BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G09

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594017.1|  PREDICTED: probable protein phosphatase 2C 38    72.8    5e-12   Nicotiana tomentosiformis
ref|XP_009796582.1|  PREDICTED: probable protein phosphatase 2C 38    72.0    9e-12   Nicotiana sylvestris
ref|XP_004239681.1|  PREDICTED: probable protein phosphatase 2C 38    70.1    5e-11   Solanum lycopersicum
ref|XP_006345807.1|  PREDICTED: probable protein phosphatase 2C 3...  69.7    6e-11   Solanum tuberosum [potatoes]
ref|XP_009787701.1|  PREDICTED: probable protein phosphatase 2C 3...  66.2    9e-10   Nicotiana sylvestris
ref|XP_009787699.1|  PREDICTED: probable protein phosphatase 2C 3...  66.2    9e-10   Nicotiana sylvestris
ref|XP_009616353.1|  PREDICTED: probable protein phosphatase 2C 3...  65.9    1e-09   Nicotiana tomentosiformis
ref|XP_009616352.1|  PREDICTED: probable protein phosphatase 2C 3...  65.9    1e-09   Nicotiana tomentosiformis
ref|XP_011077015.1|  PREDICTED: probable protein phosphatase 2C 3...  63.5    8e-09   Sesamum indicum [beniseed]
ref|XP_011077014.1|  PREDICTED: probable protein phosphatase 2C 3...  63.5    9e-09   Sesamum indicum [beniseed]
gb|KJB67682.1|  hypothetical protein B456_010G203500                  61.6    3e-08   Gossypium raimondii
ref|XP_007009637.1|  Phosphatase 2C family protein isoform 1          61.6    3e-08   Theobroma cacao [chocolate]
ref|XP_007009638.1|  Phosphatase 2C family protein isoform 2          61.6    3e-08   Theobroma cacao [chocolate]
gb|KJB67681.1|  hypothetical protein B456_010G203500                  61.6    3e-08   Gossypium raimondii
emb|CDP04341.1|  unnamed protein product                              61.6    3e-08   Coffea canephora [robusta coffee]
ref|XP_002525065.1|  protein phosphatase 2c, putative                 59.3    6e-08   
gb|KHG13638.1|  hypothetical protein F383_18928                       60.1    1e-07   Gossypium arboreum [tree cotton]
ref|XP_008445826.1|  PREDICTED: probable protein phosphatase 2C 3...  58.2    5e-07   Cucumis melo [Oriental melon]
ref|XP_008445820.1|  PREDICTED: probable protein phosphatase 2C 3...  58.2    5e-07   Cucumis melo [Oriental melon]
ref|XP_010534295.1|  PREDICTED: probable protein phosphatase 2C 38    57.8    6e-07   Tarenaya hassleriana [spider flower]
ref|XP_008233397.1|  PREDICTED: probable protein phosphatase 2C 3...  57.4    9e-07   Prunus mume [ume]
ref|XP_008233398.1|  PREDICTED: probable protein phosphatase 2C 3...  57.4    9e-07   Prunus mume [ume]
ref|XP_011084375.1|  PREDICTED: probable protein phosphatase 2C 38    56.6    1e-06   Sesamum indicum [beniseed]
ref|XP_004497368.1|  PREDICTED: probable protein phosphatase 2C 3...  56.6    2e-06   Cicer arietinum [garbanzo]
ref|XP_007218123.1|  hypothetical protein PRUPE_ppa007029mg           56.2    2e-06   Prunus persica
gb|KGN50486.1|  hypothetical protein Csa_5G177060                     55.5    4e-06   Cucumis sativus [cucumbers]
ref|XP_004143597.1|  PREDICTED: probable protein phosphatase 2C 3...  55.5    4e-06   Cucumis sativus [cucumbers]
ref|XP_010101501.1|  putative protein phosphatase 2C 38               55.5    4e-06   
ref|XP_006292665.1|  hypothetical protein CARUB_v10018907mg           55.1    5e-06   Capsella rubella
ref|XP_011027061.1|  PREDICTED: probable protein phosphatase 2C 3...  54.3    9e-06   Populus euphratica
ref|XP_006378750.1|  hypothetical protein POPTR_0010s22180g           54.3    9e-06   
ref|XP_011027064.1|  PREDICTED: probable protein phosphatase 2C 3...  54.3    1e-05   Populus euphratica
ref|XP_002878013.1|  serine/threonine protein phosphatase 2C          53.5    1e-05   Arabidopsis lyrata subsp. lyrata
gb|KHG04682.1|  hypothetical protein F383_30115                       53.5    2e-05   Gossypium arboreum [tree cotton]
gb|KHN27097.1|  Hypothetical protein glysoja_032865                   53.5    2e-05   Glycine soja [wild soybean]
ref|XP_003555636.1|  PREDICTED: probable protein phosphatase 2C 3...  53.5    2e-05   Glycine max [soybeans]
ref|XP_009116204.1|  PREDICTED: probable protein phosphatase 2C 48    53.1    2e-05   Brassica rapa
ref|XP_006403497.1|  hypothetical protein EUTSA_v10010445mg           53.1    2e-05   Eutrema salsugineum [saltwater cress]
ref|NP_191065.2|  putative protein phosphatase 2C 48                  53.1    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010253439.1|  PREDICTED: probable protein phosphatase 2C 38    52.8    3e-05   
ref|XP_003592807.1|  hypothetical protein MTR_1g116260                52.8    3e-05   Medicago truncatula
emb|CDY51441.1|  BnaA09g54860D                                        52.8    3e-05   Brassica napus [oilseed rape]
gb|KDO67862.1|  hypothetical protein CISIN_1g026383mg                 52.0    4e-05   Citrus sinensis [apfelsine]
emb|CDX73413.1|  BnaC08g25900D                                        52.4    4e-05   
gb|KDO67861.1|  hypothetical protein CISIN_1g026383mg                 52.0    4e-05   Citrus sinensis [apfelsine]
gb|KJB73662.1|  hypothetical protein B456_011G242300                  52.4    4e-05   Gossypium raimondii
gb|KCW65340.1|  hypothetical protein EUGRSUZ_G02783                   52.4    4e-05   Eucalyptus grandis [rose gum]
ref|XP_004307440.1|  PREDICTED: probable protein phosphatase 2C 38    52.4    4e-05   Fragaria vesca subsp. vesca
ref|XP_006436169.1|  hypothetical protein CICLE_v10031798mg           52.0    4e-05   
ref|XP_002312054.1|  serine/threonine protein phosphatase 2C          52.4    5e-05   
ref|XP_011017023.1|  PREDICTED: probable protein phosphatase 2C 3...  52.0    5e-05   Populus euphratica
ref|XP_011016344.1|  PREDICTED: probable protein phosphatase 2C 3...  52.0    5e-05   Populus euphratica
ref|XP_011016941.1|  PREDICTED: probable protein phosphatase 2C 3...  52.0    5e-05   Populus euphratica
ref|XP_010067239.1|  PREDICTED: probable protein phosphatase 2C 38    52.0    5e-05   Eucalyptus grandis [rose gum]
ref|XP_006436172.1|  hypothetical protein CICLE_v10031798mg           51.6    7e-05   
gb|KHN37290.1|  Hypothetical protein glysoja_013505                   51.6    8e-05   Glycine soja [wild soybean]
ref|XP_003536795.1|  PREDICTED: probable protein phosphatase 2C 3...  51.6    8e-05   Glycine max [soybeans]
ref|XP_006436170.1|  hypothetical protein CICLE_v10031798mg           51.6    8e-05   
ref|XP_008369746.1|  PREDICTED: probable protein phosphatase 2C 3...  51.2    8e-05   
ref|XP_008369731.1|  PREDICTED: probable protein phosphatase 2C 3...  51.2    9e-05   
ref|XP_010558777.1|  PREDICTED: probable protein phosphatase 2C 38    50.8    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_002281610.1|  PREDICTED: probable protein phosphatase 2C 3...  50.8    1e-04   Vitis vinifera
ref|XP_010658151.1|  PREDICTED: probable protein phosphatase 2C 3...  50.8    1e-04   Vitis vinifera
ref|XP_007142657.1|  hypothetical protein PHAVU_007G0057000g          50.4    1e-04   Phaseolus vulgaris [French bean]
ref|XP_010669737.1|  PREDICTED: probable protein phosphatase 2C 3...  49.7    3e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG11455.1|  hypothetical protein F383_16117                       49.7    3e-04   Gossypium arboreum [tree cotton]
ref|XP_010669739.1|  PREDICTED: probable protein phosphatase 2C 3...  49.7    3e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB76497.1|  hypothetical protein B456_012G092200                  49.7    3e-04   Gossypium raimondii
ref|XP_010556097.1|  PREDICTED: probable protein phosphatase 2C 48    49.3    4e-04   Tarenaya hassleriana [spider flower]
ref|XP_009139203.1|  PREDICTED: probable protein phosphatase 2C 48    49.3    4e-04   Brassica rapa
emb|CDX76124.1|  BnaA04g03880D                                        49.3    4e-04   
emb|CDY02904.1|  BnaC04g25820D                                        49.3    5e-04   



>ref|XP_009594017.1| PREDICTED: probable protein phosphatase 2C 38 [Nicotiana tomentosiformis]
Length=388

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MVTTT R+ VYPCW+P+IE+EG++ S+RGGDP+GRVDGL WY
Sbjct  1    MVTTTLRKFVYPCWKPSIENEGENSSTRGGDPDGRVDGLWWY  42



>ref|XP_009796582.1| PREDICTED: probable protein phosphatase 2C 38 [Nicotiana sylvestris]
Length=388

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MVTTT R+ VYPCW+P+IE+EG++ S+RGGDP GRVDGL WY
Sbjct  1    MVTTTLRKFVYPCWKPSIENEGENSSTRGGDPGGRVDGLWWY  42



>ref|XP_004239681.1| PREDICTED: probable protein phosphatase 2C 38 [Solanum lycopersicum]
 ref|XP_010321325.1| PREDICTED: probable protein phosphatase 2C 38 [Solanum lycopersicum]
Length=384

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MVT+TW++ VYPCW+PT+++EG++ SSRGGDP G VDGL WY
Sbjct  1    MVTSTWKKYVYPCWKPTLDNEGENSSSRGGDPGGSVDGLWWY  42



>ref|XP_006345807.1| PREDICTED: probable protein phosphatase 2C 38-like [Solanum tuberosum]
Length=384

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MVT+TW+R VYPCW+PT+++EG + SSRGGDP G VDGL WY
Sbjct  1    MVTSTWKRYVYPCWKPTLDNEGDNSSSRGGDPGGSVDGLWWY  42



>ref|XP_009787701.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Nicotiana 
sylvestris]
Length=385

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 38/44 (86%), Gaps = 2/44 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGG--DPNGRVDGLLWY  516
            MVTTTW++ VYPCW+P+I++EG++ +SRGG  DP+G VDGL WY
Sbjct  1    MVTTTWKKFVYPCWKPSIDNEGENSNSRGGDRDPDGSVDGLWWY  44



>ref|XP_009787699.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009787700.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Nicotiana 
sylvestris]
Length=390

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 38/44 (86%), Gaps = 2/44 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGG--DPNGRVDGLLWY  516
            MVTTTW++ VYPCW+P+I++EG++ +SRGG  DP+G VDGL WY
Sbjct  1    MVTTTWKKFVYPCWKPSIDNEGENSNSRGGDRDPDGSVDGLWWY  44



>ref|XP_009616353.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Nicotiana 
tomentosiformis]
Length=385

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 2/44 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGG--DPNGRVDGLLWY  516
            MVTTTW++ VYPCW+P+I +EG++ +SRGG  DP+G VDGL WY
Sbjct  1    MVTTTWKKFVYPCWKPSINNEGENSNSRGGDQDPDGSVDGLWWY  44



>ref|XP_009616352.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Nicotiana 
tomentosiformis]
Length=390

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 2/44 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGG--DPNGRVDGLLWY  516
            MVTTTW++ VYPCW+P+I +EG++ +SRGG  DP+G VDGL WY
Sbjct  1    MVTTTWKKFVYPCWKPSINNEGENSNSRGGDQDPDGSVDGLWWY  44



>ref|XP_011077015.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Sesamum 
indicum]
Length=389

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ TWR+ + PCWRP  E + ++ S+RGGD +GRVDGLLWY
Sbjct  1    MVSNTWRKFIAPCWRPLRESQSENCSNRGGDLSGRVDGLLWY  42



>ref|XP_011077014.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Sesamum 
indicum]
Length=394

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ TWR+ + PCWRP  E + ++ S+RGGD +GRVDGLLWY
Sbjct  1    MVSNTWRKFIAPCWRPLRESQSENCSNRGGDLSGRVDGLLWY  42



>gb|KJB67682.1| hypothetical protein B456_010G203500 [Gossypium raimondii]
Length=371

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT RRIV PCW+P++E E    SSRGG  NGRVDGLLWY
Sbjct  1    MVSTTLRRIVSPCWKPSVEGEN---SSRGGVGNGRVDGLLWY  39



>ref|XP_007009637.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007009640.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY18447.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY18450.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=379

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ +  RIV PCWRP++E E    SSRGGD NGRVDGLLWY
Sbjct  1    MVSASLMRIVSPCWRPSVEGEN---SSRGGDANGRVDGLLWY  39



>ref|XP_007009638.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 ref|XP_007009639.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOY18448.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOY18449.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
Length=384

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ +  RIV PCWRP++E E    SSRGGD NGRVDGLLWY
Sbjct  1    MVSASLMRIVSPCWRPSVEGEN---SSRGGDANGRVDGLLWY  39



>gb|KJB67681.1| hypothetical protein B456_010G203500 [Gossypium raimondii]
Length=378

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT RRIV PCW+P++E E    SSRGG  NGRVDGLLWY
Sbjct  1    MVSTTLRRIVSPCWKPSVEGEN---SSRGGVGNGRVDGLLWY  39



>emb|CDP04341.1| unnamed protein product [Coffea canephora]
Length=388

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MVTTT RRIV PCWRP++E+EGQ+ S RGGD   RVDGL WY
Sbjct  1    MVTTTLRRIVSPCWRPSVENEGQN-SGRGGDLGCRVDGLWWY  41



>ref|XP_002525065.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF37312.1| protein phosphatase 2c, putative [Ricinus communis]
Length=237

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+ RIV PCW+P++E E    SSRGG+ +GR DGLLWY
Sbjct  1    MVSTTFMRIVAPCWKPSVEGEN---SSRGGEASGRADGLLWY  39



>gb|KHG13638.1| hypothetical protein F383_18928 [Gossypium arboreum]
Length=386

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT RR V PCW+P++E E    SSRGG  NGRVDGLLWY
Sbjct  1    MVSTTLRRFVSPCWKPSVEGEN---SSRGGVGNGRVDGLLWY  39



>ref|XP_008445826.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Cucumis 
melo]
Length=384

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T+ +IV PCW+P +E E    SSRGGD +GRVDGLLWY
Sbjct  1    MVSETFMKIVSPCWKPLVEGEN---SSRGGDASGRVDGLLWY  39



>ref|XP_008445820.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
 ref|XP_008445821.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
 ref|XP_008445822.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
 ref|XP_008445823.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
 ref|XP_008445824.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
 ref|XP_008445825.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
Length=389

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T+ +IV PCW+P +E E    SSRGGD +GRVDGLLWY
Sbjct  1    MVSETFMKIVSPCWKPLVEGEN---SSRGGDASGRVDGLLWY  39



>ref|XP_010534295.1| PREDICTED: probable protein phosphatase 2C 38 [Tarenaya hassleriana]
Length=389

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 2/42 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T+ RIV PCWRP++E  G++ S   GD NGR+DGLLWY
Sbjct  1    MVSDTFMRIVSPCWRPSVE--GENSSRHHGDTNGRIDGLLWY  40



>ref|XP_008233397.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Prunus 
mume]
Length=390

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT  ++V PCW+P++E  G++ ++RGGD +GR+DGLLWY
Sbjct  1    MVSTTLMKLVAPCWKPSVE--GENSNNRGGDVSGRLDGLLWY  40



>ref|XP_008233398.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Prunus 
mume]
Length=385

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT  ++V PCW+P++E  G++ ++RGGD +GR+DGLLWY
Sbjct  1    MVSTTLMKLVAPCWKPSVE--GENSNNRGGDVSGRLDGLLWY  40



>ref|XP_011084375.1| PREDICTED: probable protein phosphatase 2C 38 [Sesamum indicum]
 ref|XP_011084376.1| PREDICTED: probable protein phosphatase 2C 38 [Sesamum indicum]
Length=384

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MVT TWR++V PCWRP ++D+G++ S+RG +  GR DGL WY
Sbjct  1    MVTPTWRKLVLPCWRPLVDDDGENSSNRGYELIGRSDGLWWY  42



>ref|XP_004497368.1| PREDICTED: probable protein phosphatase 2C 38-like isoform X1 
[Cicer arietinum]
 ref|XP_004497369.1| PREDICTED: probable protein phosphatase 2C 38-like isoform X2 
[Cicer arietinum]
Length=382

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T RRIV PCWRP+IE E    S R GD +GR DGLLWY
Sbjct  1    MVSATIRRIVSPCWRPSIEGEN---SGRNGDGSGRSDGLLWY  39



>ref|XP_007218123.1| hypothetical protein PRUPE_ppa007029mg [Prunus persica]
 gb|EMJ19322.1| hypothetical protein PRUPE_ppa007029mg [Prunus persica]
Length=385

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT  ++V PCW+P++E  G++ ++RGGD +GR+DGLLW+
Sbjct  1    MVSTTLMKLVAPCWKPSVE--GENSNNRGGDVSGRLDGLLWH  40



>gb|KGN50486.1| hypothetical protein Csa_5G177060 [Cucumis sativus]
Length=384

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T+ +IV PCW+P +E E    SSR GD +GRVDGLLWY
Sbjct  1    MVSETFMKIVSPCWKPLVEGEN---SSRDGDASGRVDGLLWY  39



>ref|XP_004143597.1| PREDICTED: probable protein phosphatase 2C 38-like [Cucumis sativus]
 ref|XP_004163467.1| PREDICTED: probable protein phosphatase 2C 38-like [Cucumis sativus]
Length=389

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T+ +IV PCW+P +E E    SSR GD +GRVDGLLWY
Sbjct  1    MVSETFMKIVSPCWKPLVEGEN---SSRDGDASGRVDGLLWY  39



>ref|XP_010101501.1| putative protein phosphatase 2C 38 [Morus notabilis]
 gb|EXB88498.1| putative protein phosphatase 2C 38 [Morus notabilis]
Length=635

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MVT T  +IV  C++P++E+E    SSRGGD N RVDGLLWY
Sbjct  1    MVTATLMKIVSSCFKPSVEEEN---SSRGGDANDRVDGLLWY  39



>ref|XP_006292665.1| hypothetical protein CARUB_v10018907mg [Capsella rubella]
 gb|EOA25563.1| hypothetical protein CARUB_v10018907mg [Capsella rubella]
Length=384

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 2/42 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+RRIV PCWRP     G+D S    D NGR+DGLLWY
Sbjct  1    MVSTTFRRIVSPCWRPF--GIGEDSSPAADDANGRLDGLLWY  40



>ref|XP_011027061.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
 ref|XP_011027062.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
 ref|XP_011027063.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
Length=391

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+T+  RIV PCW+P++E E    SS GGD  GR +GLLWY
Sbjct  1    MVSTSLMRIVSPCWKPSVEGEN---SSNGGDAAGRAEGLLWY  39



>ref|XP_006378750.1| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
 ref|XP_002315265.2| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
 gb|ERP56547.1| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
 gb|EEF01436.2| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
Length=386

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+T+  RIV PCW+P++E E    SS GGD  GR +GLLWY
Sbjct  1    MVSTSLMRIVSPCWKPSVEGEN---SSNGGDAAGRAEGLLWY  39



>ref|XP_011027064.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Populus 
euphratica]
Length=386

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+T+  RIV PCW+P++E E    SS GGD  GR +GLLWY
Sbjct  1    MVSTSLMRIVSPCWKPSVEGEN---SSNGGDAAGRAEGLLWY  39



>ref|XP_002878013.1| serine/threonine protein phosphatase 2C [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54272.1| serine/threonine protein phosphatase 2C [Arabidopsis lyrata subsp. 
lyrata]
Length=384

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 2/42 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+RRIV PCWRP     G+D S    D NGR+DGLLWY
Sbjct  1    MVSTTFRRIVSPCWRPF--GIGEDSSPGSDDANGRLDGLLWY  40



>gb|KHG04682.1| hypothetical protein F383_30115 [Gossypium arboreum]
Length=368

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ +  R++ PCWRP++E  G+D SSRG D NGRVDGLLWY
Sbjct  1    MVSGSLMRMMPPCWRPSVE--GED-SSRGDDANGRVDGLLWY  39



>gb|KHN27097.1| Hypothetical protein glysoja_032865 [Glycine soja]
Length=388

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 4/42 (10%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T RRIV PCWRP+   EG+  SSR GD +GR +GLLWY
Sbjct  1    MVSATIRRIVSPCWRPS---EGE-ISSRHGDASGRANGLLWY  38



>ref|XP_003555636.1| PREDICTED: probable protein phosphatase 2C 38-like [Glycine max]
Length=388

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 4/42 (10%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T RRIV PCWRP+   EG+  SSR GD +GR +GLLWY
Sbjct  1    MVSATIRRIVSPCWRPS---EGE-ISSRHGDASGRANGLLWY  38



>ref|XP_009116204.1| PREDICTED: probable protein phosphatase 2C 48 [Brassica rapa]
Length=388

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+RRIV PCWRP    EG   SS   D NGR+DGLLWY
Sbjct  2    MVSTTFRRIVSPCWRPFGIGEGSIPSS-SDDSNGRIDGLLWY  42



>ref|XP_006403497.1| hypothetical protein EUTSA_v10010445mg [Eutrema salsugineum]
 gb|ESQ44950.1| hypothetical protein EUTSA_v10010445mg [Eutrema salsugineum]
Length=383

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 2/42 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+RRIVYPCWRP    EG    S   D NGR+DGLLWY
Sbjct  1    MVSTTFRRIVYPCWRPFGIGEGSIPGS--DDTNGRLDGLLWY  40



>ref|NP_191065.2| putative protein phosphatase 2C 48 [Arabidopsis thaliana]
 ref|NP_974438.1| putative protein phosphatase 2C 48 [Arabidopsis thaliana]
 sp|Q94CL8.1|P2C48_ARATH RecName: Full=Probable protein phosphatase 2C 48; Short=AtPP2C48; 
AltName: Full=Protein phosphatase 2C 6 [Arabidopsis thaliana]
 emb|CAC44619.1| Ser/Thr protein phosphatase 2C [Arabidopsis thaliana]
 gb|AAT44968.1| At3g55050 [Arabidopsis thaliana]
 gb|AAX49374.1| At3g55050 [Arabidopsis thaliana]
 dbj|BAF01155.1| protein phosphatase 2C like protein [Arabidopsis thaliana]
 gb|AEE79332.1| putative protein phosphatase 2C 48 [Arabidopsis thaliana]
 gb|AEE79333.1| putative protein phosphatase 2C 48 [Arabidopsis thaliana]
Length=384

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 2/42 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+RRIV PCWRP     G+D S    D NGR+DGLLWY
Sbjct  1    MVSTTFRRIVSPCWRPF--GIGEDSSPGSDDTNGRLDGLLWY  40



>ref|XP_010253439.1| PREDICTED: probable protein phosphatase 2C 38 [Nelumbo nucifera]
 ref|XP_010253440.1| PREDICTED: probable protein phosphatase 2C 38 [Nelumbo nucifera]
Length=388

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 6/42 (14%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV++ + +IV PCW+P++ED      S+ GD +GRVDGLLWY
Sbjct  1    MVSSGFMKIVTPCWKPSVED------SKSGDASGRVDGLLWY  36



>ref|XP_003592807.1| hypothetical protein MTR_1g116260 [Medicago truncatula]
 gb|AES63058.1| serine/threonine phosphatase family, 2C domain protein [Medicago 
truncatula]
Length=379

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 28/42 (67%), Gaps = 6/42 (14%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T RRIV PCWRP+IE E        GD +GR DGLLWY
Sbjct  1    MVSATIRRIVSPCWRPSIEGEN------SGDASGRSDGLLWY  36



>emb|CDY51441.1| BnaA09g54860D [Brassica napus]
Length=387

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+RRIV PCWRP    EG   SS   D NGR+DGLLWY
Sbjct  1    MVSTTFRRIVSPCWRPFGIGEGSIPSS-SDDSNGRLDGLLWY  41



>gb|KDO67862.1| hypothetical protein CISIN_1g026383mg [Citrus sinensis]
 gb|KDO67863.1| hypothetical protein CISIN_1g026383mg [Citrus sinensis]
 gb|KDO67864.1| hypothetical protein CISIN_1g026383mg [Citrus sinensis]
Length=234

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T+ +IV PCW+P+ E E    S+  G+ NGRVDGLLWY
Sbjct  1    MVSATFMKIVSPCWKPSTEGEN---SNSDGEDNGRVDGLLWY  39



>emb|CDX73413.1| BnaC08g25900D [Brassica napus]
Length=387

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+RRIV PCWRP    EG   SS   D NGR+DGLLWY
Sbjct  1    MVSTTFRRIVSPCWRPFGIGEGSIPSS-SDDSNGRLDGLLWY  41



>gb|KDO67861.1| hypothetical protein CISIN_1g026383mg [Citrus sinensis]
Length=239

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T+ +IV PCW+P+ E E    S+  G+ NGRVDGLLWY
Sbjct  1    MVSATFMKIVSPCWKPSTEGEN---SNSDGEDNGRVDGLLWY  39



>gb|KJB73662.1| hypothetical protein B456_011G242300 [Gossypium raimondii]
Length=386

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            M++ +  R++ PCWRP++E  G+D SSRG D NGRVDGLLWY
Sbjct  1    MLSGSLMRMMPPCWRPSVE--GED-SSRGDDANGRVDGLLWY  39



>gb|KCW65340.1| hypothetical protein EUGRSUZ_G02783 [Eucalyptus grandis]
Length=324

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MVT +  RIV PCW+P++E    D S + GD +GRVDGLLWY
Sbjct  1    MVTGSLMRIVSPCWKPSVEG---DDSGKSGDASGRVDGLLWY  39



>ref|XP_004307440.1| PREDICTED: probable protein phosphatase 2C 38 [Fragaria vesca 
subsp. vesca]
Length=385

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+T   +I+ PCWRP++  EG++ S+R GD +GRVDGLLWY
Sbjct  1    MVSTRLMKIMAPCWRPSVV-EGEN-SNRAGDASGRVDGLLWY  40



>ref|XP_006436169.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
 ref|XP_006485971.1| PREDICTED: probable protein phosphatase 2C 38-like isoform X3 
[Citrus sinensis]
 gb|ESR49409.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
Length=246

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T+ +IV PCW+P+ E E    S+  G+ NGRVDGLLWY
Sbjct  1    MVSATFMKIVSPCWKPSTEGEN---SNSDGEDNGRVDGLLWY  39



>ref|XP_002312054.1| serine/threonine protein phosphatase 2C [Populus trichocarpa]
 gb|EEE89421.1| serine/threonine protein phosphatase 2C [Populus trichocarpa]
Length=386

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T  R V PCW+P++E E    SS GGD  GR +GLLWY
Sbjct  1    MVSATLMRFVSPCWKPSVEGEN---SSNGGDAAGRAEGLLWY  39



>ref|XP_011017023.1| PREDICTED: probable protein phosphatase 2C 38 isoform X3 [Populus 
euphratica]
Length=391

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T  R V PCW+P++E E    SS GGD  GR +GLLWY
Sbjct  1    MVSATLMRFVSPCWKPSVEGEN---SSNGGDAAGRAEGLLWY  39



>ref|XP_011016344.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
 ref|XP_011016863.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
Length=401

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T  R V PCW+P++E E    SS GGD  GR +GLLWY
Sbjct  1    MVSATLMRFVSPCWKPSVEGEN---SSNGGDAAGRAEGLLWY  39



>ref|XP_011016941.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Populus 
euphratica]
Length=396

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T  R V PCW+P++E E    SS GGD  GR +GLLWY
Sbjct  1    MVSATLMRFVSPCWKPSVEGEN---SSNGGDAAGRAEGLLWY  39



>ref|XP_010067239.1| PREDICTED: probable protein phosphatase 2C 38 [Eucalyptus grandis]
 gb|KCW65337.1| hypothetical protein EUGRSUZ_G02783 [Eucalyptus grandis]
 gb|KCW65338.1| hypothetical protein EUGRSUZ_G02783 [Eucalyptus grandis]
 gb|KCW65339.1| hypothetical protein EUGRSUZ_G02783 [Eucalyptus grandis]
Length=386

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MVT +  RIV PCW+P++E    D S + GD +GRVDGLLWY
Sbjct  1    MVTGSLMRIVSPCWKPSVEG---DDSGKSGDASGRVDGLLWY  39



>ref|XP_006436172.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
 gb|ESR49412.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
Length=333

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T+ +IV PCW+P+ E E    S+  G+ NGRVDGLLWY
Sbjct  1    MVSATFMKIVSPCWKPSTEGEN---SNSDGEDNGRVDGLLWY  39



>gb|KHN37290.1| Hypothetical protein glysoja_013505 [Glycine soja]
Length=388

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 4/42 (10%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T RRIV PCWRP    EG+  SSR GD +GR +GLLWY
Sbjct  1    MVSATIRRIVSPCWRPF---EGE-ISSRHGDASGRANGLLWY  38



>ref|XP_003536795.1| PREDICTED: probable protein phosphatase 2C 38-like isoform X1 
[Glycine max]
 ref|XP_006589783.1| PREDICTED: probable protein phosphatase 2C 38-like isoform X2 
[Glycine max]
Length=389

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 4/42 (10%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T RRIV PCWRP    EG+  SSR GD +GR +GLLWY
Sbjct  2    MVSATIRRIVSPCWRPF---EGE-ISSRHGDASGRANGLLWY  39



>ref|XP_006436170.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
 ref|XP_006436171.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
 ref|XP_006485969.1| PREDICTED: probable protein phosphatase 2C 38-like isoform X1 
[Citrus sinensis]
 ref|XP_006485970.1| PREDICTED: probable protein phosphatase 2C 38-like isoform X2 
[Citrus sinensis]
 gb|ESR49410.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
 gb|ESR49411.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
Length=386

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T+ +IV PCW+P+ E E    S+  G+ NGRVDGLLWY
Sbjct  1    MVSATFMKIVSPCWKPSTEGEN---SNSDGEDNGRVDGLLWY  39



>ref|XP_008369746.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Malus 
domestica]
Length=384

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 4/42 (10%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+ ++V PCW+P+ E E    +S  GD +GR+DGLLWY
Sbjct  1    MVSTTFLKLVSPCWKPSFEGE----NSNRGDVSGRIDGLLWY  38



>ref|XP_008369731.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Malus 
domestica]
 ref|XP_008369739.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Malus 
domestica]
Length=389

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 4/42 (10%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+ ++V PCW+P+ E E    +S  GD +GR+DGLLWY
Sbjct  1    MVSTTFLKLVSPCWKPSFEGE----NSNRGDVSGRIDGLLWY  38



>ref|XP_010558777.1| PREDICTED: probable protein phosphatase 2C 38 [Tarenaya hassleriana]
Length=388

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ ++ RIV  CWRP+ E E    S+R GD NGR+DGLLWY
Sbjct  1    MVSGSFMRIVSNCWRPSGEGEN---STRQGDSNGRIDGLLWY  39



>ref|XP_002281610.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Vitis 
vinifera]
 emb|CBI25323.3| unnamed protein product [Vitis vinifera]
Length=385

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 4/42 (10%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ +  RIV PCWRP+IE E    +S  GD  GRVDGLLWY
Sbjct  1    MVSNSLMRIVAPCWRPSIEGE----NSGRGDVAGRVDGLLWY  38



>ref|XP_010658151.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Vitis 
vinifera]
Length=390

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 4/42 (10%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ +  RIV PCWRP+IE E    +S  GD  GRVDGLLWY
Sbjct  1    MVSNSLMRIVAPCWRPSIEGE----NSGRGDVAGRVDGLLWY  38



>ref|XP_007142657.1| hypothetical protein PHAVU_007G0057000g, partial [Phaseolus vulgaris]
 gb|ESW14651.1| hypothetical protein PHAVU_007G0057000g, partial [Phaseolus vulgaris]
Length=310

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ T RRIV PCWR +  D G+  S R GD +GRVDGLLWY
Sbjct  1    MVSATIRRIVSPCWRAS--DTGE-ISGRHGDSSGRVDGLLWY  39



>ref|XP_010669737.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010669738.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=389

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 5/42 (12%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MVT+ + RIVYPCW+P++E    D S++  D NGR DGLLW+
Sbjct  1    MVTSGFMRIVYPCWKPSVEG---DNSTK--DANGRFDGLLWH  37



>gb|KHG11455.1| hypothetical protein F383_16117 [Gossypium arboreum]
Length=370

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ + +RI   CWRP+ + E    S + GD NGRVDGLLWY
Sbjct  1    MVSRSLKRIASRCWRPSFDGEN---SCKAGDANGRVDGLLWY  39



>ref|XP_010669739.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=384

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 5/42 (12%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MVT+ + RIVYPCW+P++E    D S++  D NGR DGLLW+
Sbjct  1    MVTSGFMRIVYPCWKPSVEG---DNSTK--DANGRFDGLLWH  37



>gb|KJB76497.1| hypothetical protein B456_012G092200 [Gossypium raimondii]
Length=370

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+ + +RI   CWRP+ + E    S + GD NGRVDGLLWY
Sbjct  1    MVSRSLKRIASRCWRPSFDGEN---SCKAGDANGRVDGLLWY  39



>ref|XP_010556097.1| PREDICTED: probable protein phosphatase 2C 48 [Tarenaya hassleriana]
 ref|XP_010556173.1| PREDICTED: probable protein phosphatase 2C 48 [Tarenaya hassleriana]
Length=393

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+   R+IV PCWRP+   E  + S   GD NGRV+GLLWY
Sbjct  1    MVSARLRKIVSPCWRPSAIGESSNAS---GDVNGRVEGLLWY  39



>ref|XP_009139203.1| PREDICTED: probable protein phosphatase 2C 48 [Brassica rapa]
Length=382

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+RRIV PCWRP    EG   S    D NGR+DGLLWY
Sbjct  1    MVSTTFRRIVTPCWRPFGVGEG---SVPDDDGNGRLDGLLWY  39



>emb|CDX76124.1| BnaA04g03880D [Brassica napus]
Length=374

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+RRIV PCWRP    EG   S    D NGR+DGLLWY
Sbjct  1    MVSTTFRRIVTPCWRPFGVGEG---SVPDDDGNGRLDGLLWY  39



>emb|CDY02904.1| BnaC04g25820D [Brassica napus]
Length=374

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = +1

Query  391  MVTTTWRRIVYPCWRPTIEDEGQDWSSRGGDPNGRVDGLLWY  516
            MV+TT+RRIV PCWRP    EG   S    D NGR+DGLLWY
Sbjct  1    MVSTTFRRIVTPCWRPFGIGEG---SVPDDDGNGRLDGLLWY  39



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325