BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G08

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248341.1|  PREDICTED: uncharacterized protein LOC101265175  52.8    4e-15   Solanum lycopersicum
ref|XP_011095715.1|  PREDICTED: uncharacterized protein LOC105175089  50.1    2e-14   Sesamum indicum [beniseed]
ref|XP_010064078.1|  PREDICTED: uncharacterized protein LOC104451...  60.1    4e-14   Eucalyptus grandis [rose gum]
gb|KCW71385.1|  hypothetical protein EUGRSUZ_F04459                   59.7    8e-14   Eucalyptus grandis [rose gum]
ref|XP_006352584.1|  PREDICTED: uncharacterized protein LOC102588261  51.6    1e-13   Solanum tuberosum [potatoes]
ref|XP_011458428.1|  PREDICTED: uncharacterized protein LOC101292...  52.8    2e-13   Fragaria vesca subsp. vesca
ref|XP_011458429.1|  PREDICTED: uncharacterized protein LOC101292...  52.8    2e-13   Fragaria vesca subsp. vesca
ref|XP_004290431.1|  PREDICTED: uncharacterized protein LOC101292...  52.8    3e-13   Fragaria vesca subsp. vesca
gb|EPS65429.1|  hypothetical protein M569_09349                       50.1    5e-13   Genlisea aurea
ref|XP_010064079.1|  PREDICTED: uncharacterized protein LOC104451...  59.7    8e-13   
ref|XP_009769866.1|  PREDICTED: uncharacterized protein LOC104220...  48.1    8e-13   Nicotiana sylvestris
ref|XP_009769860.1|  PREDICTED: uncharacterized protein LOC104220...  48.1    8e-13   Nicotiana sylvestris
ref|XP_010088814.1|  hypothetical protein L484_018376                 50.8    9e-13   Morus notabilis
ref|XP_008381005.1|  PREDICTED: uncharacterized protein LOC103443...  55.5    2e-12   Malus domestica [apple tree]
ref|XP_008381004.1|  PREDICTED: uncharacterized protein LOC103443...  55.5    2e-12   Malus domestica [apple tree]
ref|XP_010245782.1|  PREDICTED: uncharacterized protein LOC104589...  53.1    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009593125.1|  PREDICTED: uncharacterized protein LOC104089...  48.1    3e-12   
ref|XP_009593120.1|  PREDICTED: uncharacterized protein LOC104089...  48.1    3e-12   Nicotiana tomentosiformis
ref|XP_010245781.1|  PREDICTED: uncharacterized protein LOC104589...  53.1    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010245779.1|  PREDICTED: uncharacterized protein LOC104589...  53.1    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010245778.1|  PREDICTED: uncharacterized protein LOC104589...  53.1    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_004139901.1|  PREDICTED: putative rRNA methylase YtqB-like     51.6    3e-12   Cucumis sativus [cucumbers]
ref|XP_002441357.1|  hypothetical protein SORBIDRAFT_09g025160        50.1    8e-12   Sorghum bicolor [broomcorn]
ref|XP_008237294.1|  PREDICTED: uncharacterized protein LOC103336034  52.0    1e-11   
ref|XP_007200887.1|  hypothetical protein PRUPE_ppb015097mg           52.8    1e-11   
ref|XP_004488782.1|  PREDICTED: uncharacterized protein LOC101512...  50.8    2e-11   Cicer arietinum [garbanzo]
ref|XP_004488781.1|  PREDICTED: uncharacterized protein LOC101512...  50.8    2e-11   
ref|XP_006846008.1|  hypothetical protein AMTR_s00155p00066550        54.3    2e-11   
ref|XP_003568137.1|  PREDICTED: uncharacterized protein LOC100841937  51.6    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_004961547.1|  PREDICTED: uncharacterized protein LOC101767020  52.0    3e-11   
dbj|BAK06347.1|  predicted protein                                    49.7    6e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001056017.1|  Os05g0511700                                     51.2    9e-11   
ref|XP_003546814.1|  PREDICTED: uncharacterized protein LOC100798928  50.1    1e-10   Glycine max [soybeans]
gb|KHN48884.1|  Putative rRNA methylase ytqB                          50.1    1e-10   Glycine soja [wild soybean]
ref|XP_008649852.1|  PREDICTED: uncharacterized protein LOC103630584  48.1    1e-10   
ref|XP_004488861.1|  PREDICTED: aspartic proteinase CDR1-like         47.0    1e-10   
gb|AFW78647.1|  hypothetical protein ZEAMMB73_301644                  47.8    1e-10   
gb|KEH42072.1|  rRNA methylase, putative                              50.1    1e-10   Medicago truncatula
ref|XP_010923681.1|  PREDICTED: uncharacterized protein LOC105046711  55.8    7e-10   Elaeis guineensis
ref|XP_009403390.1|  PREDICTED: uncharacterized protein LOC103986956  50.8    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010537789.1|  PREDICTED: uncharacterized protein LOC104812...  48.5    1e-09   Tarenaya hassleriana [spider flower]
ref|XP_008794448.1|  PREDICTED: uncharacterized protein LOC103710498  54.3    2e-09   
ref|XP_006655473.1|  PREDICTED: lipoyl synthase 2, chloroplastic-...  48.1    2e-09   
ref|XP_007149201.1|  hypothetical protein PHAVU_005G050100g           47.8    2e-09   Phaseolus vulgaris [French bean]
ref|XP_006493791.1|  PREDICTED: uncharacterized protein LOC102612...  53.9    2e-09   Citrus sinensis [apfelsine]
ref|XP_007022590.1|  S-adenosyl-L-methionine-dependent methyltran...  48.1    2e-09   
ref|XP_002513364.1|  S-adenosylmethionine-dependent methyltransfe...  53.5    2e-09   Ricinus communis
ref|XP_006422249.1|  hypothetical protein CICLE_v10005586mg           53.9    2e-09   
ref|XP_007022591.1|  S-adenosyl-L-methionine-dependent methyltran...  53.9    4e-09   
ref|XP_011007214.1|  PREDICTED: uncharacterized protein LOC105112...  50.1    4e-09   Populus euphratica
ref|XP_011007213.1|  PREDICTED: uncharacterized protein LOC105112...  50.1    4e-09   Populus euphratica
ref|XP_011007215.1|  PREDICTED: uncharacterized protein LOC105112...  49.7    5e-09   Populus euphratica
ref|XP_011007212.1|  PREDICTED: uncharacterized protein LOC105112...  49.7    5e-09   Populus euphratica
ref|XP_006416817.1|  hypothetical protein EUTSA_v10008448mg           47.0    6e-09   Eutrema salsugineum [saltwater cress]
ref|XP_002310087.2|  hypothetical protein POPTR_0007s08000g           50.1    7e-09   
gb|EMT21418.1|  hypothetical protein F775_12615                       46.2    7e-09   
gb|KFK43854.1|  hypothetical protein AALP_AA1G182300                  45.1    9e-09   Arabis alpina [alpine rockcress]
gb|ADE77832.1|  unknown                                               53.1    1e-08   Picea sitchensis
ref|XP_010459185.1|  PREDICTED: uncharacterized protein LOC104740...  46.6    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010459187.1|  PREDICTED: uncharacterized protein LOC104740...  46.6    1e-08   Camelina sativa [gold-of-pleasure]
gb|EMS64750.1|  hypothetical protein TRIUR3_01018                     47.4    1e-08   Triticum urartu
emb|CDX81763.1|  BnaC08g38380D                                        46.6    1e-08   
ref|XP_010497853.1|  PREDICTED: uncharacterized protein LOC104775557  46.2    2e-08   Camelina sativa [gold-of-pleasure]
gb|KHG00676.1|  Putative rRNA methylase ytqB                          45.8    2e-08   Gossypium arboreum [tree cotton]
gb|KJB81384.1|  hypothetical protein B456_013G1424002                 46.2    3e-08   Gossypium raimondii
gb|KDO61598.1|  hypothetical protein CISIN_1g041272mg                 54.7    3e-08   Citrus sinensis [apfelsine]
ref|XP_010476756.1|  PREDICTED: uncharacterized protein LOC104755966  45.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010669993.1|  PREDICTED: uncharacterized protein LOC104887102  45.4    4e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006493792.1|  PREDICTED: uncharacterized protein LOC102612...  54.3    6e-08   
ref|XP_002890167.1|  hypothetical protein ARALYDRAFT_471841           46.6    7e-08   Arabidopsis lyrata subsp. lyrata
ref|NP_683312.2|  S-adenosyl-L-methionine-dependent methyltransfe...  48.1    9e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KJB81385.1|  hypothetical protein B456_013G1424002                 47.0    1e-06   Gossypium raimondii
ref|XP_002263914.3|  PREDICTED: uncharacterized protein LOC100252956  53.5    3e-05   Vitis vinifera
emb|CAN63608.1|  hypothetical protein VITISV_019132                   53.5    3e-05   Vitis vinifera
ref|XP_002975185.1|  hypothetical protein SELMODRAFT_57713            48.5    8e-05   
emb|CDY51003.1|  BnaA09g56320D                                        46.6    9e-05   Brassica napus [oilseed rape]
ref|XP_009117765.1|  PREDICTED: uncharacterized protein LOC103842850  46.6    1e-04   Brassica rapa



>ref|XP_004248341.1| PREDICTED: uncharacterized protein LOC101265175 [Solanum lycopersicum]
Length=285

 Score = 52.8 bits (125),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWKHIV++GD V+DATCGNG+DTL ++K
Sbjct  105  VWKHIVQKGDAVVDATCGNGYDTLALLK  132


 Score = 46.2 bits (108),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALLK++AD TR+GRVY MDVQK+A
Sbjct  128  LALLKLVADKTRRGRVYGMDVQKIA  152


 Score = 28.9 bits (63),  Expect(3) = 4e-15, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  431  VEGVMMEYICGQRRATLVAH  490
            +E VM+EY+ G+++AT VAH
Sbjct  84   MEQVMVEYVFGRKKATEVAH  103



>ref|XP_011095715.1| PREDICTED: uncharacterized protein LOC105175089 [Sesamum indicum]
Length=341

 Score = 50.1 bits (118),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            +VWK++VR+GD VIDATCGNG+DTL +++
Sbjct  160  AVWKNVVRKGDLVIDATCGNGYDTLAMLR  188


 Score = 45.4 bits (106),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+L++IADDTR+GRVYAMD+QK A
Sbjct  184  LAMLRLIADDTRRGRVYAMDLQKDA  208


 Score = 30.4 bits (67),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E VM  YI G+R+AT VAH+
Sbjct  139  GLEDVMTGYIFGKRKATEVAHA  160



>ref|XP_010064078.1| PREDICTED: uncharacterized protein LOC104451027 isoform X1 [Eucalyptus 
grandis]
 gb|KCW71384.1| hypothetical protein EUGRSUZ_F04459 [Eucalyptus grandis]
Length=259

 Score = 60.1 bits (144),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            SVWKH+VREGDTV+DATCGNGHDTL ++K
Sbjct  78   SVWKHVVREGDTVVDATCGNGHDTLALVK  106


 Score = 34.3 bits (77),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LAL+K++A ++ +GRVY MD+Q+ A
Sbjct  102  LALVKLVAGESGRGRVYGMDIQEDA  126


 Score = 30.4 bits (67),  Expect(3) = 4e-14, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E  M+ YI G+RRAT VAHS
Sbjct  57   GLEDQMVGYIFGRRRATDVAHS  78



>gb|KCW71385.1| hypothetical protein EUGRSUZ_F04459 [Eucalyptus grandis]
Length=212

 Score = 59.7 bits (143),  Expect(3) = 8e-14, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            SVWKH+VREGDTV+DATCGNGHDTL ++K
Sbjct  31   SVWKHVVREGDTVVDATCGNGHDTLALVK  59


 Score = 33.9 bits (76),  Expect(3) = 8e-14, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LAL+K++A ++ +GRVY MD+Q+ A
Sbjct  55   LALVKLVAGESGRGRVYGMDIQEDA  79


 Score = 30.0 bits (66),  Expect(3) = 8e-14, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E  M+ YI G+RRAT VAHS
Sbjct  10   GLEDQMVGYIFGRRRATDVAHS  31



>ref|XP_006352584.1| PREDICTED: uncharacterized protein LOC102588261 [Solanum tuberosum]
Length=285

 Score = 51.6 bits (122),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWKH+V++GD V+DATCGNG+DTL ++K
Sbjct  105  VWKHVVQKGDAVVDATCGNGYDTLALLK  132


 Score = 42.0 bits (97),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALLK++ D T++GRVY MDVQK+A
Sbjct  128  LALLKLVDDKTQRGRVYGMDVQKIA  152


 Score = 28.9 bits (63),  Expect(3) = 1e-13, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  431  VEGVMMEYICGQRRATLVAH  490
            +E VM+EY+ G+++AT VAH
Sbjct  84   MEQVMVEYVFGRKKATEVAH  103



>ref|XP_011458428.1| PREDICTED: uncharacterized protein LOC101292757 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=234

 Score = 52.8 bits (125),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            SVW+ +V+EGDTVID TCGNGHDTL ++K
Sbjct  75   SVWRRVVQEGDTVIDTTCGNGHDTLAMLK  103


 Score = 37.7 bits (86),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LKM+AD + KG +Y MD+Q+VA
Sbjct  99   LAMLKMVADASGKGSIYGMDIQEVA  123


 Score = 31.6 bits (70),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E V++ +I G++RAT VAHS
Sbjct  54   GLEDVLLSFILGKKRATEVAHS  75



>ref|XP_011458429.1| PREDICTED: uncharacterized protein LOC101292757 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=231

 Score = 52.8 bits (125),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            SVW+ +V+EGDTVID TCGNGHDTL ++K
Sbjct  75   SVWRRVVQEGDTVIDTTCGNGHDTLAMLK  103


 Score = 37.4 bits (85),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LKM+AD + KG +Y MD+Q+VA
Sbjct  99   LAMLKMVADASGKGSIYGMDIQEVA  123


 Score = 31.6 bits (70),  Expect(3) = 2e-13, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E V++ +I G++RAT VAHS
Sbjct  54   GLEDVLLSFILGKKRATEVAHS  75



>ref|XP_004290431.1| PREDICTED: uncharacterized protein LOC101292757 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011458426.1| PREDICTED: uncharacterized protein LOC101292757 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011458427.1| PREDICTED: uncharacterized protein LOC101292757 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=257

 Score = 52.8 bits (125),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            SVW+ +V+EGDTVID TCGNGHDTL ++K
Sbjct  75   SVWRRVVQEGDTVIDTTCGNGHDTLAMLK  103


 Score = 37.4 bits (85),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LKM+AD + KG +Y MD+Q+VA
Sbjct  99   LAMLKMVADASGKGSIYGMDIQEVA  123


 Score = 31.2 bits (69),  Expect(3) = 3e-13, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E V++ +I G++RAT VAHS
Sbjct  54   GLEDVLLSFILGKKRATEVAHS  75



>gb|EPS65429.1| hypothetical protein M569_09349, partial [Genlisea aurea]
Length=203

 Score = 50.1 bits (118),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            +VWK++VR+GD V+DATCGNG+DTL +++
Sbjct  23   AVWKNVVRKGDAVVDATCGNGYDTLALVR  51


 Score = 39.3 bits (90),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LAL++++ADD R+GRVY +D+QK A
Sbjct  47   LALVRLVADDARRGRVYGIDLQKHA  71


 Score = 31.6 bits (70),  Expect(3) = 5e-13, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E  +MEYI G+++AT VAH+
Sbjct  2    GLEDAVMEYISGKKKATEVAHA  23



>ref|XP_010064079.1| PREDICTED: uncharacterized protein LOC104451027 isoform X2 [Eucalyptus 
grandis]
Length=198

 Score = 59.7 bits (143),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            SVWKH+VREGDTV+DATCGNGHDTL ++K
Sbjct  17   SVWKHVVREGDTVVDATCGNGHDTLALVK  45


 Score = 33.9 bits (76),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LAL+K++A ++ +GRVY MD+Q+ A
Sbjct  41   LALVKLVAGESGRGRVYGMDIQEDA  65


 Score = 26.6 bits (57),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  443  MMEYICGQRRATLVAHS  493
            M+ YI G+RRAT VAHS
Sbjct  1    MVGYIFGRRRATDVAHS  17



>ref|XP_009769866.1| PREDICTED: uncharacterized protein LOC104220666 isoform X2 [Nicotiana 
sylvestris]
Length=259

 Score = 48.1 bits (113),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWK +V++GD V+DATCGNG+DTL +++
Sbjct  98   VWKQVVQKGDAVVDATCGNGYDTLALLR  125


 Score = 43.1 bits (100),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALL+M+AD T +GRVY MDVQK+A
Sbjct  121  LALLRMVADSTGRGRVYGMDVQKIA  145


 Score = 28.5 bits (62),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  431  VEGVMMEYICGQRRATLVAH  490
            +E VM+EY+ G+++AT VAH
Sbjct  77   MEQVMVEYVFGRKKATEVAH  96



>ref|XP_009769860.1| PREDICTED: uncharacterized protein LOC104220666 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769861.1| PREDICTED: uncharacterized protein LOC104220666 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769862.1| PREDICTED: uncharacterized protein LOC104220666 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769863.1| PREDICTED: uncharacterized protein LOC104220666 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769865.1| PREDICTED: uncharacterized protein LOC104220666 isoform X1 [Nicotiana 
sylvestris]
Length=278

 Score = 48.1 bits (113),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWK +V++GD V+DATCGNG+DTL +++
Sbjct  98   VWKQVVQKGDAVVDATCGNGYDTLALLR  125


 Score = 43.1 bits (100),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALL+M+AD T +GRVY MDVQK+A
Sbjct  121  LALLRMVADSTGRGRVYGMDVQKIA  145


 Score = 28.5 bits (62),  Expect(3) = 8e-13, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  431  VEGVMMEYICGQRRATLVAH  490
            +E VM+EY+ G+++AT VAH
Sbjct  77   MEQVMVEYVFGRKKATEVAH  96



>ref|XP_010088814.1| hypothetical protein L484_018376 [Morus notabilis]
 gb|EXB36997.1| hypothetical protein L484_018376 [Morus notabilis]
Length=283

 Score = 50.8 bits (120),  Expect(3) = 9e-13, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ +VR+GDTVIDATCGNG+DTL ++K
Sbjct  102  VWERVVRKGDTVIDATCGNGYDTLTLLK  129


 Score = 40.4 bits (93),  Expect(3) = 9e-13, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            L LLKM+AD++ +GRVY +DVQK A
Sbjct  125  LTLLKMVADESHQGRVYGLDVQKAA  149


 Score = 28.5 bits (62),  Expect(3) = 9e-13, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            GVE V+  Y+ G+++AT VAH
Sbjct  80   GVEDVLASYVFGKKKATEVAH  100



>ref|XP_008381005.1| PREDICTED: uncharacterized protein LOC103443885 isoform X2 [Malus 
domestica]
Length=271

 Score = 55.5 bits (132),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWKH+V++GDTVIDATCGNGHDTL ++K
Sbjct  109  VWKHVVQKGDTVIDATCGNGHDTLAMLK  136


 Score = 36.6 bits (83),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LKM+AD++ KG VY +D+Q+ A
Sbjct  132  LAMLKMVADESGKGSVYGLDIQEAA  156


 Score = 26.9 bits (58),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E +++ +I G++RAT V+H
Sbjct  87   GLEDLLVSFILGKKRATEVSH  107



>ref|XP_008381004.1| PREDICTED: uncharacterized protein LOC103443885 isoform X1 [Malus 
domestica]
Length=290

 Score = 55.5 bits (132),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWKH+V++GDTVIDATCGNGHDTL ++K
Sbjct  109  VWKHVVQKGDTVIDATCGNGHDTLAMLK  136


 Score = 36.6 bits (83),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LKM+AD++ KG VY +D+Q+ A
Sbjct  132  LAMLKMVADESGKGSVYGLDIQEAA  156


 Score = 26.9 bits (58),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E +++ +I G++RAT V+H
Sbjct  87   GLEDLLVSFILGKKRATEVSH  107



>ref|XP_010245782.1| PREDICTED: uncharacterized protein LOC104589231 isoform X4 [Nelumbo 
nucifera]
Length=243

 Score = 53.1 bits (126),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            S+WKH V++GDTV+DATCGNG+DTL ++K
Sbjct  101  SIWKHFVQKGDTVVDATCGNGYDTLAMLK  129


 Score = 36.6 bits (83),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LK++ADD+  G VY MD+Q VA
Sbjct  125  LAMLKLVADDSGNGCVYGMDIQTVA  149


 Score = 28.5 bits (62),  Expect(3) = 2e-12, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E  ++ YI G+++AT VAHS
Sbjct  80   GLEDALIGYISGKKKATEVAHS  101



>ref|XP_009593125.1| PREDICTED: uncharacterized protein LOC104089832 isoform X2 [Nicotiana 
tomentosiformis]
Length=259

 Score = 48.1 bits (113),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWK +V++GD V+DATCGNG+DTL +++
Sbjct  98   VWKQVVQKGDAVVDATCGNGYDTLALLR  125


 Score = 42.0 bits (97),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALL+M+AD+  +GRVY MDVQK+A
Sbjct  121  LALLRMVADNAGRGRVYGMDVQKIA  145


 Score = 28.1 bits (61),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  431  VEGVMMEYICGQRRATLVAH  490
            +E VM+EY+ G+++AT VAH
Sbjct  77   MEQVMVEYVFGRKKATEVAH  96



>ref|XP_009593120.1| PREDICTED: uncharacterized protein LOC104089832 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009593121.1| PREDICTED: uncharacterized protein LOC104089832 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009593122.1| PREDICTED: uncharacterized protein LOC104089832 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009593123.1| PREDICTED: uncharacterized protein LOC104089832 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009593124.1| PREDICTED: uncharacterized protein LOC104089832 isoform X1 [Nicotiana 
tomentosiformis]
Length=278

 Score = 48.1 bits (113),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWK +V++GD V+DATCGNG+DTL +++
Sbjct  98   VWKQVVQKGDAVVDATCGNGYDTLALLR  125


 Score = 42.0 bits (97),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALL+M+AD+  +GRVY MDVQK+A
Sbjct  121  LALLRMVADNAGRGRVYGMDVQKIA  145


 Score = 28.1 bits (61),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +2

Query  431  VEGVMMEYICGQRRATLVAH  490
            +E VM+EY+ G+++AT VAH
Sbjct  77   MEQVMVEYVFGRKKATEVAH  96



>ref|XP_010245781.1| PREDICTED: uncharacterized protein LOC104589231 isoform X3 [Nelumbo 
nucifera]
Length=243

 Score = 53.1 bits (126),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            S+WKH V++GDTV+DATCGNG+DTL ++K
Sbjct  101  SIWKHFVQKGDTVVDATCGNGYDTLAMLK  129


 Score = 36.6 bits (83),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LK++ADD+  G VY MD+Q VA
Sbjct  125  LAMLKLVADDSGNGCVYGMDIQTVA  149


 Score = 28.5 bits (62),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E  ++ YI G+++AT VAHS
Sbjct  80   GLEDALIGYISGKKKATEVAHS  101



>ref|XP_010245779.1| PREDICTED: uncharacterized protein LOC104589231 isoform X2 [Nelumbo 
nucifera]
Length=279

 Score = 53.1 bits (126),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            S+WKH V++GDTV+DATCGNG+DTL ++K
Sbjct  98   SIWKHFVQKGDTVVDATCGNGYDTLAMLK  126


 Score = 36.6 bits (83),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LK++ADD+  G VY MD+Q VA
Sbjct  122  LAMLKLVADDSGNGCVYGMDIQTVA  146


 Score = 28.5 bits (62),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E  ++ YI G+++AT VAHS
Sbjct  77   GLEDALIGYISGKKKATEVAHS  98



>ref|XP_010245778.1| PREDICTED: uncharacterized protein LOC104589231 isoform X1 [Nelumbo 
nucifera]
Length=282

 Score = 53.1 bits (126),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            S+WKH V++GDTV+DATCGNG+DTL ++K
Sbjct  101  SIWKHFVQKGDTVVDATCGNGYDTLAMLK  129


 Score = 36.6 bits (83),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LK++ADD+  G VY MD+Q VA
Sbjct  125  LAMLKLVADDSGNGCVYGMDIQTVA  149


 Score = 28.5 bits (62),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E  ++ YI G+++AT VAHS
Sbjct  80   GLEDALIGYISGKKKATEVAHS  101



>ref|XP_004139901.1| PREDICTED: putative rRNA methylase YtqB-like [Cucumis sativus]
 ref|XP_004165139.1| PREDICTED: putative rRNA methylase YtqB-like [Cucumis sativus]
 gb|KGN46802.1| hypothetical protein Csa_6G136560 [Cucumis sativus]
Length=265

 Score = 51.6 bits (122),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            SVWK IV++GDTV+DATCGNG+DTL ++K
Sbjct  84   SVWKCIVKKGDTVVDATCGNGYDTLAMVK  112


 Score = 35.8 bits (81),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA++KM+AD++   RVYAMDVQ  A
Sbjct  108  LAMVKMVADESGSARVYAMDVQNEA  132


 Score = 30.4 bits (67),  Expect(3) = 3e-12, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E VM+ Y  G++RAT VAHS
Sbjct  63   GLEDVMVGYFFGKKRATEVAHS  84



>ref|XP_002441357.1| hypothetical protein SORBIDRAFT_09g025160 [Sorghum bicolor]
 gb|EES19787.1| hypothetical protein SORBIDRAFT_09g025160 [Sorghum bicolor]
Length=272

 Score = 50.1 bits (118),  Expect(3) = 8e-12, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            +VW++IV++GDTV+DATCGNG+DTL ++K
Sbjct  90   AVWRNIVQKGDTVVDATCGNGNDTLALLK  118


 Score = 40.4 bits (93),  Expect(3) = 8e-12, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALLKM+AD+T +GRVY MD+Q  A
Sbjct  114  LALLKMVADETAQGRVYGMDIQDSA  138


 Score = 26.2 bits (56),  Expect(3) = 8e-12, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            GVE  ++ ++ G+R+AT VAH+
Sbjct  69   GVEEAVVGFVAGKRKATEVAHA  90



>ref|XP_008237294.1| PREDICTED: uncharacterized protein LOC103336034 [Prunus mume]
Length=363

 Score = 52.0 bits (123),  Expect(3) = 1e-11, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWK +V++GDTVIDATCGNGHDTL ++K
Sbjct  207  VWKSVVQKGDTVIDATCGNGHDTLAMLK  234


 Score = 35.8 bits (81),  Expect(3) = 1e-11, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LKM+AD++ KG VY +DVQ+ A
Sbjct  230  LAMLKMVADESCKGSVYGLDVQEAA  254


 Score = 27.7 bits (60),  Expect(3) = 1e-11, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 29/63 (46%), Gaps = 1/63 (2%)
 Frame = +2

Query  305  HPNPKPKPSGIVSVRPIPNGNLEPSGLVSIASSIp-pppplpGVEGVMMEYICGQRRATL  481
            +PN KP     V+   +     E  G V     I        G+E +++ +I G++RAT 
Sbjct  143  NPNIKPTKKRNVANDKLAISATEEGGYVWFELFIFPVTKQSSGLEDLLVSFILGKKRATE  202

Query  482  VAH  490
            V+H
Sbjct  203  VSH  205



>ref|XP_007200887.1| hypothetical protein PRUPE_ppb015097mg, partial [Prunus persica]
 gb|EMJ02086.1| hypothetical protein PRUPE_ppb015097mg, partial [Prunus persica]
Length=228

 Score = 52.8 bits (125),  Expect(3) = 1e-11, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWK +V++GDTVIDATCGNGHDTL ++K
Sbjct  29   VWKSVVQKGDTVIDATCGNGHDTLAMLK  56


 Score = 36.2 bits (82),  Expect(3) = 1e-11, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LKM+AD++ KG VY +DVQ+ A
Sbjct  52   LAMLKMVADESCKGSVYGLDVQEAA  76


 Score = 26.9 bits (58),  Expect(3) = 1e-11, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E +++ +I G++RAT V+H
Sbjct  7    GLEDLLVSFILGKKRATEVSH  27



>ref|XP_004488782.1| PREDICTED: uncharacterized protein LOC101512353 isoform X2 [Cicer 
arietinum]
Length=290

 Score = 50.8 bits (120),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGII  578
            VWKHI+++GDTVIDATCGNG DTL ++
Sbjct  110  VWKHIIQKGDTVIDATCGNGFDTLALL  136


 Score = 37.4 bits (85),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALL ++ADD+  G VYA+D+QK A
Sbjct  133  LALLNLVADDSHNGYVYALDIQKDA  157


 Score = 27.3 bits (59),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + ++ G++RAT VAH
Sbjct  88   GLEDVFVSFVFGKKRATDVAH  108



>ref|XP_004488781.1| PREDICTED: uncharacterized protein LOC101512353 isoform X1 [Cicer 
arietinum]
Length=295

 Score = 50.8 bits (120),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGII  578
            VWKHI+++GDTVIDATCGNG DTL ++
Sbjct  110  VWKHIIQKGDTVIDATCGNGFDTLALL  136


 Score = 37.4 bits (85),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALL ++ADD+  G VYA+D+QK A
Sbjct  133  LALLNLVADDSHNGYVYALDIQKDA  157


 Score = 27.3 bits (59),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + ++ G++RAT VAH
Sbjct  88   GLEDVFVSFVFGKKRATDVAH  108



>ref|XP_006846008.1| hypothetical protein AMTR_s00155p00066550 [Amborella trichopoda]
 gb|ERN07683.1| hypothetical protein AMTR_s00155p00066550 [Amborella trichopoda]
Length=292

 Score = 54.3 bits (129),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            SVW+H+VR GD VIDATCGNGHDTL ++K
Sbjct  90   SVWRHVVRGGDIVIDATCGNGHDTLALLK  118


 Score = 32.3 bits (72),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALLKM+++ +  G VY +D+Q+ A
Sbjct  114  LALLKMVSNGSGHGHVYGLDIQQFA  138


 Score = 28.9 bits (63),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +2

Query  398  SSIppppplpGVEGVMMEYICGQRRATLVAHS  493
            SS+    P+ G+E  +M +I G+R+ T VAHS
Sbjct  59   SSVSETSPVLGLEDALMGFIYGERKVTEVAHS  90



>ref|XP_003568137.1| PREDICTED: uncharacterized protein LOC100841937 [Brachypodium 
distachyon]
Length=261

 Score = 51.6 bits (122),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            SVW+ IVR+GDTV+DATCGNG+DT  ++K
Sbjct  80   SVWRSIVRKGDTVVDATCGNGNDTFALLK  108


 Score = 36.2 bits (82),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +1

Query  571  ALLKMIADDTRKGRVYAMDVQKVA  642
            ALLKM+AD+  +GRVY MD+Q  A
Sbjct  105  ALLKMVADERGQGRVYGMDIQDSA  128


 Score = 27.3 bits (59),  Expect(3) = 2e-11, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +2

Query  395  ASSIppppplpGVEGVMMEYICGQRRATLVAHS  493
            A+ +  P    GVE  ++ ++ G+R+AT VAHS
Sbjct  48   AAQLADPLAAAGVEEAVVGFVTGKRKATEVAHS  80



>ref|XP_004961547.1| PREDICTED: uncharacterized protein LOC101767020 [Setaria italica]
Length=311

 Score = 52.0 bits (123),  Expect(3) = 3e-11, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            +VW+ IVR+GDTV+DATCGNG+DTL ++K
Sbjct  129  AVWRSIVRKGDTVVDATCGNGNDTLALLK  157


 Score = 34.3 bits (77),  Expect(3) = 3e-11, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALLKM+AD+  +G VY MD+Q  A
Sbjct  153  LALLKMVADERAQGCVYGMDIQDSA  177


 Score = 28.1 bits (61),  Expect(3) = 3e-11, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            GVE  ++ ++ G+RRAT VAH+
Sbjct  108  GVEDAVVGFVTGKRRATEVAHA  129



>dbj|BAK06347.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score = 49.7 bits (117),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            +VW+ IVR+GDTV+DATCGNG+DT  ++K
Sbjct  78   AVWRSIVRKGDTVVDATCGNGNDTFALLK  106


 Score = 37.4 bits (85),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  571  ALLKMIADDTRKGRVYAMDVQKVA  642
            ALLKM++D+T +GRVY MD+Q  A
Sbjct  103  ALLKMVSDETGRGRVYGMDIQDSA  126


 Score = 26.2 bits (56),  Expect(3) = 6e-11, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            GVE  ++ ++ G+R+AT VAH+
Sbjct  57   GVEEAVVGFVTGKRKATEVAHA  78



>ref|NP_001056017.1| Os05g0511700 [Oryza sativa Japonica Group]
 dbj|BAF17931.1| Os05g0511700 [Oryza sativa Japonica Group]
 gb|EEC79514.1| hypothetical protein OsI_20592 [Oryza sativa Indica Group]
 gb|EEE64328.1| hypothetical protein OsJ_19168 [Oryza sativa Japonica Group]
Length=260

 Score = 51.2 bits (121),  Expect(3) = 9e-11, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  486  LIRSVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            L  +VW+ IVR+GDTV+DATCGNG+DT  ++K
Sbjct  76   LAHAVWRSIVRKGDTVVDATCGNGNDTFAMLK  107


 Score = 34.7 bits (78),  Expect(3) = 9e-11, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  571  ALLKMIADDTRKGRVYAMDVQKVA  642
            A+LKM+AD+  +GRVY +D+Q+ A
Sbjct  104  AMLKMVADERVQGRVYGLDIQESA  127


 Score = 27.3 bits (59),  Expect(3) = 9e-11, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = +2

Query  380  GLVSIASSIppppplpGVEGVMMEYICGQRRATLVAHS  493
            GL   AS+      + GVE  ++ ++ G+R+AT +AH+
Sbjct  42   GLSVRASAAELAAGVAGVEDAVVGFVTGKRKATELAHA  79



>ref|XP_003546814.1| PREDICTED: uncharacterized protein LOC100798928 [Glycine max]
Length=285

 Score = 50.1 bits (118),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGII  578
            VWKH+V++GDTVIDATCGNG DTL ++
Sbjct  105  VWKHVVQKGDTVIDATCGNGFDTLAML  131


 Score = 35.4 bits (80),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+L ++ADD+  G VYA+D+QK A
Sbjct  128  LAMLNLVADDSHNGCVYALDIQKDA  152


 Score = 27.3 bits (59),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E  ++ Y+ G++RAT +AH
Sbjct  83   GLEDALVSYLFGKKRATDIAH  103



>gb|KHN48884.1| Putative rRNA methylase ytqB [Glycine soja]
Length=285

 Score = 50.1 bits (118),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGII  578
            VWKH+V++GDTVIDATCGNG DTL ++
Sbjct  105  VWKHVVQKGDTVIDATCGNGFDTLAML  131


 Score = 35.0 bits (79),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+L ++ADD+  G VYA+D+QK A
Sbjct  128  LAMLNLVADDSHNGCVYALDIQKDA  152


 Score = 27.3 bits (59),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E  ++ Y+ G++RAT +AH
Sbjct  83   GLEDALVSYLFGKKRATDIAH  103



>ref|XP_008649852.1| PREDICTED: uncharacterized protein LOC103630584 [Zea mays]
Length=227

 Score = 48.1 bits (113),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            + W++IV++GDTV+DATCGNG+DTL ++K
Sbjct  85   AFWRNIVQKGDTVVDATCGNGNDTLALLK  113


 Score = 40.4 bits (93),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALLKM+AD+T +GRVY MD+Q  A
Sbjct  109  LALLKMVADETGRGRVYGMDIQDSA  133


 Score = 24.3 bits (51),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E     ++ G+R+AT VAH+
Sbjct  64   GLEAAAAGFVTGKRKATEVAHA  85



>ref|XP_004488861.1| PREDICTED: aspartic proteinase CDR1-like [Cicer arietinum]
Length=518

 Score = 47.0 bits (110),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            V KHI+++GDTVIDATCGNG DTL ++ 
Sbjct  469  VLKHIIQKGDTVIDATCGNGFDTLALLN  496


 Score = 37.4 bits (85),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALL ++ADD+  G VYA+D+QK A
Sbjct  492  LALLNLVADDSHYGYVYALDIQKDA  516


 Score = 27.7 bits (60),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + ++ G++RAT VAH
Sbjct  447  GLEDVFVSFVFGKKRATDVAH  467



>gb|AFW78647.1| hypothetical protein ZEAMMB73_301644 [Zea mays]
Length=183

 Score = 47.8 bits (112),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            + W++IV++GDTV+DATCGNG+DTL ++K
Sbjct  41   AFWRNIVQKGDTVVDATCGNGNDTLALLK  69


 Score = 40.4 bits (93),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALLKM+AD+T +GRVY MD+Q  A
Sbjct  65   LALLKMVADETGRGRVYGMDIQDSA  89


 Score = 24.3 bits (51),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E     ++ G+R+AT VAH+
Sbjct  20   GLEAAAAGFVTGKRKATEVAHA  41



>gb|KEH42072.1| rRNA methylase, putative [Medicago truncatula]
Length=264

 Score = 50.1 bits (118),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGII  578
            VWKH+V++GDTVIDATCGNG DTL ++
Sbjct  84   VWKHVVQKGDTVIDATCGNGFDTLALL  110


 Score = 35.4 bits (80),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALL ++AD++  G VYA+D+QK A
Sbjct  107  LALLNLVADESHNGYVYALDIQKDA  131


 Score = 26.6 bits (57),  Expect(3) = 1e-10, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + ++ G++RAT VAH
Sbjct  62   GLEDVFVSFLFGKKRATDVAH  82



>ref|XP_010923681.1| PREDICTED: uncharacterized protein LOC105046711 [Elaeis guineensis]
Length=281

 Score = 55.8 bits (133),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            SVWK+I+R+GDTV+DATCGNGHDTL ++K
Sbjct  100  SVWKNIIRDGDTVVDATCGNGHDTLALLK  128


 Score = 34.3 bits (77),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALLKM+AD + +G VY MD+Q  A
Sbjct  124  LALLKMVADQSGRGCVYGMDIQTSA  148



>ref|XP_009403390.1| PREDICTED: uncharacterized protein LOC103986956 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score = 50.8 bits (120),  Expect(3) = 1e-09, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGII  578
            SVWK+I+++GDTVIDATCGNG+DTL ++
Sbjct  72   SVWKNIIQKGDTVIDATCGNGYDTLALL  99


 Score = 31.2 bits (69),  Expect(3) = 1e-09, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALL M+A ++ +G VY MD+Q+ A
Sbjct  96   LALLAMVAGESGRGCVYGMDIQQEA  120


 Score = 26.9 bits (58),  Expect(3) = 1e-09, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            G+E   M +I G+++AT VAHS
Sbjct  51   GMEEAFMGFITGRKKATEVAHS  72



>ref|XP_010537789.1| PREDICTED: uncharacterized protein LOC104812361 isoform X2 [Tarenaya 
hassleriana]
Length=272

 Score = 48.5 bits (114),  Expect(3) = 1e-09, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ +V++GDTV+DATCGNG+DTL ++K
Sbjct  90   VWEQVVQKGDTVVDATCGNGYDTLAMLK  117


 Score = 33.5 bits (75),  Expect(3) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LKM+ D++  G VYAMD+Q  A
Sbjct  113  LAMLKMVMDESGGGHVYAMDIQDNA  137


 Score = 26.9 bits (58),  Expect(3) = 1e-09, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V++ Y+ G+++AT VAH
Sbjct  68   GLEDVLIGYLFGKKKATEVAH  88



>ref|XP_008794448.1| PREDICTED: uncharacterized protein LOC103710498 [Phoenix dactylifera]
Length=307

 Score = 54.3 bits (129),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            SVWK+I+++GDTV+DATCGNGHDTL ++K
Sbjct  100  SVWKNIIQKGDTVVDATCGNGHDTLALLK  128


 Score = 35.0 bits (79),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALLKM+AD++ +G +Y MD+Q  A
Sbjct  124  LALLKMVADESGRGCIYGMDIQNSA  148



>ref|XP_006655473.1| PREDICTED: lipoyl synthase 2, chloroplastic-like [Oryza brachyantha]
Length=592

 Score = 48.1 bits (113),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  486  LIRSVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            L  +VW+ I+++GDTV+DATCGNG+DT  ++K
Sbjct  408  LAHAVWRSIIQKGDTVVDATCGNGNDTFAMLK  439


 Score = 34.7 bits (78),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
             A+LKM+AD+  +GRVY +D+Q+ A
Sbjct  435  FAMLKMVADERVQGRVYGLDIQESA  459


 Score = 25.8 bits (55),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAHS  493
            GVE  ++ ++ G+R+AT +AH+
Sbjct  390  GVEDAVVGFVAGKRKATELAHA  411



>ref|XP_007149201.1| hypothetical protein PHAVU_005G050100g [Phaseolus vulgaris]
 gb|ESW21195.1| hypothetical protein PHAVU_005G050100g [Phaseolus vulgaris]
Length=280

 Score = 47.8 bits (112),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGII  578
            VWK +V++GDTVIDATCGNG DTL ++
Sbjct  100  VWKQVVQKGDTVIDATCGNGFDTLAML  126


 Score = 33.5 bits (75),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+L ++ADD   G VYA+D+Q+ A
Sbjct  123  LAMLNLVADDYHDGYVYALDIQEDA  147


 Score = 26.9 bits (58),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E  ++ Y+ G++RAT +AH
Sbjct  78   GLEDALVSYLFGKKRATDIAH  98



>ref|XP_006493791.1| PREDICTED: uncharacterized protein LOC102612041 isoform X1 [Citrus 
sinensis]
Length=289

 Score = 53.9 bits (128),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWKH+VR+GDTV+DATCGNG+DTL ++K
Sbjct  109  VWKHVVRKGDTVVDATCGNGYDTLMMLK  136


 Score = 30.0 bits (66),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            L +LKM+AD++  G VY +D+Q  A
Sbjct  132  LMMLKMVADESSAGCVYGLDIQSEA  156


 Score = 24.6 bits (52),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E  ++ Y+ G+++AT VAH
Sbjct  87   GLENELVGYVFGKKKATEVAH  107



>ref|XP_007022590.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY14115.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=270

 Score = 48.1 bits (113),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+H++ +GD VIDATCGNG+DTL ++K
Sbjct  90   VWRHVLHKGDIVIDATCGNGYDTLAMLK  117


 Score = 35.0 bits (79),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQ  633
            LA+LKM+AD++  GRVY +D+Q
Sbjct  113  LAMLKMVADESGSGRVYGIDIQ  134


 Score = 25.4 bits (54),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E  ++ YI G+++AT VAH
Sbjct  68   GLENELVGYILGKKKATEVAH  88



>ref|XP_002513364.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48767.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=286

 Score = 53.5 bits (127),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWKH++++GDTV+DATCGNGHDTL ++K
Sbjct  86   VWKHVLQKGDTVVDATCGNGHDTLALLK  113


 Score = 35.4 bits (80),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LALLKM+AD++  G VY MD+Q  A
Sbjct  109  LALLKMVADESGNGHVYGMDIQSDA  133



>ref|XP_006422249.1| hypothetical protein CICLE_v10005586mg [Citrus clementina]
 gb|ESR35489.1| hypothetical protein CICLE_v10005586mg [Citrus clementina]
Length=279

 Score = 53.9 bits (128),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWKH+VR+GDTV+DATCGNG+DTL ++K
Sbjct  99   VWKHVVRKGDTVVDATCGNGYDTLMMLK  126


 Score = 30.0 bits (66),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            L +LKM+AD++  G VY +D+Q  A
Sbjct  122  LMMLKMVADESSAGCVYGLDIQSEA  146


 Score = 24.3 bits (51),  Expect(3) = 2e-09, Method: Compositional matrix adjust.
 Identities = 9/21 (43%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E  ++ Y+ G+++AT VAH
Sbjct  77   GLENELVGYVFGKKKATEVAH  97



>ref|XP_007022591.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY14116.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=219

 Score = 53.9 bits (128),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  423  FQA*RV**WNIYAVKGEPLSLLIRSVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            FQ  R+  W IY  + +    LI  VW+H++ +GD VIDATCGNG+DTL ++K
Sbjct  14   FQGWRMSWWVIYWGRRKQQKWLICRVWRHVLHKGDIVIDATCGNGYDTLAMLK  66


 Score = 34.3 bits (77),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQ  633
            LA+LKM+AD++  GRVY +D+Q
Sbjct  62   LAMLKMVADESGSGRVYGIDIQ  83



>ref|XP_011007214.1| PREDICTED: uncharacterized protein LOC105112966 isoform X3 [Populus 
euphratica]
Length=266

 Score = 50.1 bits (118),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            +WK +V+ GDTVIDATCGNG+DTL ++K
Sbjct  80   IWKRVVQNGDTVIDATCGNGYDTLAMLK  107


 Score = 37.7 bits (86),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQ  633
            LA+LKM+AD++ +GRVY MD+Q
Sbjct  103  LAMLKMVADESGRGRVYGMDIQ  124



>ref|XP_011007213.1| PREDICTED: uncharacterized protein LOC105112966 isoform X2 [Populus 
euphratica]
Length=266

 Score = 50.1 bits (118),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            +WK +V+ GDTVIDATCGNG+DTL ++K
Sbjct  80   IWKRVVQNGDTVIDATCGNGYDTLAMLK  107


 Score = 37.7 bits (86),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQ  633
            LA+LKM+AD++ +GRVY MD+Q
Sbjct  103  LAMLKMVADESGRGRVYGMDIQ  124



>ref|XP_011007215.1| PREDICTED: uncharacterized protein LOC105112966 isoform X4 [Populus 
euphratica]
 ref|XP_011007216.1| PREDICTED: uncharacterized protein LOC105112966 isoform X4 [Populus 
euphratica]
Length=234

 Score = 49.7 bits (117),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            +WK +V+ GDTVIDATCGNG+DTL ++K
Sbjct  80   IWKRVVQNGDTVIDATCGNGYDTLAMLK  107


 Score = 37.7 bits (86),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQ  633
            LA+LKM+AD++ +GRVY MD+Q
Sbjct  103  LAMLKMVADESGRGRVYGMDIQ  124



>ref|XP_011007212.1| PREDICTED: uncharacterized protein LOC105112966 isoform X1 [Populus 
euphratica]
Length=270

 Score = 49.7 bits (117),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            +WK +V+ GDTVIDATCGNG+DTL ++K
Sbjct  80   IWKRVVQNGDTVIDATCGNGYDTLAMLK  107


 Score = 37.7 bits (86),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQ  633
            LA+LKM+AD++ +GRVY MD+Q
Sbjct  103  LAMLKMVADESGRGRVYGMDIQ  124



>ref|XP_006416817.1| hypothetical protein EUTSA_v10008448mg [Eutrema salsugineum]
 gb|ESQ35170.1| hypothetical protein EUTSA_v10008448mg [Eutrema salsugineum]
Length=274

 Score = 47.0 bits (110),  Expect(3) = 6e-09, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ I+++GD V+DATCGNG+DTL ++K
Sbjct  90   VWEQIIQKGDVVVDATCGNGNDTLAMLK  117


 Score = 33.5 bits (75),  Expect(3) = 6e-09, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 2/27 (7%)
 Frame = +1

Query  568  LALLKMIADDTRK--GRVYAMDVQKVA  642
            LA+LKM+ DD+    G VYAMD+QK A
Sbjct  113  LAMLKMVTDDSNGYGGHVYAMDIQKDA  139


 Score = 26.2 bits (56),  Expect(3) = 6e-09, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + Y+ G+++AT VAH
Sbjct  68   GLEDVFVGYLFGRKKATEVAH  88



>ref|XP_002310087.2| hypothetical protein POPTR_0007s08000g [Populus trichocarpa]
 gb|EEE90537.2| hypothetical protein POPTR_0007s08000g [Populus trichocarpa]
Length=266

 Score = 50.1 bits (118),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            +WK +V+ GDTVIDATCGNG+DTL ++K
Sbjct  80   IWKRVVQNGDTVIDATCGNGYDTLAMLK  107


 Score = 37.0 bits (84),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQ  633
            LA+LKM+AD+  +GRVY MD+Q
Sbjct  103  LAMLKMVADELGRGRVYGMDIQ  124



>gb|EMT21418.1| hypothetical protein F775_12615 [Aegilops tauschii]
Length=258

 Score = 46.2 bits (108),  Expect(3) = 7e-09, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  495  SVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            +VW+ IV++GD V+DATCGNG+DT  ++K
Sbjct  80   AVWRSIVQKGDAVVDATCGNGNDTFALLK  108


 Score = 38.9 bits (89),  Expect(3) = 7e-09, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  571  ALLKMIADDTRKGRVYAMDVQKVA  642
            ALLKM++DDT +GRVY MD+Q  A
Sbjct  105  ALLKMVSDDTGRGRVYGMDIQDSA  128


 Score = 21.2 bits (43),  Expect(3) = 7e-09, Method: Compositional matrix adjust.
 Identities = 7/14 (50%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = +2

Query  452  YICGQRRATLVAHS  493
            ++ G+R+AT VAH+
Sbjct  67   FVTGKRKATEVAHA  80



>gb|KFK43854.1| hypothetical protein AALP_AA1G182300 [Arabis alpina]
Length=231

 Score = 45.1 bits (105),  Expect(3) = 9e-09, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ ++++GD V+DATCGNG+DTL ++K
Sbjct  48   VWEQVIQKGDLVVDATCGNGNDTLAMLK  75


 Score = 32.7 bits (73),  Expect(3) = 9e-09, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 2/27 (7%)
 Frame = +1

Query  568  LALLKMIADDTRK--GRVYAMDVQKVA  642
            LA+LKM+ DD+    G VYAMD+QK A
Sbjct  71   LAMLKMVLDDSDACGGHVYAMDIQKDA  97


 Score = 28.5 bits (62),  Expect(3) = 9e-09, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+EGV + Y+ G+++AT VAH
Sbjct  26   GLEGVFLGYLFGRKKATEVAH  46



>gb|ADE77832.1| unknown [Picea sitchensis]
Length=187

 Score = 53.1 bits (126),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  486  LIRSVWKHIVREGDTVIDATCGNGHDTLGIIKNDC  590
            LI  VW+H+VR GD VIDATCGNGHDTL + K  C
Sbjct  3    LICRVWRHVVRGGDFVIDATCGNGHDTLALAKMVC  37


 Score = 33.5 bits (75),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LAL KM+  ++RKG +Y MDVQ+ A
Sbjct  30   LALAKMVCTESRKGLIYGMDVQQSA  54



>ref|XP_010459185.1| PREDICTED: uncharacterized protein LOC104740331 isoform X1 [Camelina 
sativa]
Length=278

 Score = 46.6 bits (109),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ ++++GD VIDATCGNG+DTL ++K
Sbjct  96   VWEKVIKKGDMVIDATCGNGNDTLAMLK  123


 Score = 33.1 bits (74),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LKM+ DD+  G VYAMD+QK A
Sbjct  119  LAMLKMVMDDS-GGYVYAMDIQKDA  142


 Score = 26.2 bits (56),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + Y+ G+++AT VAH
Sbjct  74   GLEDVFVGYLFGKKKATEVAH  94



>ref|XP_010459187.1| PREDICTED: uncharacterized protein LOC104740331 isoform X2 [Camelina 
sativa]
Length=272

 Score = 46.6 bits (109),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ ++++GD VIDATCGNG+DTL ++K
Sbjct  90   VWEKVIKKGDMVIDATCGNGNDTLAMLK  117


 Score = 32.7 bits (73),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LA+LKM+ DD+  G VYAMD+QK A
Sbjct  113  LAMLKMVMDDS-GGYVYAMDIQKDA  136


 Score = 26.2 bits (56),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + Y+ G+++AT VAH
Sbjct  68   GLEDVFVGYLFGKKKATEVAH  88



>gb|EMS64750.1| hypothetical protein TRIUR3_01018 [Triticum urartu]
Length=209

 Score = 47.4 bits (111),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ IV+ GDTV+DATCGNG+DT  ++K
Sbjct  18   VWRSIVQRGDTVVDATCGNGNDTFALLK  45


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +1

Query  571  ALLKMIADDTRKGRVYAMDVQKVA  642
            ALLKM++DDT +GRVY MD+Q  A
Sbjct  42   ALLKMVSDDTGRGRVYGMDIQDSA  65



>emb|CDX81763.1| BnaC08g38380D [Brassica napus]
Length=275

 Score = 46.6 bits (109),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ ++++GD VIDATCGNG+DTL ++K
Sbjct  91   VWEQVIQKGDMVIDATCGNGNDTLAMLK  118


 Score = 31.6 bits (70),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 2/27 (7%)
 Frame = +1

Query  568  LALLKMIADDTR--KGRVYAMDVQKVA  642
            LA+LKM+ DD+    G VYAMDVQK A
Sbjct  114  LAMLKMVTDDSDYFGGCVYAMDVQKDA  140


 Score = 26.9 bits (58),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            GVE V + Y+ G+++AT VAH
Sbjct  69   GVEDVFVGYLFGRKKATEVAH  89



>ref|XP_010497853.1| PREDICTED: uncharacterized protein LOC104775557 [Camelina sativa]
Length=275

 Score = 46.2 bits (108),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ ++++GD VIDATCGNG+DTL ++K
Sbjct  91   VWEKVIQKGDMVIDATCGNGNDTLAMLK  118


 Score = 32.3 bits (72),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 20/26 (77%), Gaps = 1/26 (4%)
 Frame = +1

Query  568  LALLKMIADDTRKG-RVYAMDVQKVA  642
            LA+LKM+ DD+  G  VYAMD+QK A
Sbjct  114  LAMLKMVMDDSVSGGYVYAMDIQKDA  139


 Score = 26.2 bits (56),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + Y+ G+++AT VAH
Sbjct  69   GLEDVFVGYLFGRKKATEVAH  89



>gb|KHG00676.1| Putative rRNA methylase ytqB [Gossypium arboreum]
Length=244

 Score = 45.8 bits (107),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+H++ +GD VIDATCGNG+DT+ ++K
Sbjct  64   VWRHVLHKGDIVIDATCGNGYDTVAMLK  91


 Score = 34.3 bits (77),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            +A+LKM+AD++  GRVY +D+Q  A
Sbjct  87   VAMLKMVADESGHGRVYGIDIQTEA  111


 Score = 24.6 bits (52),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E  ++ YI G+++AT VAH
Sbjct  42   GLEDELVGYIFGKKKATEVAH  62



>gb|KJB81384.1| hypothetical protein B456_013G1424002, partial [Gossypium raimondii]
Length=162

 Score = 46.2 bits (108),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+H++ +GD VIDATCGNG+DT+ ++K
Sbjct  75   VWRHVLHKGDIVIDATCGNGYDTVAMLK  102


 Score = 33.1 bits (74),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            +A+LKM+AD++  G VY MD+Q  A
Sbjct  98   VAMLKMVADESGHGHVYGMDIQTEA  122


 Score = 25.0 bits (53),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E  ++ YI G+++AT VAH
Sbjct  53   GLEDELVGYIFGKKKATEVAH  73



>gb|KDO61598.1| hypothetical protein CISIN_1g041272mg [Citrus sinensis]
Length=267

 Score = 54.7 bits (130),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  462  VKGEPLSLLIRSVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            + G  +++    VWKH+VR+GDTV+DATCGNG+DTL ++K
Sbjct  75   LSGTLITIAANGVWKHVVRKGDTVVDATCGNGYDTLMMLK  114


 Score = 30.0 bits (66),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            L +LKM+AD++  G VY +D+Q  A
Sbjct  110  LMMLKMVADESSAGCVYGLDIQSEA  134



>ref|XP_010476756.1| PREDICTED: uncharacterized protein LOC104755966 [Camelina sativa]
Length=265

 Score = 45.8 bits (107),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ ++++GD VIDATCGNG+DTL ++K
Sbjct  81   VWEKVIQKGDMVIDATCGNGNDTLAMLK  108


 Score = 32.0 bits (71),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 20/26 (77%), Gaps = 1/26 (4%)
 Frame = +1

Query  568  LALLKMIADDTRKGR-VYAMDVQKVA  642
            LA+LKM+ DD+  G  VYAMD+QK A
Sbjct  104  LAMLKMVMDDSISGGCVYAMDIQKDA  129


 Score = 26.2 bits (56),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + Y+ G+++AT VAH
Sbjct  59   GLEDVFIGYLFGRKKATEVAH  79



>ref|XP_010669993.1| PREDICTED: uncharacterized protein LOC104887102 [Beta vulgaris 
subsp. vulgaris]
Length=276

 Score = 45.4 bits (106),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ +V++GDTV+DATCGNG+DTL + K
Sbjct  96   VWELVVQKGDTVVDATCGNGNDTLALSK  123


 Score = 30.4 bits (67),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            LAL K++ DD  +G +YA+DVQ+ A
Sbjct  119  LALSKLVIDDLAEGCIYALDVQEDA  143


 Score = 28.1 bits (61),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            GV+ V+  Y+ GQ++AT VAH
Sbjct  74   GVDDVLKGYLFGQKKATEVAH  94



>ref|XP_006493792.1| PREDICTED: uncharacterized protein LOC102612041 isoform X2 [Citrus 
sinensis]
Length=227

 Score = 54.3 bits (129),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  489  IRSVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            I  VWKH+VR+GDTV+DATCGNG+DTL ++K
Sbjct  44   IHRVWKHVVRKGDTVVDATCGNGYDTLMMLK  74


 Score = 29.6 bits (65),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            L +LKM+AD++  G VY +D+Q  A
Sbjct  70   LMMLKMVADESSAGCVYGLDIQSEA  94



>ref|XP_002890167.1| hypothetical protein ARALYDRAFT_471841 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66426.1| hypothetical protein ARALYDRAFT_471841 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score = 46.6 bits (109),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ ++++GD VIDATCGNG+DTL ++K
Sbjct  90   VWEQVIQKGDMVIDATCGNGNDTLAMLK  117


 Score = 29.6 bits (65),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 20/27 (74%), Gaps = 2/27 (7%)
 Frame = +1

Query  568  LALLKMIADDTRK--GRVYAMDVQKVA  642
            LA+LKM+ +D+    G VYAMD+QK A
Sbjct  113  LAMLKMVMNDSVGCGGYVYAMDIQKDA  139


 Score = 26.6 bits (57),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            GVE V + Y+ G+++AT VAH
Sbjct  68   GVEDVFVGYLFGRKKATEVAH  88



>ref|NP_683312.2| S-adenosyl-L-methionine-dependent methyltransferase domain-containing 
protein [Arabidopsis thaliana]
 gb|AAN86149.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29452.1| S-adenosyl-L-methionine-dependent methyltransferase domain-containing 
protein [Arabidopsis thaliana]
Length=274

 Score = 48.1 bits (113),  Expect(3) = 9e-08, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ ++++GDTVIDATCGNG+DTL ++K
Sbjct  90   VWEQVIQKGDTVIDATCGNGNDTLAMLK  117


 Score = 28.9 bits (63),  Expect(3) = 9e-08, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 2/27 (7%)
 Frame = +1

Query  568  LALLKMIADDTRK--GRVYAMDVQKVA  642
            LA+LKM+  D+    G VYAMD+QK A
Sbjct  113  LAMLKMVMHDSVGCGGYVYAMDIQKDA  139


 Score = 25.4 bits (54),  Expect(3) = 9e-08, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + Y+ G+++AT VAH
Sbjct  68   GLEDVFVGYLFGRKKATEVAH  88



>gb|KJB81385.1| hypothetical protein B456_013G1424002, partial [Gossypium raimondii]
 gb|KJB81386.1| hypothetical protein B456_013G1424002, partial [Gossypium raimondii]
Length=108

 Score = 47.0 bits (110),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  486  LIRSVWKHIVREGDTVIDATCGNGHDTLGIIK  581
            LI  VW+H++ +GD VIDATCGNG+DT+ ++K
Sbjct  17   LICRVWRHVLHKGDIVIDATCGNGYDTVAMLK  48


 Score = 32.7 bits (73),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            +A+LKM+AD++  G VY MD+Q  A
Sbjct  44   VAMLKMVADESGHGHVYGMDIQTEA  68



>ref|XP_002263914.3| PREDICTED: uncharacterized protein LOC100252956 [Vitis vinifera]
 emb|CBI24188.3| unnamed protein product [Vitis vinifera]
Length=259

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWKH+V++GDTV+DATCGNG+DTL ++K
Sbjct  79   VWKHVVQKGDTVVDATCGNGYDTLAMLK  106



>emb|CAN63608.1| hypothetical protein VITISV_019132 [Vitis vinifera]
Length=285

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VWKH+V++GDTV+DATCGNG+DTL ++K
Sbjct  79   VWKHVVQKGDTVVDATCGNGYDTLAMLK  106



>ref|XP_002975185.1| hypothetical protein SELMODRAFT_57713, partial [Selaginella moellendorffii]
 gb|EFJ23970.1| hypothetical protein SELMODRAFT_57713, partial [Selaginella moellendorffii]
Length=184

 Score = 48.5 bits (114),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  486  LIRSVWKHIVREGDTVIDATCGNGHDTL  569
            L RSVWK IVR GDTV+D TCGNG DTL
Sbjct  1    LARSVWKRIVRPGDTVVDTTCGNGIDTL  28


 Score = 24.6 bits (52),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = +1

Query  568  LALLKMIADDTRKGRVYAMDVQKVA  642
            L L ++++  +  GRVY  D+QK A
Sbjct  28   LLLARLVSPGSLLGRVYGFDIQKEA  52



>emb|CDY51003.1| BnaA09g56320D [Brassica napus]
Length=275

 Score = 46.6 bits (109),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ ++++GD VIDATCGNG+DTL ++K
Sbjct  91   VWEQVIQKGDMVIDATCGNGNDTLAMLK  118


 Score = 26.2 bits (56),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + Y+ G+++AT VAH
Sbjct  69   GIEDVFVGYLFGRKKATEVAH  89



>ref|XP_009117765.1| PREDICTED: uncharacterized protein LOC103842850 [Brassica rapa]
Length=275

 Score = 46.6 bits (109),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  498  VWKHIVREGDTVIDATCGNGHDTLGIIK  581
            VW+ ++++GD VIDATCGNG+DTL ++K
Sbjct  91   VWEQVIQKGDMVIDATCGNGNDTLAMLK  118


 Score = 26.2 bits (56),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  428  GVEGVMMEYICGQRRATLVAH  490
            G+E V + Y+ G+++AT VAH
Sbjct  69   GIEDVFVGYLFGRKKATEVAH  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375