERDDAIRERN  62

Query  390  lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            LAL+EKK ALA RD AI QR+ A+ ER+ A+MERDNA+A++Q  E++MN
Sbjct  63   LALAEKKEALAARDEAIQQREKALVERDKALMERDNALASIQCRENAMN  111



>gb|ABU63290.1| GAGA-motif binding transcriptional activator, partial [Arabidopsis 
thaliana]
Length=297

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 17/104 (16%)
 Frame = +3

Query  267  GHRENGRHK------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalse  404
            G  ENGR+K            +P+ +   QH   +  K+I+ I+AERDAA++ERN A++ 
Sbjct  19   GQYENGRYKPDYYKGTQSVNVMPKKE---QHNALVMNKKIISILAERDAAVKERNEAVAA  75

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             K ALA RD A+ QRD A++ER+NAIME ++A+  L+Y E+++N
Sbjct  76   TKEALASRDEALEQRDKALSERDNAIMETESALNALRYRENNLN  119



>ref|NP_001190957.1| basic pentacysteine 5 [Arabidopsis thaliana]
 sp|F4JUI3.1|BPC5_ARATH RecName: Full=Protein BASIC PENTACYSTEINE5; Short=AtBPC5; AltName: 
Full=GAGA-motif binding transcriptional activator BBR/BPC5 
[Arabidopsis thaliana]
 gb|AEE86992.1| basic pentacysteine 5 [Arabidopsis thaliana]
Length=283

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 17/104 (16%)
 Frame = +3

Query  267  GHRENGRHK------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalse  404
            G  ENGR+K            +P+ +   QH   +  K+I+ I+AERDAA++ERN A++ 
Sbjct  5    GQYENGRYKPDYYKGTQSVNVMPKKE---QHNALVMNKKIISILAERDAAVKERNEAVAA  61

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             K ALA RD A+ QRD A++ER+NAIME ++A+  L+Y E+++N
Sbjct  62   TKEALASRDEALEQRDKALSERDNAIMETESALNALRYRENNLN  105



>gb|ABU63289.1| GAGA-motif binding transcriptional activator, partial [Arabidopsis 
thaliana]
Length=297

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 17/104 (16%)
 Frame = +3

Query  267  GHRENGRHK------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalse  404
            G  ENGR+K            +P+ +   QH   +  K+I+ I+AERDAA++ERN A++ 
Sbjct  19   GQYENGRYKPDYYKGTQSVNVMPKKE---QHNALVMNKKIISILAERDAAVKERNEAVAA  75

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             K ALA RD A+ QRD A++ER+NAIME ++A+  L+Y E+++N
Sbjct  76   TKEALASRDEALEQRDKALSERDNAIMETESALNALRYRENNLN  119



>gb|ABU63288.1| GAGA-motif binding transcriptional activator, partial [Cardamine 
pratensis]
Length=275

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            K+IM I+AERDAAI+ERN A++ KK ALA RD A+ QRD A++ER+NAIME ++A+  LQ
Sbjct  23   KKIMSILAERDAAIKERNEAVAAKKEALAARDEALEQRDKALSERDNAIMETESALNALQ  82

Query  516  YHESSMN  536
            + E+++N
Sbjct  83   FRENNLN  89



>emb|CAB38811.1| putative protein [Arabidopsis thaliana]
 emb|CAB80554.1| putative protein [Arabidopsis thaliana]
Length=445

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 17/104 (16%)
 Frame = +3

Query  267  GHRENGRHK------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalse  404
            G  ENGR+K            +P+ +   QH   +  K+I+ I+AERDAA++ERN A++ 
Sbjct  19   GQYENGRYKPDYYKGTQSVNVMPKKE---QHNALVMNKKIISILAERDAAVKERNEAVAA  75

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             K ALA RD A+ QRD A++ER+NAIME ++A+  L+Y E+++N
Sbjct  76   TKEALASRDEALEQRDKALSERDNAIMETESALNALRYRENNLN  119



>gb|EMS63619.1| hypothetical protein TRIUR3_11677 [Triticum urartu]
Length=385

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 15/109 (14%)
 Frame = +3

Query  258  MDD-GHRENGR-----HKLPQGQWLMQHQPTMKQ-----IMGIMAERDAAIQERNlalse  404
            MD+ GHRENGR     +K    QW+M  Q  MK      ++ +++ERD AI ER+ AL+E
Sbjct  1    MDNLGHRENGRQRPDPYKALHTQWMMP-QRQMKDHHSMNLLALLSERDTAIMERDHALAE  59

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHES---SMNTG  542
            KKAA+AERD A  QRD+A+AERN AI+ERDNA+A L+   +   +MN+G
Sbjct  60   KKAAMAERDMAFAQRDSAMAERNAAIVERDNALAALELARTNGFNMNSG  108



>ref|NP_001078691.1| basic pentacysteine 6 [Arabidopsis thaliana]
 gb|AED94822.1| basic pentacysteine 6 [Arabidopsis thaliana]
Length=282

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = +3

Query  435  AILQRDTAIAERNNAIMERDNAIATLQYHESSMNT---GSMSPCPPGC  569
            A LQRDTAIAERNNAIMERD+A+  LQY E+SM T    +MS CPPGC
Sbjct  2    AFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAPAANMSACPPGC  49



>ref|XP_009109516.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
 emb|CDX90300.1| BnaA08g16840D [Brassica napus]
Length=285

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 64/102 (63%), Gaps = 16/102 (16%)
 Frame = +3

Query  267  GHRENGRHK--------------LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlal  398
            G  +NGR+K              +PQ Q   QH   +  K+IM I+AERDAA++ERN AL
Sbjct  5    GQYDNGRYKPDYYKGTPPSVWNMMPQHQIKEQHNALVMNKKIMSILAERDAALKERNEAL  64

Query  399  sekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHE  524
            + KK ALA RD A+ QRD A++ER+NAIMER+ A+  L Y E
Sbjct  65   AAKKEALAARDEALEQRDKALSERDNAIMERETALNALHYPE  106



>ref|XP_008382361.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Malus domestica]
 ref|XP_008365904.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Malus 
domestica]
 ref|XP_008365905.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Malus 
domestica]
 ref|XP_008365906.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Malus 
domestica]
Length=311

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 16/109 (15%)
 Frame = +3

Query  258  MDDGHR-ENGRHKLPQGQ------WLMQHQPTMKQ---------IMGIMAERDAAIQERN  389
            MDDG + ENGRHK+   +      W M  Q   K+         IM I+A+RDAAI+ERN
Sbjct  1    MDDGRQHENGRHKMDYYRGGVASPWNMMAQQQAKEPNALVMNKKIMSIIADRDAAIRERN  60

Query  390  lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             AL+EK  ALA RD A+ QRD A+ +R++A+MERDNA A L   ++++N
Sbjct  61   AALAEKNEALAARDEALRQRDEALTQRDSALMERDNAYAALHSRDNAVN  109



>ref|XP_004964426.1| PREDICTED: barley B recombinant-like protein D-like isoform X1 
[Setaria italica]
 ref|XP_004964427.1| PREDICTED: barley B recombinant-like protein D-like isoform X2 
[Setaria italica]
Length=329

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 68/97 (70%), Gaps = 14/97 (14%)
 Frame = +3

Query  258  MDD-GHRENGR-----HKLPQGQWLMQHQPTMKQ-----IMGIMAERDAAIQERNlalse  404
            MD+ GHRENGR     +K    QW+M   P +K      ++ +M E+D+AI+ER+ AL+E
Sbjct  2    MDNLGHRENGRQRPDQYKAVHTQWMM---PQLKDHHSMNLLALMNEKDSAIRERDHALAE  58

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            KKAA+AERD A  QRD A+AERN AI+ERDNA+A L+
Sbjct  59   KKAAIAERDMAFAQRDAAMAERNAAIVERDNALAALE  95



>ref|XP_002313754.1| hypothetical protein POPTR_0009s12820g [Populus trichocarpa]
 gb|EEE87709.1| hypothetical protein POPTR_0009s12820g [Populus trichocarpa]
Length=301

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 21/114 (18%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQ----------WLM--QHQ--------PTMKQIMGIMAERDAA  374
            MDDG   +NGR K+   +          W M  QHQ           K+IM I+ ERD A
Sbjct  1    MDDGGQHQNGRFKMDYYKAAHPHPHPPAWNMMSQHQVKEQTNALAMNKKIMTILIERDDA  60

Query  375  IQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            I+ERNLAL+EKK ALA RD AI QR+ A+ ER+ A+MERDNA+A +QY E++M+
Sbjct  61   IRERNLALAEKKEALAARDEAIQQREKALVERDKALMERDNALAAIQYRENAMS  114



>ref|XP_008365900.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Malus 
domestica]
Length=338

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 16/109 (15%)
 Frame = +3

Query  258  MDDGHR-ENGRHKLPQGQ------WLMQHQPTMKQ---------IMGIMAERDAAIQERN  389
            MDDG + ENGRHK+   +      W M  Q   K+         IM I+A+RDAAI+ERN
Sbjct  28   MDDGRQHENGRHKMDYYRGGVASPWNMMAQQQAKEPNALVMNKKIMSIIADRDAAIRERN  87

Query  390  lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             AL+EK  ALA RD A+ QRD A+ +R++A+MERDNA A L   ++++N
Sbjct  88   AALAEKNEALAARDEALRQRDEALTQRDSALMERDNAYAALHSRDNAVN  136



>ref|XP_008365901.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Malus 
domestica]
 ref|XP_008365902.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Malus 
domestica]
Length=337

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 16/109 (15%)
 Frame = +3

Query  258  MDDGHR-ENGRHKLPQGQ------WLMQHQPTMKQ---------IMGIMAERDAAIQERN  389
            MDDG + ENGRHK+   +      W M  Q   K+         IM I+A+RDAAI+ERN
Sbjct  27   MDDGRQHENGRHKMDYYRGGVASPWNMMAQQQAKEPNALVMNKKIMSIIADRDAAIRERN  86

Query  390  lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             AL+EK  ALA RD A+ QRD A+ +R++A+MERDNA A L   ++++N
Sbjct  87   AALAEKNEALAARDEALRQRDEALTQRDSALMERDNAYAALHSRDNAVN  135



>ref|XP_006655749.1| PREDICTED: barley B recombinant-like protein D-like [Oryza brachyantha]
Length=330

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 67/97 (69%), Gaps = 11/97 (11%)
 Frame = +3

Query  258  MDD-GHRENGRHKLPQ-----GQWLMQHQPTMKQ-----IMGIMAERDAAIQERNlalse  404
            MD+ GHRENGR +  Q      QW+M  Q  +K      ++ +M +RD AI+ER+ AL+E
Sbjct  1    MDNLGHRENGRQRPDQYKGLHTQWMMPQQRHLKDHQSMNLLALMNDRDNAIRERDHALAE  60

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            KKAA+AERD A  QRD A+AERN A++ERDNA+A L+
Sbjct  61   KKAAIAERDMAFAQRDAAMAERNAAVVERDNALAALE  97



>ref|XP_006379265.1| hypothetical protein POPTR_0009s12820g [Populus trichocarpa]
 gb|ADV59343.1| GAGA-binding transcriptional activator [Populus trichocarpa]
 gb|ADV59344.1| GAGA-binding transcriptional activator [Populus trichocarpa]
 gb|ERP57062.1| hypothetical protein POPTR_0009s12820g [Populus trichocarpa]
Length=320

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 21/114 (18%)
 Frame = +3

Query  258  MDDG-HRENGRHKLPQGQ----------WLM--QHQ--------PTMKQIMGIMAERDAA  374
            MDDG   +NGR K+   +          W M  QHQ           K+IM I+ ERD A
Sbjct  1    MDDGGQHQNGRFKMDYYKAAHPHPHPPAWNMMSQHQVKEQTNALAMNKKIMTILIERDDA  60

Query  375  IQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            I+ERNLAL+EKK ALA RD AI QR+ A+ ER+ A+MERDNA+A +QY E++M+
Sbjct  61   IRERNLALAEKKEALAARDEAIQQREKALVERDKALMERDNALAAIQYRENAMS  114



>gb|EAY99518.1| hypothetical protein OsI_21488 [Oryza sativa Indica Group]
Length=274

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 15/110 (14%)
 Frame = +3

Query  258  MDD-GHRENGRHKLPQ-----GQWLM-QHQPTMKQ-----IMGIMAERDAAIQERNlals  401
            MD+ GHRENGR +  Q      QW+M Q Q  +K      ++ +M +RD AI+ER+ AL+
Sbjct  1    MDNLGHRENGRQRPDQYKGLHTQWMMPQTQRHLKDHQSMNLLALMNDRDNAIRERDHALA  60

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ---YHESSMNTG  542
            EKKAA+AERD A  QRD A+AERN A++ERDNA+A L+   Y  SS + G
Sbjct  61   EKKAAIAERDMAFTQRDAAMAERNAAVVERDNALAALESIPYLNSSRSAG  110



>dbj|BAK06066.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 11/93 (12%)
 Frame = +3

Query  267  GHRENGR-----HKLPQGQWLMQHQPTMKQ-----IMGIMAERDAAIQERNlalsekkaa  416
            GHRE+GR     +K    QW+M  Q  MK      ++ +M+ERD AI ER+ AL+EKKAA
Sbjct  5    GHREDGRQRQDSYKALHTQWMMP-QRQMKDHHSMNLLALMSERDNAIMERDHALAEKKAA  63

Query  417  laeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            +AERD A  QRD+A+AERN AI+ERDNA+A L+
Sbjct  64   MAERDMAFAQRDSAMAERNAAIVERDNALAALE  96



>dbj|BAK05756.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 11/93 (12%)
 Frame = +3

Query  267  GHRENGR-----HKLPQGQWLMQHQPTMKQ-----IMGIMAERDAAIQERNlalsekkaa  416
            GHRE+GR     +K    QW+M  Q  MK      ++ +M+ERD AI ER+ AL+EKKAA
Sbjct  5    GHREDGRQRQDSYKALHTQWMMP-QRQMKDHHSMNLLALMSERDNAIMERDHALAEKKAA  63

Query  417  laeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            +AERD A  QRD+A+AERN AI+ERDNA+A L+
Sbjct  64   MAERDMAFAQRDSAMAERNAAIVERDNALAALE  96



>emb|CDY12110.1| BnaC03g60260D [Brassica napus]
Length=279

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +3

Query  294  LPQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAE  467
            +PQ Q   QH   +  K+IM I+AERDAA++ERN AL+ KK ALA RD A+ QRD A++E
Sbjct  28   MPQHQIKEQHNALVMNKKIMSILAERDAALKERNEALAAKKEALAARDEALEQRDKALSE  87

Query  468  RNNAIMERDNAIATLQYHESS  530
            R+NAIMER+ A+  L Y E +
Sbjct  88   RDNAIMERETALNALHYPEKN  108



>ref|NP_195602.5| basic pentacysteine 5 [Arabidopsis thaliana]
 gb|AEE86991.1| basic pentacysteine 5 [Arabidopsis thaliana]
Length=258

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            K+I+ I+AERDAA++ERN A++  K ALA RD A+ QRD A++ER+NAIME ++A+  L+
Sbjct  14   KKIISILAERDAAVKERNEAVAATKEALASRDEALEQRDKALSERDNAIMETESALNALR  73

Query  516  YHESSMN  536
            Y E+++N
Sbjct  74   YRENNLN  80



>ref|XP_010444881.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Camelina sativa]
Length=280

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = +3

Query  297  PQGQWLMQHQPTM--KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAER  470
            PQ Q   QH   +  K+IM I+AERD A++E+N A++ KK ALA RD A+ QRD A++ER
Sbjct  27   PQHQIKEQHNALVMNKKIMSILAERDTAVKEKNEAVAAKKEALAARDEALEQRDKALSER  86

Query  471  NNAIMERDNAIATLQYHESS  530
            + AIMER++A+  LQY E++
Sbjct  87   DTAIMERESALNALQYRENN  106



>ref|NP_001141822.1| BBR/BPC transcription factor [Zea mays]
 ref|XP_008658294.1| PREDICTED: BBR/BPC transcription factor isoform X1 [Zea mays]
 gb|ACF87113.1| unknown [Zea mays]
 gb|ACG36592.1| GAGA-binding transcriptional activator [Zea mays]
 gb|ACR34757.1| unknown [Zea mays]
 gb|ADX60201.1| BBR/BPC transcription factor [Zea mays]
 gb|AFW86020.1| GAGA-binding transcriptional activator isoform 1 [Zea mays]
 gb|AFW86021.1| GAGA-binding transcriptional activator isoform 2 [Zea mays]
 gb|AFW86022.1| GAGA-binding transcriptional activator isoform 3 [Zea mays]
Length=330

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 75/109 (69%), Gaps = 13/109 (12%)
 Frame = +3

Query  258  MDD-GHRENGR-----HKLPQGQWLM-QHQPTMKQIMGIMA---ERDAAIQERNlalsek  407
            MD+ GHRENGR     +K    QW++ Q Q    Q M ++A   E+D+AI+ER+ AL+EK
Sbjct  1    MDNLGHRENGRQRPEQYKALHTQWMIPQRQLKDHQSMNLLALMNEKDSAIRERDHALAEK  60

Query  408  kaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHES---SMNTGS  545
            KAA+AERD A  QRD A+AERN AI+ERDNA+A L+   +   +MN+G+
Sbjct  61   KAAIAERDMAFAQRDAAMAERNAAIVERDNALAALELARTNGFNMNSGN  109



>gb|EPS70368.1| hypothetical protein M569_04392 [Genlisea aurea]
Length=241

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 5/71 (7%)
 Frame = +3

Query  354  MAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSM  533
            MAERDAAIQERNLA+SEKKAA+AERD AILQRD+AI+ERNNAI+ERDNA+     H  S 
Sbjct  1    MAERDAAIQERNLAISEKKAAIAERDMAILQRDSAISERNNAIIERDNAL-----HFRST  55

Query  534  NTGSMSPCPPG  566
            +T + +P   G
Sbjct  56   STINTNPSSTG  66



>gb|AGT17153.1| basic pentacysteine 6 [Saccharum hybrid cultivar R570]
Length=330

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 10/96 (10%)
 Frame = +3

Query  258  MDD-GHRENGR-----HKLPQGQWLMQHQPTMKQ----IMGIMAERDAAIQERNlalsek  407
            MD+ GHRENGR     +K    QW+M  +         ++ +M E+D+AI+ER+ AL+EK
Sbjct  1    MDNLGHRENGRQRPDQYKAVHTQWMMPQRQLKDHHSMNLLALMNEKDSAIRERDHALAEK  60

Query  408  kaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            KAA+AERD A  QRD A+AERN AI+ERDNA+A L+
Sbjct  61   KAAIAERDMAFAQRDAAMAERNAAIVERDNALAALE  96



>gb|EAZ35708.1| hypothetical protein OsJ_19997 [Oryza sativa Japonica Group]
Length=307

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 12/98 (12%)
 Frame = +3

Query  258  MDD-GHRENGRHKLPQ-----GQWLM-QHQPTMKQ-----IMGIMAERDAAIQERNlals  401
            MD+ GHRENGR +  Q      QW+M Q Q  +K      ++ +M +RD AI+ER+ AL+
Sbjct  1    MDNLGHRENGRQRPDQYKGLHTQWMMPQTQRHLKDHQSMNLLALMNDRDNAIRERDHALA  60

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            EKKAA+AERD A  QRD A+AERN A++ERDNA+A L+
Sbjct  61   EKKAAIAERDMAFTQRDAAMAERNAAVVERDNALAALE  98



>ref|XP_011047142.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Populus euphratica]
 ref|XP_011047147.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Populus euphratica]
 ref|XP_011047155.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Populus euphratica]
Length=326

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            K+IM I+ ERD AI+ERNLAL+EKK ALA RD AI QR+ A+ ER+ A+MERDNA+A +Q
Sbjct  54   KKIMTILIERDDAIRERNLALAEKKEALAARDEAIQQREKALVERDKALMERDNALAAIQ  113

Query  516  YHESSMN  536
            + E++MN
Sbjct  114  HRENAMN  120



>ref|XP_009379566.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Pyrus 
x bretschneideri]
Length=285

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            K+IM I+AERDAAI+ERN AL+EK  ALA RD A+ QRD A+A+R++A+MERDNA A L 
Sbjct  17   KKIMSIIAERDAAIRERNAALAEKNEALAARDEALRQRDEALAQRDSAMMERDNAYAALH  76

Query  516  YHESSMNTGSMSPCPPG  566
              ++++N       P G
Sbjct  77   SRDNAVNFPLGGGAPRG  93



>ref|NP_001056691.1| Os06g0130600 [Oryza sativa Japonica Group]
 sp|Q5VSA8.1|BBRD_ORYSJ RecName: Full=Barley B recombinant-like protein D; Short=BBR-like 
protein D; AltName: Full=GAGA-binding transcriptional activator 
BBR-D [Oryza sativa Japonica Group]
 dbj|BAD67667.1| putative basic pentacysteine 4 [Oryza sativa Japonica Group]
 gb|AAX59045.1| barley B recombinant-like protein D [Oryza sativa Japonica Group]
 gb|AAX59046.1| barley B recombinant-like protein D [Oryza sativa Japonica Group]
 dbj|BAF18605.1| Os06g0130600 [Oryza sativa Japonica Group]
 dbj|BAG92056.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 12/98 (12%)
 Frame = +3

Query  258  MDD-GHRENGRHKLPQ-----GQWLM-QHQPTMKQ-----IMGIMAERDAAIQERNlals  401
            MD+ GHRENGR +  Q      QW+M Q Q  +K      ++ +M +RD AI+ER+ AL+
Sbjct  1    MDNLGHRENGRQRPDQYKGLHTQWMMPQTQRHLKDHQSMNLLALMNDRDNAIRERDHALA  60

Query  402  ekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            EKKAA+AERD A  QRD A+AERN A++ERDNA+A L+
Sbjct  61   EKKAAIAERDMAFTQRDAAMAERNAAVVERDNALAALE  98



>emb|CDY42593.1| BnaC01g00050D [Brassica napus]
Length=282

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            ++IM I+AERDAA++ER+ AL+ K+ ALA RD A+ QRD A++ R+NAI+ERD+A++ LQ
Sbjct  41   QKIMSILAERDAALKERDDALAAKQEALAARDEALDQRDKALSLRDNAILERDSALSALQ  100

Query  516  YHESSMN  536
            + E ++N
Sbjct  101  FREHNLN  107



>ref|XP_009378464.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X4 [Pyrus 
x bretschneideri]
Length=285

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            K+IM I+A+RDAAI+ERN AL+EK  ALA RD A+ QRD A+A+R++A+MERDNA A L 
Sbjct  17   KKIMSIIADRDAAIRERNAALAEKNEALAARDEALRQRDEALAQRDSALMERDNAYAALH  76

Query  516  YHESSMN  536
              ++++N
Sbjct  77   SRDNAVN  83



>ref|XP_010028660.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X2 [Eucalyptus 
grandis]
Length=303

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 5/98 (5%)
 Frame = +3

Query  258  MDDGHRE-NGRHKL---PQGQWLMQHQPTMKQ-IMGIMAERDAAIQERNlalsekkaala  422
            MDDG +  N RHK    PQ Q   ++   M Q IM I+ E++ AIQER  A ++ KAA+ 
Sbjct  1    MDDGGQHGNHRHKWNMAPQHQMKEKNALAMNQKIMNILREKEQAIQERKDAEAQTKAAIG  60

Query  423  eRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             RD A  QR+ A+ ER+ A+MERDNA A LQY E+++N
Sbjct  61   ARDEAFRQREEALVERDKALMERDNARAALQYWENAIN  98



>gb|ABR17349.1| unknown [Picea sitchensis]
Length=313

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = +3

Query  258  MDDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTA  437
            MDD  R + RH     Q +  H P +K  M ++AERDAAI ERN A SEKKAA AE++TA
Sbjct  1    MDDDGRLDIRHWDTLEQSVKDH-PGLK-FMSVLAERDAAILERNTAFSEKKAAFAEKETA  58

Query  438  ILQRDTAIAERNNAIMERDNAIATLQYH-------ESSMNTGSMS  551
            I QRD A A+RN AI+ERD A A L Y        + S++ G++S
Sbjct  59   IFQRDVAYADRNTAILERDAAAAALDYARDGGWNGQRSLSCGTLS  103



>gb|ADV59364.1| GAGA-binding transcriptional activator [Picea sitchensis]
Length=313

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = +3

Query  258  MDDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTA  437
            MDD  R + RH     Q +  H P +K  M ++AERDAAI ERN A SEKKAA AE++TA
Sbjct  1    MDDDGRLDIRHWDTLEQSVKDH-PGLK-FMSVLAERDAAILERNTAFSEKKAAFAEKETA  58

Query  438  ILQRDTAIAERNNAIMERDNAIATLQYH-------ESSMNTGSMS  551
            I QRD A A+RN AI+ERD A A L Y        + S++ G++S
Sbjct  59   IFQRDVAYADRNTAILERDAAAAALDYARDGGWNGQRSLSCGTLS  103



>ref|XP_002437754.1| hypothetical protein SORBIDRAFT_10g002020 [Sorghum bicolor]
 gb|EER89121.1| hypothetical protein SORBIDRAFT_10g002020 [Sorghum bicolor]
Length=329

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 11/96 (11%)
 Frame = +3

Query  258  MDDGHRENGR-----HKLPQGQWLMQHQPTMK-----QIMGIMAERDAAIQERNlalsek  407
            MD+  RENGR     +K    QW+M  Q  +K      ++ +M E+D+AI+ER+ AL+EK
Sbjct  1    MDNLGRENGRQRPDQYKAVHTQWMMP-QRQLKDHHSMNLLALMNEKDSAIRERDHALAEK  59

Query  408  kaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            KAA+AERD A  QRD A+AERN AI+ERDNA+A L+
Sbjct  60   KAAIAERDMAFAQRDAAMAERNAAIVERDNALAALE  95



>gb|EYU40418.1| hypothetical protein MIMGU_mgv1a012572mg [Erythranthe guttata]
Length=246

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  330  TMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIAT  509
            T  +I  +  E++AA++ER+ A+SE KA L E + AI QRD AI ERNNA+ ERDNAIA 
Sbjct  18   TTAKIGILFEEKEAALKERDKAISETKAILKEMEFAITQRDLAIIERNNALKERDNAIAA  77

Query  510  LQYHESSM  533
            LQ+HES+M
Sbjct  78   LQFHESNM  85



>gb|ADV59358.1| GAGA-binding transcriptional activator [Pinus taeda]
Length=312

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 61/96 (64%), Gaps = 6/96 (6%)
 Frame = +3

Query  282  GRHKLPQGQW-----LMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQ  446
            G + L  G W      M   P +K +M ++AERD AI ER+ A++EKKAA AERD A+LQ
Sbjct  3    GGNALDFGDWGTYEESMNDHPALK-LMAVIAERDVAILERDTAIAEKKAAYAERDVALLQ  61

Query  447  RDTAIAERNNAIMERDNAIATLQYHESSMNTGSMSP  554
            R+ AI++RN+A++ERD A A L Y      +G  SP
Sbjct  62   REVAISDRNSALLERDAAAAALGYSGQMNLSGQRSP  97



>ref|XP_008382362.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X2 [Malus domestica]
 ref|XP_008365907.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X4 [Malus 
domestica]
Length=285

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            K+IM I+A+RDAAI+ERN AL+EK  ALA RD A+ QRD A+ +R++A+MERDNA A L 
Sbjct  17   KKIMSIIADRDAAIRERNAALAEKNEALAARDEALRQRDEALTQRDSALMERDNAYAALH  76

Query  516  YHESSMN  536
              ++++N
Sbjct  77   SRDNAVN  83



>gb|ADV59357.1| GAGA-binding transcriptional activator [Pinus taeda]
Length=313

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 65/105 (62%), Gaps = 9/105 (9%)
 Frame = +3

Query  258  MDDGHRENGRHKLPQGQWLMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTA  437
            MDD  R + RH     Q +  H P +K  M ++AERDAAI ERN A SEKKAA AE++TA
Sbjct  1    MDDEGRLDIRHWDTLEQSVKDH-PGLK-FMSVLAERDAAILERNTAFSEKKAAFAEKETA  58

Query  438  ILQRDTAIAERNNAIMERDNAIATLQYH-------ESSMNTGSMS  551
            I QRD A A+RN AI+ERD A A L Y        + S+  G++S
Sbjct  59   IFQRDVAYADRNTAILERDAAAAALNYARDGGWNGQRSLTCGTLS  103



>ref|XP_010028658.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028659.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55432.1| hypothetical protein EUGRSUZ_I01334 [Eucalyptus grandis]
Length=314

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 62/109 (57%), Gaps = 16/109 (15%)
 Frame = +3

Query  258  MDDG-------HRENGRHKLPQGQWLMQHQPTMKQ---------IMGIMAERDAAIQERN  389
            MDDG       H+    +KL    W M  Q  MK+         IM I+ E++ AIQER 
Sbjct  1    MDDGGQHGNHRHKVEYPYKLMHTLWNMAPQHQMKEKNALAMNQKIMNILREKEQAIQERK  60

Query  390  lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             A ++ KAA+  RD A  QR+ A+ ER+ A+MERDNA A LQY E+++N
Sbjct  61   DAEAQTKAAIGARDEAFRQREEALVERDKALMERDNARAALQYWENAIN  109



>ref|XP_003532442.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform 1 [Glycine 
max]
 ref|XP_003532443.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform 2 [Glycine 
max]
 gb|KHN16871.1| Protein BASIC PENTACYSTEINE4 [Glycine soja]
Length=317

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 67/110 (61%), Gaps = 17/110 (15%)
 Frame = +3

Query  258  MDDGHR-ENGRHKL-----PQGQWLM--QHQPTM-------KQIMGIMAERDAAIQE--R  386
            MDDGH+ EN RHK+      +  W    QHQ          K+I  IMAER AAI E   
Sbjct  1    MDDGHQHENSRHKMEFYRGARSLWNTDSQHQVKEPNALVMNKKIRSIMAERQAAILEIEL  60

Query  387  NlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
              A+SEK  ALA RD AI QRD A+A+R+NA++ERDNA+A LQ   +S+N
Sbjct  61   ETAISEKNEALAARDAAIQQRDEALAQRDNALLERDNALAALQSRNNSVN  110



>ref|XP_009137623.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
 ref|XP_009138239.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
 ref|XP_009138877.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
 ref|XP_009139486.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
Length=287

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            ++IM I+AERDAA++ER+ AL+ K+ ALA RD A+  RD A++ R+NAI+ERD+A++ LQ
Sbjct  46   QKIMSILAERDAALKERDDALAAKQEALAARDEALDLRDKALSLRDNAILERDSALSALQ  105

Query  516  YHESSMN  536
            + E ++N
Sbjct  106  FREHNLN  112



>ref|XP_003557130.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
 ref|XP_010228059.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
 ref|XP_010228060.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
 ref|XP_010228061.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
 ref|XP_010228062.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
 ref|XP_010228063.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
Length=327

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 64/93 (69%), Gaps = 11/93 (12%)
 Frame = +3

Query  267  GHRENGRHKLPQ-----GQWLMQHQPTMKQ-----IMGIMAERDAAIQERNlalsekkaa  416
            GHRENGR +  Q      QW++  Q  MK      ++ +M+ERD AI ER+ AL+EKKAA
Sbjct  5    GHRENGRQRPDQYKGLHTQWMIP-QRQMKDHHSMNLLALMSERDNAIMERDHALAEKKAA  63

Query  417  laeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            LAERD A  QR++A+ ERN AI+ERDNA+A L+
Sbjct  64   LAERDMAFAQRESAMVERNAAIVERDNALAALE  96



>emb|CDY41951.1| BnaA01g05230D [Brassica napus]
Length=287

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            ++IM I+AERDAA++ER+ AL+ K+ ALA RD A+  RD A++ R+NAI+ERD+A++ LQ
Sbjct  46   QKIMSILAERDAALKERDDALAAKQEALAVRDEALDLRDKALSLRDNAILERDSALSALQ  105

Query  516  YHESSMN  536
            + E ++N
Sbjct  106  FREHNLN  112



>ref|XP_003525427.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoformX1 [Glycine 
max]
 ref|XP_003525429.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoformX3 [Glycine 
max]
 ref|XP_006580620.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X4 [Glycine 
max]
 gb|KHN17473.1| Protein BASIC PENTACYSTEINE4 [Glycine soja]
Length=317

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 17/110 (15%)
 Frame = +3

Query  258  MDDGHR-ENGRHKL-----PQGQWLM--QHQPTM-------KQIMGIMAERDAAIQE--R  386
            MDDG + ENGRHK+         W    QHQ          K+I  IMAER AAI E   
Sbjct  1    MDDGRQHENGRHKMEYYRGAHSLWNTDSQHQVKEPNALVMNKKIRSIMAERQAAILEIEL  60

Query  387  NlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
              A+SEK  ALA RD AI QRD A+A+R+NA++ERDNA+A LQ   +S+N
Sbjct  61   EAAISEKNEALAARDAAIRQRDEALAQRDNALLERDNALAALQSRNNSVN  110



>gb|ADE76107.1| unknown [Picea sitchensis]
 gb|ADV59366.1| GAGA-binding transcriptional activator [Picea sitchensis]
Length=294

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query  318  QHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDN  497
            +  P +K +M ++AERD AI ER+ A++EKKAA AERD A+LQR+ AI++RN+A++ERD 
Sbjct  20   KDHPALK-LMAVIAERDVAILERDTAIAEKKAAYAERDVALLQREVAISDRNSALLERDA  78

Query  498  AIATLQYHESSMNTGSMSP  554
            A A L Y      TG   P
Sbjct  79   AAAALGYSGHINLTGQRGP  97



>gb|ABC25620.1| GAGA-binding transcriptional activator [Arabidopsis thaliana]
 gb|ABC25619.1| GAGA-binding transcriptional activator [Arabidopsis thaliana]
Length=36

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 1/34 (3%)
 Frame = +3

Query  261  DDGHRENGRHKLP-QGQWLMQHQPTMKQIMGIMA  359
            D GHRENGRHK   QGQWLMQHQP+MKQ+M I+A
Sbjct  3    DGGHRENGRHKAAVQGQWLMQHQPSMKQVMSIIA  36



>ref|XP_010667727.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Beta vulgaris subsp. 
vulgaris]
Length=290

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 57/97 (59%), Gaps = 14/97 (14%)
 Frame = +3

Query  267  GHRENGRHKL-------PQGQWLMQHQPTM-------KQIMGIMAERDAAIQERNlalse  404
            GHR   RHK        P      QHQ          ++++ I+AERD AI+E N AL E
Sbjct  5    GHRGGARHKCDNIRESCPWNMVAYQHQAKEQNALHMNRKLLNIIAERDDAIEEMNRALHE  64

Query  405  kkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            K+ AL ER+TAI QR+ AI ER++A+MERDN +  LQ
Sbjct  65   KRRALEERETAISQRNLAIKERDDAVMERDNVLNALQ  101



>ref|XP_007159983.1| hypothetical protein PHAVU_002G283200g [Phaseolus vulgaris]
 ref|XP_007159984.1| hypothetical protein PHAVU_002G283200g [Phaseolus vulgaris]
 gb|ESW31977.1| hypothetical protein PHAVU_002G283200g [Phaseolus vulgaris]
 gb|ESW31978.1| hypothetical protein PHAVU_002G283200g [Phaseolus vulgaris]
Length=312

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 65/110 (59%), Gaps = 17/110 (15%)
 Frame = +3

Query  258  MDDGHR-ENGRHKL-----PQGQWLM--QHQ---PTM----KQIMGIMAERDAAIQERN-  389
            M+DG + EN RHK+         W    QHQ   P      K+I  IMAER AAI E   
Sbjct  1    MEDGRQNENDRHKMEYYRGAHSMWNTDSQHQVKEPNALVMNKKIRSIMAERQAAILELEL  60

Query  390  -lalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
              A+S K  ALA RD AI QRD A+A+R+NAI+ERDNA+A LQ   +S++
Sbjct  61   EAAISVKNEALAARDAAIRQRDEALAQRDNAILERDNALAALQSRNNSVS  110



>gb|AET05031.2| GAGA-binding transcriptional activator BBR/BPC6-like protein 
[Medicago truncatula]
Length=312

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 61/115 (53%), Gaps = 30/115 (26%)
 Frame = +3

Query  261  DDGHRENGRHKL-------------PQGQWLMQHQPTM-KQIMGIMAERDAA--------  374
            DD   ENGRHK+             PQ Q   Q+   M K+I  IMAER AA        
Sbjct  3    DDRQYENGRHKMDYYRGAHSLWNVDPQHQIKEQNALVMNKKIRSIMAERQAALLELELEA  62

Query  375  -IQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             I E+N AL+        RD A+ QRD A+A+R+NA++ERDNA+A LQ   S+ N
Sbjct  63   AISEKNEALAA-------RDVALRQRDEALAQRDNALLERDNALAALQSRNSTAN  110



>ref|XP_003630555.1| GAGA-binding transcriptional activator BBR/BPC4-like protein 
[Medicago truncatula]
Length=356

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 61/115 (53%), Gaps = 30/115 (26%)
 Frame = +3

Query  261  DDGHRENGRHKL-------------PQGQWLMQHQPTM-KQIMGIMAERDAA--------  374
            DD   ENGRHK+             PQ Q   Q+   M K+I  IMAER AA        
Sbjct  47   DDRQYENGRHKMDYYRGAHSLWNVDPQHQIKEQNALVMNKKIRSIMAERQAALLELELEA  106

Query  375  -IQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             I E+N AL+        RD A+ QRD A+A+R+NA++ERDNA+A LQ   S+ N
Sbjct  107  AISEKNEALAA-------RDVALRQRDEALAQRDNALLERDNALAALQSRNSTAN  154



>gb|ADV59402.1| GAGA-binding transcriptional activator [Lotus japonicus]
 gb|ADV59403.1| GAGA-binding transcriptional activator [Lotus japonicus]
 gb|AFK46069.1| unknown [Lotus japonicus]
Length=317

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 62/115 (54%), Gaps = 30/115 (26%)
 Frame = +3

Query  261  DDGHRENGRHKL-----PQGQWLMQHQPTMKQ---------IMGIMAERDAA--------  374
            DD   ENGRHK+      +  W M HQ  +K+         +  IMAER AA        
Sbjct  3    DDRQHENGRHKMEYYRGARSPWDMDHQHQVKEPNALVMNKKLRSIMAERQAALLELELEA  62

Query  375  -IQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
             I E+N AL+        RD A+ QRD A+A+R+NA+++RDNA+A LQ   S++N
Sbjct  63   AISEKNEALAA-------RDLALRQRDEALAQRDNALLQRDNALAALQNRNSAVN  110



>emb|CDX82011.1| BnaC08g35900D [Brassica napus]
Length=184

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 17/84 (20%)
 Frame = +3

Query  336  KQIMGIMAERDAAIQERNlalsekk-----------------aalaeRDTAILQRDTAIA  464
            K+IM I+A+RDAA+ ER+ A S KK                  ALA R+ A+ QRD A+ 
Sbjct  3    KKIMSILAKRDAAVLERDQASSAKKEALARPDPRCFYSFLPLLALAAREEALQQRDKALT  62

Query  465  ERNNAIMERDNAIATLQYHESSMN  536
            ER+ A++E+D+A A LQ+H  S+N
Sbjct  63   ERDKALIEKDDAFAALQHHVKSLN  86



>ref|XP_004503784.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503785.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Cicer 
arietinum]
Length=308

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 65/108 (60%), Gaps = 16/108 (15%)
 Frame = +3

Query  261  DDGHRENGRHKL-------------PQGQWLMQHQPTM-KQIMGIMAERDAAIQERN--l  392
            DD   ENGRHK+             PQ Q   Q+   M K+I  IMAER AAI E     
Sbjct  3    DDREYENGRHKMEYYRGAHSLWNTDPQHQVKEQNALVMNKKIRSIMAERQAAILELELEA  62

Query  393  alsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQYHESSMN  536
            A+SEK  ALA RD A+ QRD A+A+R++A++ERDNA+A LQ   +S+N
Sbjct  63   AISEKNEALAARDAALRQRDEALAQRDSALLERDNALAALQSRSNSVN  110



>ref|XP_006844102.1| hypothetical protein AMTR_s00006p00254090 [Amborella trichopoda]
 gb|ERN05777.1| hypothetical protein AMTR_s00006p00254090 [Amborella trichopoda]
Length=356

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  351  IMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATLQ  515
            + AERDAA++ER++A++EKKAA +ERD+A  QRD A+A+R  A+MERD A+A L+
Sbjct  70   VKAERDAAVRERDMAIAEKKAATSERDSAFNQRDMALAQREEAVMERDAALAALE  124



>gb|AFB34871.1| hypothetical protein UMN_6093_01, partial [Pinus mugo]
 gb|AFB34872.1| hypothetical protein UMN_6093_01, partial [Pinus mugo]
Length=115

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  330  TMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIAT  509
             M +++    ERDA I+ER+ A++EKK ALAE++ A  QRD A A+R+ AIMERD A A 
Sbjct  27   AMLRLISAKTERDAVIRERDKAIAEKKIALAEKEAAYAQRDAAFAQRDEAIMERDAAFAA  86

Query  510  LQYHESSMNTG  542
            L+      N G
Sbjct  87   LENARDERNRG  97



>gb|EOS76789.1| hypothetical protein C819_01404 [Lachnospiraceae bacterium 10-1]
Length=301

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  312  LMQHQPTMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMER  491
            + +    + +I  +M  R++AI ERN  ++E+ +A+AERD+ I +RD+AIAER++ I ER
Sbjct  205  MTEKHSIISEINSVMNARNSAIAERNSVITERDSAIAERDSVITERDSAIAERDSVITER  264

Query  492  DNAIA  506
            D+AIA
Sbjct  265  DSAIA  269



>gb|ADV59362.1| GAGA-binding transcriptional activator [Physcomitrella patens]
 gb|ADV59363.1| GAGA-binding transcriptional activator [Physcomitrella patens]
Length=328

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  339  QIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERD  494
            +IM I+AERDAA+ E++ AL+EK AA AERD AILQRD A A+R+ AI+ RD
Sbjct  19   EIMDIIAERDAALMEKSTALAEKMAAYAERDAAILQRDIASADRDAAILTRD  70



>gb|ABR18188.1| unknown [Picea sitchensis]
 gb|ADV59365.1| GAGA-binding transcriptional activator [Picea sitchensis]
Length=334

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +3

Query  333  MKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIATL  512
            M +++    ERDA I+ER+ A++EKK A+AE++ A  QRD A A+R+ AIMERD A A L
Sbjct  28   MLRLISAKTERDAVIRERDKAIAEKKVAIAEKEAAYAQRDAAFAQRDEAIMERDAAFAAL  87

Query  513  QYHESSMNTG  542
            +      N G
Sbjct  88   ENARDERNRG  97



>gb|AFB34868.1| hypothetical protein UMN_6093_01, partial [Pinus cembra]
 gb|AFB34869.1| hypothetical protein UMN_6093_01, partial [Pinus cembra]
 gb|AFB34870.1| hypothetical protein UMN_6093_01, partial [Pinus cembra]
Length=115

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  330  TMKQIMGIMAERDAAIQERNlalsekkaalaeRDTAILQRDTAIAERNNAIMERDNAIAT  509
             M +++    ERD  I+ER+ A++EKK A+AE++ A  QRD A A+R+ AIMERD A A 
Sbjct  27   AMLRLLSAKTERDTVIRERDKAIAEKKIAIAEKEAAYAQRDAAFAQRDEAIMERDAAFAA  86

Query  510  LQYHESSMNTG  542
            L+      N G
Sbjct  87   LENARDERNRG  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960