BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G07

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011028654.1|  PREDICTED: coatomer subunit alpha-1                261   4e-77   Populus euphratica
ref|XP_008802787.1|  PREDICTED: coatomer subunit alpha-1                256   3e-75   Phoenix dactylifera
ref|XP_010096174.1|  Coatomer subunit alpha-1                           255   4e-75   
ref|XP_002957821.1|  hypothetical protein VOLCADRAFT_77684              254   6e-75   Volvox carteri f. nagariensis
ref|XP_001693686.1|  alpha-COP                                          254   2e-74   Chlamydomonas reinhardtii
gb|KCW64034.1|  hypothetical protein EUGRSUZ_G017081                    234   6e-74   Eucalyptus grandis [rose gum]
ref|XP_005651719.1|  Coatomer, alpha subunit                            252   7e-74   Coccomyxa subellipsoidea C-169
ref|XP_002321558.1|  coatomer alpha subunit-like family protein         249   7e-73   
ref|XP_011042648.1|  PREDICTED: coatomer subunit alpha-1-like iso...    249   8e-73   Populus euphratica
ref|XP_011074632.1|  PREDICTED: coatomer subunit alpha-1-like           249   9e-73   Sesamum indicum [beniseed]
ref|XP_007017678.1|  Coatomer, alpha subunit                            248   9e-73   
ref|XP_002318013.1|  coatomer alpha subunit-like family protein         248   9e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011042646.1|  PREDICTED: coatomer subunit alpha-1-like iso...    248   9e-73   Populus euphratica
gb|EYU36749.1|  hypothetical protein MIMGU_mgv1a000357mg                248   1e-72   Erythranthe guttata [common monkey flower]
gb|KDO49492.1|  hypothetical protein CISIN_1g000933mg                   246   1e-72   Citrus sinensis [apfelsine]
ref|XP_006341999.1|  PREDICTED: coatomer subunit alpha-1-like           248   1e-72   Solanum tuberosum [potatoes]
ref|XP_004238316.1|  PREDICTED: coatomer subunit alpha-1                248   1e-72   Solanum lycopersicum
gb|KDO49489.1|  hypothetical protein CISIN_1g000933mg                   248   1e-72   Citrus sinensis [apfelsine]
emb|CDP07449.1|  unnamed protein product                                248   1e-72   Coffea canephora [robusta coffee]
gb|KDP41738.1|  hypothetical protein JCGZ_26756                         248   1e-72   Jatropha curcas
ref|XP_009598989.1|  PREDICTED: coatomer subunit alpha-1-like           248   1e-72   Nicotiana tomentosiformis
ref|XP_006487332.1|  PREDICTED: coatomer subunit alpha-2-like iso...    248   1e-72   Citrus sinensis [apfelsine]
ref|XP_002512969.1|  coatomer alpha subunit, putative                   248   1e-72   Ricinus communis
gb|KDO49490.1|  hypothetical protein CISIN_1g000933mg                   248   1e-72   Citrus sinensis [apfelsine]
ref|XP_006423409.1|  hypothetical protein CICLE_v10027697mg             248   1e-72   Citrus clementina [clementine]
ref|XP_011083895.1|  PREDICTED: coatomer subunit alpha-1-like           248   1e-72   
gb|EYU32877.1|  hypothetical protein MIMGU_mgv1a000353mg                248   2e-72   Erythranthe guttata [common monkey flower]
ref|XP_009790884.1|  PREDICTED: coatomer subunit alpha-1-like           248   2e-72   Nicotiana sylvestris
ref|XP_008240283.1|  PREDICTED: coatomer subunit alpha-1                248   2e-72   Prunus mume [ume]
ref|XP_007210424.1|  hypothetical protein PRUPE_ppa000386mg             248   2e-72   Prunus persica
gb|EAZ08188.1|  hypothetical protein OsI_30447                          248   2e-72   Oryza sativa Indica Group [Indian rice]
ref|NP_001062612.1|  Os09g0127800                                       248   2e-72   
ref|XP_009794496.1|  PREDICTED: coatomer subunit alpha-1-like           248   2e-72   Nicotiana sylvestris
ref|XP_004982004.1|  PREDICTED: coatomer subunit alpha-3-like           248   2e-72   Setaria italica
ref|XP_009599251.1|  PREDICTED: coatomer subunit alpha-1-like           247   3e-72   Nicotiana tomentosiformis
ref|XP_008644216.1|  PREDICTED: uncharacterized protein LOC100502...    247   3e-72   Zea mays [maize]
gb|KGN61838.1|  hypothetical protein Csa_2G249920                       240   3e-72   Cucumis sativus [cucumbers]
ref|XP_008393301.1|  PREDICTED: coatomer subunit alpha-1-like           247   4e-72   
ref|XP_008225617.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    246   4e-72   Prunus mume [ume]
ref|XP_007213296.1|  hypothetical protein PRUPE_ppa000388mg             246   5e-72   Prunus persica
ref|XP_008448067.1|  PREDICTED: coatomer subunit alpha-1                246   5e-72   Cucumis melo [Oriental melon]
ref|XP_004293978.1|  PREDICTED: coatomer subunit alpha-1-like           246   5e-72   Fragaria vesca subsp. vesca
ref|XP_004300535.1|  PREDICTED: coatomer subunit alpha-1-like           246   5e-72   Fragaria vesca subsp. vesca
ref|XP_010263850.1|  PREDICTED: coatomer subunit alpha-1                246   6e-72   Nelumbo nucifera [Indian lotus]
ref|XP_004150072.1|  PREDICTED: coatomer subunit alpha-1-like           242   6e-72   
gb|EPS65879.1|  hypothetical protein M569_08896                         246   7e-72   Genlisea aurea
emb|CBI19788.3|  unnamed protein product                                245   7e-72   Vitis vinifera
ref|XP_006356758.1|  PREDICTED: coatomer subunit alpha-1-like           246   7e-72   
ref|XP_004243143.1|  PREDICTED: coatomer subunit alpha-1-like           246   7e-72   Solanum lycopersicum
ref|XP_009346991.1|  PREDICTED: coatomer subunit alpha-2-like           246   8e-72   Pyrus x bretschneideri [bai li]
ref|XP_004148533.1|  PREDICTED: coatomer subunit alpha-1-like           246   8e-72   Cucumis sativus [cucumbers]
ref|XP_002501894.1|  coatomer protein complex                           246   9e-72   Micromonas commoda
ref|XP_002279779.1|  PREDICTED: coatomer subunit alpha-1                246   9e-72   Vitis vinifera
ref|XP_010271512.1|  PREDICTED: coatomer subunit alpha-1-like           245   1e-71   Nelumbo nucifera [Indian lotus]
ref|XP_008374746.1|  PREDICTED: coatomer subunit alpha-1-like           245   1e-71   Malus domestica [apple tree]
ref|XP_008460997.1|  PREDICTED: coatomer subunit alpha-1-like           245   1e-71   Cucumis melo [Oriental melon]
ref|XP_004165124.1|  PREDICTED: coatomer subunit alpha-1-like           243   2e-71   
ref|XP_010555274.1|  PREDICTED: coatomer subunit alpha-1-like           245   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_008461000.1|  PREDICTED: coatomer subunit alpha-1-like           245   2e-71   Cucumis melo [Oriental melon]
ref|XP_010690807.1|  PREDICTED: coatomer subunit alpha-1                245   2e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006828935.1|  hypothetical protein AMTR_s00001p00220200          245   2e-71   Amborella trichopoda
gb|KGN61837.1|  hypothetical protein Csa_2G249910                       244   3e-71   Cucumis sativus [cucumbers]
ref|XP_003057643.1|  predicted protein                                  244   3e-71   Micromonas pusilla CCMP1545
ref|XP_010526595.1|  PREDICTED: coatomer subunit alpha-1                244   3e-71   Tarenaya hassleriana [spider flower]
ref|XP_004165122.1|  PREDICTED: coatomer subunit alpha-1-like           244   4e-71   
ref|XP_010109755.1|  hypothetical protein L484_008431                   244   4e-71   Morus notabilis
ref|XP_008346150.1|  PREDICTED: coatomer subunit alpha-1-like           244   4e-71   
ref|XP_004150060.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    244   4e-71   
ref|XP_009362204.1|  PREDICTED: coatomer subunit alpha-1-like           244   4e-71   Pyrus x bretschneideri [bai li]
sp|Q9AUR7.1|COPA2_ORYSJ  RecName: Full=Coatomer subunit alpha-2; ...    244   4e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010919610.1|  PREDICTED: coatomer subunit alpha-1                244   5e-71   
ref|XP_010933643.1|  PREDICTED: coatomer subunit alpha-1-like           244   5e-71   
ref|XP_011398207.1|  Coatomer subunit alpha-2                           242   7e-71   Auxenochlorella protothecoides
ref|XP_004507488.1|  PREDICTED: coatomer subunit alpha-1-like iso...    243   8e-71   
ref|XP_007042068.1|  Coatomer, alpha subunit                            243   8e-71   
ref|XP_010933642.1|  PREDICTED: coatomer subunit alpha-1-like           243   8e-71   Elaeis guineensis
gb|KJB47565.1|  hypothetical protein B456_008G031400                    243   8e-71   Gossypium raimondii
ref|XP_007042069.1|  Coatomer, alpha subunit                            243   9e-71   
ref|XP_003540979.1|  PREDICTED: coatomer subunit alpha-2-like iso...    243   9e-71   Glycine max [soybeans]
gb|KHN25415.1|  Coatomer subunit alpha-2                                243   9e-71   Glycine soja [wild soybean]
gb|KHG21379.1|  hypothetical protein F383_26788                         243   1e-70   Gossypium arboreum [tree cotton]
ref|XP_002529504.1|  coatomer alpha subunit, putative                   243   1e-70   
gb|KJB32566.1|  hypothetical protein B456_005G247300                    243   1e-70   Gossypium raimondii
ref|XP_008383465.1|  PREDICTED: coatomer subunit alpha-1-like           241   1e-70   
ref|XP_007131781.1|  hypothetical protein PHAVU_011G041000g             243   1e-70   Phaseolus vulgaris [French bean]
gb|KJB32563.1|  hypothetical protein B456_005G247200                    243   1e-70   Gossypium raimondii
ref|XP_003537852.1|  PREDICTED: coatomer subunit alpha-2-like           243   1e-70   Glycine max [soybeans]
gb|KHN39822.1|  Coatomer subunit alpha-1                                242   2e-70   Glycine soja [wild soybean]
gb|KHG26300.1|  hypothetical protein F383_08243                         242   2e-70   Gossypium arboreum [tree cotton]
gb|KHG24640.1|  hypothetical protein F383_03247                         242   2e-70   Gossypium arboreum [tree cotton]
ref|XP_008365997.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    239   2e-70   
emb|CDY61804.1|  BnaC03g76410D                                          233   2e-70   Brassica napus [oilseed rape]
ref|XP_001417203.1|  predicted protein                                  242   2e-70   Ostreococcus lucimarinus CCE9901
gb|KJB32565.1|  hypothetical protein B456_005G247300                    242   2e-70   Gossypium raimondii
gb|AAS58474.1|  coatomer alpha subunit                                  242   2e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009388919.1|  PREDICTED: coatomer subunit alpha-1-like           242   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAE45585.1|  coatomer alpha subunit-like protein                    242   2e-70   Lotus japonicus
ref|XP_009407817.1|  PREDICTED: coatomer subunit alpha-3-like           242   3e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006300379.1|  hypothetical protein CARUB_v10019676mg             242   3e-70   Capsella rubella
gb|KJB77745.1|  hypothetical protein B456_012G154500                    239   3e-70   Gossypium raimondii
ref|XP_008349149.1|  PREDICTED: coatomer subunit alpha-1-like           241   4e-70   
gb|KDD75879.1|  hypothetical protein H632_c457p0                        227   4e-70   Helicosporidium sp. ATCC 50920
ref|XP_005851353.1|  hypothetical protein CHLNCDRAFT_137537             237   4e-70   Chlorella variabilis
gb|KJB47562.1|  hypothetical protein B456_008G031300                    240   4e-70   Gossypium raimondii
gb|KJB77746.1|  hypothetical protein B456_012G154500                    241   4e-70   Gossypium raimondii
gb|KJB47564.1|  hypothetical protein B456_008G031300                    241   4e-70   Gossypium raimondii
ref|XP_010066199.1|  PREDICTED: coatomer subunit alpha-1                241   4e-70   Eucalyptus grandis [rose gum]
ref|XP_003607006.1|  Coatomer alpha subunit-like protein                241   5e-70   
ref|XP_009400896.1|  PREDICTED: coatomer subunit alpha-3                241   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007508098.1|  predicted protein                                  241   5e-70   Bathycoccus prasinos
ref|XP_002878550.1|  hypothetical protein ARALYDRAFT_900556             241   5e-70   
ref|XP_002888041.1|  hypothetical protein ARALYDRAFT_475134             241   6e-70   Arabidopsis lyrata subsp. lyrata
ref|NP_176393.1|  coatomer subunit alpha-1                              241   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411704.1|  hypothetical protein EUTSA_v10024240mg             240   8e-70   Eutrema salsugineum [saltwater cress]
gb|KEH43347.1|  coatomer subunit alpha-like protein                     240   1e-69   Medicago truncatula
ref|XP_004496148.1|  PREDICTED: coatomer subunit alpha-1-like           240   1e-69   
ref|XP_010672358.1|  PREDICTED: coatomer subunit alpha-2-like           240   1e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007144262.1|  hypothetical protein PHAVU_007G141700g             240   1e-69   Phaseolus vulgaris [French bean]
ref|XP_001771211.1|  predicted protein                                  239   1e-69   
ref|XP_003536291.1|  PREDICTED: coatomer subunit alpha-1-like           239   2e-69   Glycine max [soybeans]
gb|KHN37868.1|  Coatomer subunit alpha-1                                239   2e-69   Glycine soja [wild soybean]
ref|XP_003556297.1|  PREDICTED: coatomer subunit alpha-2-like           239   2e-69   Glycine max [soybeans]
gb|KHN00939.1|  Coatomer subunit alpha-1                                239   2e-69   Glycine soja [wild soybean]
ref|XP_010066202.1|  PREDICTED: coatomer subunit alpha-2-like           239   2e-69   Eucalyptus grandis [rose gum]
ref|XP_001753855.1|  predicted protein                                  239   2e-69   
ref|XP_010531460.1|  PREDICTED: coatomer subunit alpha-1-like           239   2e-69   
ref|XP_010429041.1|  PREDICTED: coatomer subunit alpha-2-like           239   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010429048.1|  PREDICTED: coatomer subunit alpha-2                239   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010472129.1|  PREDICTED: coatomer subunit alpha-2-like           238   3e-69   
ref|XP_010416888.1|  PREDICTED: coatomer subunit alpha-2-like           239   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006293578.1|  hypothetical protein CARUB_v10022525mg             239   4e-69   Capsella rubella
ref|NP_179734.1|  coatomer subunit alpha-2                              238   4e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CEF97511.1|  Coatomer, alpha subunit, C-terminal                    238   4e-69   Ostreococcus tauri
ref|XP_003567287.2|  PREDICTED: coatomer subunit alpha-1-like           223   6e-69   Brachypodium distachyon [annual false brome]
gb|EMS45609.1|  Coatomer subunit alpha-3                                238   7e-69   Triticum urartu
ref|XP_006404585.1|  hypothetical protein EUTSA_v10000016mg             238   9e-69   
ref|XP_002966115.1|  hypothetical protein SELMODRAFT_85610              237   9e-69   
gb|EMT27309.1|  Coatomer subunit alpha-3                                237   1e-68   
ref|XP_002982185.1|  hypothetical protein SELMODRAFT_154977             237   1e-68   
ref|XP_010430239.1|  PREDICTED: coatomer subunit alpha-1                237   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_001766709.1|  predicted protein                                  237   1e-68   
gb|ACN31006.1|  unknown                                                 221   2e-68   Zea mays [maize]
emb|CDY42637.1|  BnaC01g00490D                                          235   2e-68   Brassica napus [oilseed rape]
emb|CDX90339.1|  BnaA08g16450D                                          234   2e-68   
emb|CDY53172.1|  BnaA06g40510D                                          234   3e-68   Brassica napus [oilseed rape]
emb|CDY41989.1|  BnaA01g05610D                                          234   3e-68   Brassica napus [oilseed rape]
ref|XP_005710742.1|  Coatomer subunit alpha, WD40 repeat-containi...    236   3e-68   Chondrus crispus [carageen]
ref|XP_009397879.1|  PREDICTED: coatomer subunit alpha-3-like           236   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009101857.1|  PREDICTED: coatomer subunit alpha-2-like           236   3e-68   Brassica rapa
ref|XP_008646256.1|  PREDICTED: uncharacterized protein LOC100384...    236   3e-68   Zea mays [maize]
tpg|DAA52914.1|  TPA: hypothetical protein ZEAMMB73_412502              220   3e-68   
ref|XP_002466586.1|  hypothetical protein SORBIDRAFT_01g010390          236   3e-68   Sorghum bicolor [broomcorn]
ref|NP_001051056.1|  Os03g0711400                                       236   4e-68   
ref|XP_005759442.1|  COPA1, alpha subunit of the coatomer               236   5e-68   Emiliania huxleyi CCMP1516
ref|XP_009101859.1|  PREDICTED: coatomer subunit alpha-2                236   5e-68   Brassica rapa
emb|CDY53168.1|  BnaA06g40470D                                          235   5e-68   Brassica napus [oilseed rape]
ref|XP_009109461.1|  PREDICTED: coatomer subunit alpha-2-like           236   5e-68   Brassica rapa
ref|XP_006743501.1|  PREDICTED: coatomer subunit alpha-like             233   5e-68   Leptonychotes weddellii
ref|XP_006411687.1|  hypothetical protein EUTSA_v10024239mg             235   6e-68   Eutrema salsugineum [saltwater cress]
ref|XP_003523472.1|  PREDICTED: coatomer subunit alpha-1-like iso...    235   6e-68   Glycine max [soybeans]
dbj|BAE42571.1|  unnamed protein product                                215   9e-68   Mus musculus [mouse]
gb|EPS70817.1|  hypothetical protein M569_03938                         234   1e-67   Genlisea aurea
ref|XP_009526440.1|  hypothetical protein PHYSODRAFT_545018             234   2e-67   Phytophthora sojae
gb|EWM26143.1|  Coatomer, WD associated region                          234   2e-67   Nannochloropsis gaditana
ref|XP_008610604.1|  coatomer protein complex, subunit alpha (xenin)    234   2e-67   Saprolegnia diclina VS20
ref|XP_002896974.1|  coatomer protein complex, putative                 234   3e-67   Phytophthora infestans T30-4
ref|XP_008892963.1|  hypothetical protein PPTG_01415                    234   3e-67   Phytophthora parasitica INRA-310
gb|ETM45336.1|  hypothetical protein L914_09580                         234   3e-67   Phytophthora parasitica
gb|ETL92039.1|  hypothetical protein L917_09539                         234   3e-67   Phytophthora parasitica
gb|ETK85490.1|  hypothetical protein L915_09709                         234   3e-67   Phytophthora parasitica
gb|ETP15371.1|  hypothetical protein F441_09860                         233   3e-67   Phytophthora parasitica CJ01A1
gb|ETI45564.1|  hypothetical protein F443_09913                         233   3e-67   Phytophthora parasitica P1569
ref|XP_009400691.1|  PREDICTED: coatomer subunit alpha-3-like           233   3e-67   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBN77093.1|  Vesicle coat complex COPI, alpha subunit               233   5e-67   Ectocarpus siliculosus
ref|XP_006650487.1|  PREDICTED: coatomer subunit alpha-3-like           232   8e-67   Oryza brachyantha
ref|XP_010229358.1|  PREDICTED: coatomer subunit alpha-3                232   9e-67   Brachypodium distachyon [annual false brome]
emb|CDY13820.1|  BnaA09g43220D                                          223   9e-67   Brassica napus [oilseed rape]
ref|XP_004333061.1|  alphaCOP, putative                                 232   9e-67   Acanthamoeba castellanii str. Neff
ref|XP_002990232.1|  hypothetical protein SELMODRAFT_447957             231   1e-66   Selaginella moellendorffii
ref|XP_003564667.1|  PREDICTED: coatomer subunit alpha-3-like           231   2e-66   Brachypodium distachyon [annual false brome]
ref|XP_002455000.1|  hypothetical protein SORBIDRAFT_03g002780          230   2e-66   
ref|XP_002961902.1|  hypothetical protein SELMODRAFT_77651              231   2e-66   Selaginella moellendorffii
emb|CDX82024.1|  BnaC08g35770D                                          221   6e-66   
gb|AAI50356.1|  Copa protein                                            222   9e-66   Danio rerio [leopard danio]
ref|XP_005704483.1|  coatomer (COPI) alpha subunit                      229   2e-65   Galdieria sulphuraria
ref|XP_005768226.1|  COPA1, alpha subunit of the coatomer               225   2e-65   Emiliania huxleyi CCMP1516
emb|CDQ86226.1|  unnamed protein product                                220   3e-65   Oncorhynchus mykiss
gb|KDO30127.1|  hypothetical protein SPRG_19862                         226   4e-65   Saprolegnia parasitica CBS 223.65
ref|XP_008672096.1|  PREDICTED: uncharacterized protein LOC100192...    226   1e-64   
ref|XP_008544952.1|  PREDICTED: coatomer subunit alpha                  226   1e-64   Microplitis demolitor
dbj|BAE02266.1|  unnamed protein product                                221   2e-64   Macaca fascicularis [crab eating macaque]
ref|XP_002878551.1|  hypothetical protein ARALYDRAFT_900557             224   3e-64   
ref|XP_008862869.1|  hypothetical protein H310_01524                    225   3e-64   Aphanomyces invadans
emb|CDS11681.1|  hypothetical protein LRAMOSA03944                      225   3e-64   Lichtheimia ramosa
emb|CDH50700.1|  coatomer alpha subunit                                 225   4e-64   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_011172118.1|  PREDICTED: coatomer subunit alpha                  224   4e-64   Solenopsis invicta [imported red fire ant]
ref|XP_009821126.1|  hypothetical protein H257_00241                    224   5e-64   Aphanomyces astaci
emb|CDQ67339.1|  unnamed protein product                                224   7e-64   Oncorhynchus mykiss
ref|XP_010888093.1|  PREDICTED: coatomer subunit alpha                  224   7e-64   Esox lucius
ref|NP_001133825.1|  Coatomer subunit alpha                             224   8e-64   Salmo salar
gb|AAI62474.1|  Copa protein                                            223   9e-64   Danio rerio [leopard danio]
ref|XP_011345251.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    223   9e-64   
gb|EZA50399.1|  Coatomer subunit alpha                                  223   1e-63   Ooceraea biroi
ref|XP_007234429.1|  PREDICTED: coatomer subunit alpha-like             223   1e-63   
ref|NP_001001941.2|  coatomer subunit alpha                             223   1e-63   Danio rerio [leopard danio]
ref|XP_010750764.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    223   1e-63   
gb|AAQ63170.1|  coatomer protein complex subunit alpha                  223   1e-63   Danio rerio [leopard danio]
ref|XP_011298436.1|  PREDICTED: coatomer subunit alpha                  223   1e-63   Fopius arisanus
gb|EPB85739.1|  coatomer protein complex, subunit alpha (xenin)         223   1e-63   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_009117406.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    222   1e-63   Brassica rapa
ref|XP_623198.1|  PREDICTED: coatomer subunit alpha isoform 1           223   1e-63   Apis mellifera [bee]
ref|XP_006622894.1|  PREDICTED: coatomer subunit alpha-like             223   1e-63   Apis dorsata [rock honeybee]
ref|XP_005796611.1|  PREDICTED: coatomer subunit alpha-like isofo...    223   1e-63   Xiphophorus maculatus
ref|XP_004210494.1|  PREDICTED: coatomer subunit alpha-like             217   1e-63   
ref|XP_003978283.1|  PREDICTED: coatomer subunit alpha-like             223   1e-63   Takifugu rubripes [tiger puffer]
ref|XP_796805.3|  PREDICTED: coatomer subunit alpha-like                224   1e-63   
ref|XP_005796610.1|  PREDICTED: coatomer subunit alpha-like isofo...    223   1e-63   
ref|XP_008293242.1|  PREDICTED: coatomer subunit alpha                  223   1e-63   Stegastes partitus
ref|XP_009496181.1|  hypothetical protein H696_04035                    221   2e-63   Fonticula alba
ref|XP_008432228.1|  PREDICTED: coatomer subunit alpha                  223   2e-63   Poecilia reticulata
ref|XP_006792415.1|  PREDICTED: coatomer subunit alpha-like             223   2e-63   Neolamprologus brichardi [lyretail cichlid]
ref|NP_001166192.1|  coatomer protein complex subunit alpha             223   2e-63   Bombyx mori [silk moth]
ref|XP_007552064.1|  PREDICTED: coatomer subunit alpha                  223   2e-63   Poecilia formosa
ref|XP_004078629.1|  PREDICTED: coatomer subunit alpha                  223   2e-63   Oryzias latipes [Japanese rice fish]
ref|XP_003447511.1|  PREDICTED: coatomer subunit alpha-like             223   2e-63   Oreochromis niloticus
ref|XP_005918171.1|  PREDICTED: coatomer subunit alpha-like             223   2e-63   
ref|XP_004555248.1|  PREDICTED: coatomer subunit alpha-like             223   2e-63   Maylandia zebra
ref|XP_011269171.1|  PREDICTED: coatomer subunit alpha                  223   2e-63   Camponotus floridanus
ref|XP_005729030.1|  PREDICTED: coatomer subunit alpha-like isofo...    223   2e-63   Pundamilia nyererei
ref|XP_005729029.1|  PREDICTED: coatomer subunit alpha-like isofo...    223   2e-63   
ref|XP_006999128.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer pro...    222   2e-63   Peromyscus maniculatus bairdii
gb|KFB45492.1|  AGAP010251-PA-like protein                              223   2e-63   Anopheles sinensis
ref|XP_005368658.1|  PREDICTED: coatomer subunit alpha                  222   2e-63   
ref|XP_008152467.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_006096969.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_008494291.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Calypte anna
ref|XP_008152468.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Eptesicus fuscus
ref|XP_002801923.1|  PREDICTED: coatomer subunit alpha-like             222   3e-63   
ref|XP_005141102.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   Melopsittacus undulatus
ref|XP_004775909.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_006096970.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Myotis lucifugus
gb|EIE80782.1|  coatomer protein alpha subunit                          222   3e-63   Rhizopus delemar RA 99-880
ref|XP_011052978.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   Acromyrmex echinatior
ref|XP_004775910.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Mustela putorius furo [black ferret]
ref|XP_010562443.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   Haliaeetus leucocephalus
ref|XP_009080612.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   Acanthisitta chloris
ref|XP_006267538.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   Alligator mississippiensis
ref|XP_005233226.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_009474826.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   Nipponia nippon
ref|NP_001026576.1|  coatomer subunit alpha                             222   3e-63   Gallus gallus [bantam]
ref|XP_006001923.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Latimeria chalumnae
ref|XP_001861349.1|  coatomer subunit alpha                             222   3e-63   Culex quinquefasciatus
ref|XP_005233225.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   Falco peregrinus [peregrine]
ref|XP_003500327.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   Cricetulus griseus [Chinese hamsters]
ref|XP_008518689.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Equus przewalskii [Przewalski horse]
ref|XP_006861713.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Chrysochloris asiatica
ref|XP_006922956.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   Pteropus alecto
ref|XP_003213999.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   Meleagris gallopavo [common turkey]
dbj|BAG11074.1|  coatomer subunit alpha                                 222   3e-63   synthetic construct
ref|XP_006861712.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   Chrysochloris asiatica
ref|XP_004858771.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_001914764.2|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    222   3e-63   
ref|XP_006001922.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_009240111.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   Pongo abelii [orang utan]
ref|XP_006174003.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Camelus ferus
ref|XP_004442852.1|  PREDICTED: coatomer subunit alpha isoform 2        222   3e-63   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004027748.1|  PREDICTED: coatomer subunit alpha isoform 1        222   3e-63   
sp|Q27954.1|COPA_BOVIN  RecName: Full=Coatomer subunit alpha; Alt...    222   3e-63   Bos taurus [bovine]
ref|XP_001171574.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Pan troglodytes
ref|XP_004442851.1|  PREDICTED: coatomer subunit alpha isoform 1        222   3e-63   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_007945901.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Orycteropus afer afer
ref|XP_002715282.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   Oryctolagus cuniculus [domestic rabbit]
ref|XP_001928742.1|  PREDICTED: coatomer subunit alpha isoform 2        222   3e-63   Sus scrofa [pigs]
ref|XP_007171826.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Balaenoptera acutorostrata scammoni
ref|XP_004688439.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   Condylura cristata
gb|EAW52724.1|  coatomer protein complex, subunit alpha, isoform ...    222   3e-63   Homo sapiens [man]
ref|XP_005400263.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   Chinchilla lanigera
ref|XP_004589140.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   Ochotona princeps [southern American pika]
gb|EHB13664.1|  Coatomer subunit alpha                                  222   3e-63   Heterocephalus glaber [naked mole rat]
ref|XP_007129696.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_010991399.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_010282036.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   
ref|XP_005981769.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_004407936.1|  PREDICTED: coatomer subunit alpha isoform 2        222   3e-63   
ref|XP_008518688.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_005981768.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_004002719.1|  PREDICTED: coatomer subunit alpha isoform 2        222   3e-63   
dbj|BAC31555.1|  unnamed protein product                                222   3e-63   
ref|NP_004362.2|  coatomer subunit alpha isoform 2                      222   3e-63   
ref|XP_004448470.1|  PREDICTED: coatomer subunit alpha isoform 2        222   3e-63   
ref|XP_004002718.1|  PREDICTED: coatomer subunit alpha isoform 1        222   3e-63   
ref|XP_002928486.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   
ref|XP_004901582.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_004407935.1|  PREDICTED: coatomer subunit alpha isoform 1        222   3e-63   
ref|XP_007974683.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|NP_001099115.1|  coatomer subunit alpha                             222   3e-63   
ref|XP_006895530.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
gb|AAB70879.1|  coatomer protein                                        222   3e-63   
ref|XP_008698915.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_008582921.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_006060555.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_004284479.1|  PREDICTED: coatomer subunit alpha isoform 2        222   3e-63   
ref|NP_034068.3|  coatomer subunit alpha                                222   3e-63   
ref|XP_004448469.1|  PREDICTED: coatomer subunit alpha isoform 1        222   3e-63   
ref|XP_003415233.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   
emb|CCA26666.1|  predicted protein putative                             222   3e-63   
ref|XP_005400264.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_004671175.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_004589141.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_006895529.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_005203500.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_004027749.1|  PREDICTED: coatomer subunit alpha isoform 2        222   3e-63   
ref|XP_010788149.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    220   3e-63   
ref|XP_007129697.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_319442.1|  AGAP010251-PA                                         222   3e-63   
ref|XP_008982977.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    222   3e-63   
ref|XP_005541314.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_001369624.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_008582920.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_001171563.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_008494290.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_008056902.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   
ref|XP_007092432.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   
gb|AAH24070.1|  Coatomer protein complex subunit alpha                  222   3e-63   
ref|XP_005515154.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   
ref|XP_004858772.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_004716570.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
gb|EDL39042.1|  coatomer protein complex subunit alpha, isoform C...    222   3e-63   
ref|XP_010991398.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_008839027.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_004613819.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_003892962.1|  PREDICTED: coatomer subunit alpha isoform X2       222   3e-63   
ref|XP_011371370.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_007945900.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_005541313.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_010359050.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   
ref|XP_003937994.1|  PREDICTED: coatomer subunit alpha                  222   3e-63   
ref|XP_004671174.1|  PREDICTED: coatomer subunit alpha isoform X1       222   3e-63   
ref|XP_006168890.1|  PREDICTED: coatomer subunit alpha isoform X2       222   4e-63   
ref|XP_006174002.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|XP_003466618.1|  PREDICTED: coatomer subunit alpha isoform 2        222   4e-63   
ref|XP_007974682.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|XP_006060554.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|XP_007441248.1|  PREDICTED: coatomer subunit alpha                  222   4e-63   
ref|XP_003892963.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|XP_011289413.1|  PREDICTED: coatomer subunit alpha                  222   4e-63   
gb|AAI69090.1|  Copa protein                                            222   4e-63   
ref|XP_004901583.1|  PREDICTED: coatomer subunit alpha isoform X2       222   4e-63   
ref|XP_003466617.1|  PREDICTED: coatomer subunit alpha isoform 1        222   4e-63   
ref|XP_001928732.1|  PREDICTED: coatomer subunit alpha isoform 1        222   4e-63   
ref|XP_004284478.1|  PREDICTED: coatomer subunit alpha isoform 1        222   4e-63   
ref|NP_001128012.1|  coatomer subunit alpha                             222   4e-63   
ref|XP_010614962.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|XP_008839026.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|NP_001091868.1|  coatomer subunit alpha isoform 1                   222   4e-63   
ref|XP_009887819.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|XP_010614964.1|  PREDICTED: coatomer subunit alpha isoform X2       222   4e-63   
ref|XP_004639986.1|  PREDICTED: coatomer subunit alpha isoform X2       222   4e-63   
ref|XP_004639985.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|XP_006168889.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|XP_004688438.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|XP_004613818.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|XP_004716569.1|  PREDICTED: coatomer subunit alpha isoform X1       222   4e-63   
ref|XP_008333163.1|  PREDICTED: coatomer subunit alpha                  221   5e-63   
gb|EFX83790.1|  hypothetical protein DAPPUDRAFT_301644                  221   6e-63   
ref|XP_005903946.1|  PREDICTED: coatomer subunit alpha isoform X2       221   7e-63   
ref|XP_005903945.1|  PREDICTED: coatomer subunit alpha isoform X1       221   7e-63   
ref|NP_001121466.1|  coatomer protein complex, subunit alpha            221   7e-63   
gb|KFH68427.1|  coatomer protein complex, subunit alpha (xenin)         221   9e-63   
ref|XP_003700869.1|  PREDICTED: coatomer subunit alpha                  221   1e-62   
ref|XP_001219598.1|  conserved hypothetical protein                     220   1e-62   
ref|XP_001743343.1|  hypothetical protein                               220   2e-62   
ref|XP_005189048.1|  PREDICTED: coatomer subunit alpha                  220   2e-62   
gb|KIW43031.1|  hypothetical protein PV06_04180                         220   2e-62   
ref|XP_007913694.1|  putative coatomer subunit protein                  220   2e-62   
gb|KIV82662.1|  hypothetical protein PV11_04756                         220   2e-62   
gb|KIW28228.1|  hypothetical protein PV07_07907                         220   2e-62   
emb|CEP17781.1|  hypothetical protein                                   209   2e-62   
ref|XP_003665506.1|  hypothetical protein MYCTH_108501                  219   2e-62   
ref|NP_001086488.1|  coatomer protein complex, subunit alpha            219   2e-62   
ref|XP_009159088.1|  coatomer protein complex, subunit alpha (xenin)    219   3e-62   
gb|EPB81110.1|  coatomer protein complex, subunit alpha (xenin)         219   3e-62   
ref|XP_008467461.1|  PREDICTED: coatomer subunit alpha-like             219   3e-62   
gb|KFH45703.1|  putative coatomer subunit alpha-like protein            219   3e-62   
dbj|GAN06302.1|  coatomer protein complex, subunit alpha                219   3e-62   
dbj|GAN02438.1|  coatomer protein complex, subunit alpha                219   3e-62   
ref|XP_009262181.1|  hypothetical protein FPSE_10789                    219   4e-62   
gb|EIE76003.1|  hypothetical protein RO3G_00707                         219   4e-62   
gb|KIN00886.1|  hypothetical protein OIDMADRAFT_41582                   219   5e-62   
ref|XP_007294624.1|  coatomer WD associated region                      219   5e-62   
ref|XP_011327781.1|  coatomer subunit alpha                             219   5e-62   
ref|XP_005102617.1|  PREDICTED: coatomer subunit alpha-like             219   5e-62   
ref|XP_002025634.1|  GL20730                                            219   5e-62   
ref|XP_009059178.1|  hypothetical protein LOTGIDRAFT_218145             219   5e-62   
emb|CEG73732.1|  Putative Coatomer, WD associated region                219   5e-62   
gb|KIW61270.1|  hypothetical protein PV05_01414                         219   5e-62   
ref|XP_002731289.1|  PREDICTED: coatomer subunit alpha-like             219   5e-62   
emb|CEP14680.1|  hypothetical protein                                   218   6e-62   
ref|XP_001352767.1|  GA20724                                            218   6e-62   
dbj|BAK00682.1|  predicted protein                                      218   6e-62   
ref|XP_007697819.1|  hypothetical protein COCSADRAFT_158414             218   6e-62   
gb|ERZ98066.1|  hypothetical protein GLOINDRAFT_334453                  218   7e-62   
ref|XP_003487682.1|  PREDICTED: coatomer subunit alpha-like             209   7e-62   
ref|XP_002428302.1|  coatomer alpha subunit, putative                   218   7e-62   
ref|XP_011503846.1|  PREDICTED: coatomer subunit alpha                  218   7e-62   
gb|EWZ92610.1|  coatomer protein complex, subunit alpha (xenin)         218   7e-62   
gb|EWZ47561.1|  coatomer protein complex, subunit alpha (xenin)         218   7e-62   
gb|EGU85391.1|  hypothetical protein FOXB_04102                         218   7e-62   
ref|XP_007683623.1|  hypothetical protein COCMIDRAFT_1497               218   8e-62   
gb|EXL92480.1|  coatomer protein complex, subunit alpha (xenin)         218   8e-62   
gb|EXM21197.1|  coatomer protein complex, subunit alpha (xenin)         218   8e-62   
gb|EXK97845.1|  coatomer protein complex, subunit alpha (xenin)         218   8e-62   
gb|EWG53777.1|  coatomer protein complex, subunit alpha (xenin)         218   8e-62   
ref|XP_007708326.1|  hypothetical protein COCCADRAFT_1756               218   8e-62   
emb|CCT67478.1|  probable COP1-coatomer complex alpha chain of se...    218   8e-62   
gb|ENH65076.1|  Putative coatomer subunit alpha                         218   8e-62   
ref|XP_007928128.1|  hypothetical protein MYCFIDRAFT_215718             218   8e-62   
gb|EUN28946.1|  hypothetical protein COCVIDRAFT_94207                   218   8e-62   
ref|XP_002046370.1|  GJ12542                                            218   8e-62   
gb|KIL94438.1|  hypothetical protein FAVG1_03002                        218   8e-62   
ref|XP_008027562.1|  hypothetical protein SETTUDRAFT_163807             218   8e-62   
gb|EMD95016.1|  hypothetical protein COCHEDRAFT_1222255                 218   8e-62   
ref|XP_003040742.1|  predicted protein                                  218   8e-62   
gb|KEQ90028.1|  Coatomer, alpha subunit                                 218   9e-62   
gb|KEQ71644.1|  Coatomer, alpha subunit                                 218   9e-62   
gb|KEQ58921.1|  Coatomer, alpha subunit                                 218   9e-62   
ref|XP_003851873.1|  hypothetical protein MYCGRDRAFT_59890              218   9e-62   
ref|XP_001929805.1|  hypothetical protein                               218   9e-62   
ref|XP_002012122.1|  GI16798                                            218   1e-61   
ref|XP_001983547.1|  GH15519                                            218   1e-61   
gb|KEQ99460.1|  hypothetical protein AUEXF2481DRAFT_25363               218   1e-61   
ref|XP_002131264.1|  PREDICTED: coatomer subunit alpha                  218   1e-61   
ref|XP_957881.1|  coatomer alpha subunit                                218   1e-61   
ref|XP_009853422.1|  hypothetical protein NEUTE1DRAFT_67419             218   1e-61   
ref|XP_007676795.1|  hypothetical protein BAUCODRAFT_34527              218   1e-61   
ref|XP_009221190.1|  coatomer alpha subunit                             218   1e-61   
ref|XP_003716408.1|  coatomer alpha subunit                             218   1e-61   
ref|XP_967472.1|  PREDICTED: coatomer subunit alpha                     218   1e-61   
ref|XP_004998986.1|  COP1 protein                                       217   1e-61   
gb|KFA65340.1|  hypothetical protein S40285_07164                       217   2e-61   
gb|EHK39883.1|  hypothetical protein TRIATDRAFT_152772                  217   2e-61   
ref|XP_006965599.1|  vesicle coatomer complex, alpha subunit            217   2e-61   
gb|KIV96927.1|  hypothetical protein PV10_00740                         217   2e-61   
gb|KEY64740.1|  hypothetical protein S7711_05394                        217   2e-61   
dbj|GAM85563.1|  hypothetical protein ANO11243_035700                   217   2e-61   
ref|XP_011200833.1|  PREDICTED: coatomer subunit alpha                  217   2e-61   
ref|XP_007795611.1|  putative coatomer subunit protein                  217   2e-61   
emb|CCG83768.1|  protein of unknown function                            217   2e-61   
ref|XP_007801419.1|  coatomer subunit alpha                             217   2e-61   
gb|EME42492.1|  hypothetical protein DOTSEDRAFT_73359                   217   2e-61   
gb|EKG17766.1|  hypothetical protein MPH_04981                          217   2e-61   
ref|XP_004525714.1|  PREDICTED: coatomer subunit alpha-like             217   3e-61   
ref|XP_009039838.1|  hypothetical protein AURANDRAFT_70314              216   3e-61   
gb|EYE91947.1|  putative coatomer subunit alpha                         216   3e-61   
ref|XP_011135745.1|  PREDICTED: coatomer subunit alpha                  216   3e-61   
ref|XP_009039560.1|  hypothetical protein AURANDRAFT_38357              216   3e-61   
gb|ENH83728.1|  coatomer subunit                                        216   3e-61   
emb|CCF40384.1|  hypothetical protein CH063_02342                       216   3e-61   
ref|XP_010472128.1|  PREDICTED: coatomer subunit alpha-2-like           216   3e-61   
gb|KFM76440.1|  Coatomer subunit alpha                                  216   3e-61   
ref|XP_007284565.1|  coatomer subunit                                   216   3e-61   
ref|XP_007599108.1|  coatomer WD associated region                      216   3e-61   
ref|XP_008482797.1|  PREDICTED: coatomer subunit alpha-like             211   4e-61   
gb|EQB47987.1|  coatomer WD associated region                           216   4e-61   
gb|KDN65111.1|  putative coatomer WD associated region                  216   4e-61   
ref|XP_003737263.1|  PREDICTED: coatomer subunit alpha                  216   4e-61   
ref|XP_006695261.1|  putative coatomer complex protein                  216   4e-61   
ref|XP_002182326.1|  predicted protein                                  216   4e-61   
ref|XP_011125167.1|  hypothetical protein AOL_s00110g175                216   5e-61   
ref|XP_003691465.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    216   5e-61   
ref|XP_001950394.1|  PREDICTED: coatomer subunit alpha                  216   6e-61   
ref|XP_001631811.1|  predicted protein                                  216   6e-61   
gb|KFH68419.1|  coatomer protein complex, subunit alpha (xenin)         216   6e-61   
gb|EXX75326.1|  Cop1p                                                   214   6e-61   
emb|CAL00470.1|  unnamed protein product                                215   8e-61   
dbj|GAA84870.1|  coatomer subunit alpha                                 215   8e-61   
gb|EHA21882.1|  hypothetical protein ASPNIDRAFT_56469                   215   8e-61   
ref|XP_001397559.2|  coatomer subunit alpha                             215   8e-61   
gb|EXX75325.1|  Cop1p                                                   215   8e-61   
gb|ABM68600.1|  AAEL013098-PA                                           211   9e-61   
ref|XP_005840278.1|  coatomer subunit alpha                             215   9e-61   
ref|XP_003654020.1|  hypothetical protein THITE_2116559                 215   1e-60   
ref|XP_001587889.1|  conserved hypothetical protein                     215   1e-60   
ref|XP_001552780.1|  hypothetical protein BC1G_08115                    215   1e-60   
ref|XP_007171825.1|  PREDICTED: coatomer subunit alpha isoform X1       214   1e-60   
ref|XP_009097457.1|  PREDICTED: coatomer subunit alpha                  214   2e-60   
gb|ELR08265.1|  coatomer protein complex, subunit alpha                 214   2e-60   
gb|EMF12578.1|  coatomer alpha subunit                                  214   2e-60   
gb|KFZ03673.1|  hypothetical protein V502_10754                         214   2e-60   
gb|KFY27613.1|  hypothetical protein V491_00828                         214   2e-60   
tpe|CBF83542.1|  TPA: Coatomer alpha subunit [Source:UniProtKB/Tr...    214   2e-60   
gb|KFY55877.1|  hypothetical protein V496_06879                         214   2e-60   
gb|KFY40219.1|  hypothetical protein V495_05545                         214   2e-60   
gb|AAC18088.1|  coatomer alpha subunit                                  214   3e-60   
ref|XP_660630.1|  hypothetical protein AN3026.2                         214   3e-60   
gb|KFY51955.1|  hypothetical protein V497_08731                         214   3e-60   
gb|EPS26788.1|  hypothetical protein PDE_01727                          214   3e-60   
ref|XP_007839261.1|  coatomer subunit alpha                             214   3e-60   
gb|KFY27311.1|  hypothetical protein V493_03574                         214   3e-60   
gb|KGO74581.1|  Coatomer alpha subunit                                  213   3e-60   



>ref|XP_011028654.1| PREDICTED: coatomer subunit alpha-1 [Populus euphratica]
Length=1218

 Score =   261 bits (666),  Expect = 4e-77, Method: Composition-based stats.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_008802787.1| PREDICTED: coatomer subunit alpha-1 [Phoenix dactylifera]
Length=1218

 Score =   256 bits (653),  Expect = 3e-75, Method: Composition-based stats.
 Identities = 113/115 (98%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQ  115


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +   
Sbjct  203  HDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDI  262

Query  542  IVSASDDQ  565
            IVS S+D+
Sbjct  263  IVSNSEDK  270


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/131 (24%), Positives = 52/131 (40%), Gaps = 27/131 (21%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR---------------------------CLFTLLGHLDYIRTVQFHHE  532
            D  ++VW+    R                             + L GH   +    FH  
Sbjct  156  DQTVRVWDIGALRKKTVSPADDILRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPS  215

Query  533  YPWIVSASDDQ  565
             P IVS +DD+
Sbjct  216  LPLIVSGADDR  226



>ref|XP_010096174.1| Coatomer subunit alpha-1 [Morus notabilis]
 gb|EXB63569.1| Coatomer subunit alpha-1 [Morus notabilis]
Length=1234

 Score =   255 bits (652),  Expect = 4e-75, Method: Composition-based stats.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  15   MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  74

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  75   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  129


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  215  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  274

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  275  QDIIVSNSEDK  285



>ref|XP_002957821.1| hypothetical protein VOLCADRAFT_77684 [Volvox carteri f. nagariensis]
 gb|EFJ41149.1| hypothetical protein VOLCADRAFT_77684 [Volvox carteri f. nagariensis]
Length=1224

 Score =   254 bits (650),  Expect = 6e-75, Method: Composition-based stats.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIK+WNYKL RCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKIWNYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH + PL VSG DD ++K+W Y   +   + TL GH + +  V FH     
Sbjct  204  HDRGVNWAAFHPTLPLIVSGADDRQVKLWRYNESKAWEVDTLRGHTNNVSCVMFHARQDL  263

Query  542  IVSASDDQ  565
            I+S S+D+
Sbjct  264  IISNSEDK  271



>ref|XP_001693686.1| alpha-COP [Chlamydomonas reinhardtii]
 gb|EDP08940.1| alpha-COP [Chlamydomonas reinhardtii]
Length=1256

 Score =   254 bits (648),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 110/115 (96%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPW+LASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWVLASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIK+WNYKL RCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKIWNYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH + PL VSG DD ++K+W Y  ++   + TL GH + +  V FH     
Sbjct  204  HDRGVNWAAFHPTLPLIVSGADDRQVKLWRYNGNKAWEVDTLRGHTNNVSCVMFHARQDL  263

Query  542  IVSASDDQ  565
            I+S S+D+
Sbjct  264  IISNSEDK  271



>gb|KCW64034.1| hypothetical protein EUGRSUZ_G017081, partial [Eucalyptus grandis]
 gb|KCW64035.1| hypothetical protein EUGRSUZ_G017081, partial [Eucalyptus grandis]
Length=234

 Score =   234 bits (597),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTCRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115



>ref|XP_005651719.1| Coatomer, alpha subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE27175.1| Coatomer, alpha subunit [Coccomyxa subellipsoidea C-169]
Length=1233

 Score =   252 bits (643),  Expect = 7e-74, Method: Composition-based stats.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTVQFH EYPW+VSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVQFHQEYPWVVSASDDQ  115



>ref|XP_002321558.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
 gb|EEF05685.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
Length=1218

 Score =   249 bits (635),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_011042648.1| PREDICTED: coatomer subunit alpha-1-like isoform X2 [Populus 
euphratica]
Length=1223

 Score =   249 bits (635),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_011074632.1| PREDICTED: coatomer subunit alpha-1-like [Sesamum indicum]
Length=1218

 Score =   249 bits (635),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_007017678.1| Coatomer, alpha subunit [Theobroma cacao]
 gb|EOY14903.1| Coatomer, alpha subunit [Theobroma cacao]
Length=1219

 Score =   248 bits (634),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_002318013.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
 gb|EEE96233.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
Length=1220

 Score =   248 bits (634),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_011042646.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Populus 
euphratica]
 ref|XP_011042647.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Populus 
euphratica]
Length=1220

 Score =   248 bits (634),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|EYU36749.1| hypothetical protein MIMGU_mgv1a000357mg [Erythranthe guttata]
Length=1220

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>gb|KDO49492.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
Length=916

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_006341999.1| PREDICTED: coatomer subunit alpha-1-like [Solanum tuberosum]
Length=1218

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_004238316.1| PREDICTED: coatomer subunit alpha-1 [Solanum lycopersicum]
Length=1218

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|KDO49489.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
Length=1208

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>emb|CDP07449.1| unnamed protein product [Coffea canephora]
Length=1247

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|KDP41738.1| hypothetical protein JCGZ_26756 [Jatropha curcas]
Length=1218

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_009598989.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana tomentosiformis]
Length=1219

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_006487332.1| PREDICTED: coatomer subunit alpha-2-like isoform X1 [Citrus sinensis]
 ref|XP_006487333.1| PREDICTED: coatomer subunit alpha-2-like isoform X2 [Citrus sinensis]
Length=1219

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_002512969.1| coatomer alpha subunit, putative [Ricinus communis]
 gb|EEF49472.1| coatomer alpha subunit, putative [Ricinus communis]
Length=1217

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|KDO49490.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
 gb|KDO49491.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
Length=1219

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_006423409.1| hypothetical protein CICLE_v10027697mg [Citrus clementina]
 gb|ESR36649.1| hypothetical protein CICLE_v10027697mg [Citrus clementina]
Length=1219

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_011083895.1| PREDICTED: coatomer subunit alpha-1-like [Sesamum indicum]
Length=1199

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|EYU32877.1| hypothetical protein MIMGU_mgv1a000353mg [Erythranthe guttata]
Length=1225

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_009790884.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana sylvestris]
Length=1219

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_008240283.1| PREDICTED: coatomer subunit alpha-1 [Prunus mume]
Length=1218

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_007210424.1| hypothetical protein PRUPE_ppa000386mg [Prunus persica]
 gb|EMJ11623.1| hypothetical protein PRUPE_ppa000386mg [Prunus persica]
Length=1218

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|EAZ08188.1| hypothetical protein OsI_30447 [Oryza sativa Indica Group]
Length=1218

 Score =   248 bits (632),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +   
Sbjct  203  HDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDI  262

Query  542  IVSASDDQ  565
            IVS S+D+
Sbjct  263  IVSNSEDK  270



>ref|NP_001062612.1| Os09g0127800 [Oryza sativa Japonica Group]
 sp|Q0J3D9.1|COPA3_ORYSJ RecName: Full=Coatomer subunit alpha-3; AltName: Full=Alpha-coat 
protein 3; Short=Alpha-COP 3 [Oryza sativa Japonica Group]
 dbj|BAF24526.1| Os09g0127800 [Oryza sativa Japonica Group]
 gb|EAZ43816.1| hypothetical protein OsJ_28435 [Oryza sativa Japonica Group]
Length=1218

 Score =   248 bits (632),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +   
Sbjct  203  HDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDI  262

Query  542  IVSASDDQ  565
            IVS S+D+
Sbjct  263  IVSNSEDK  270



>ref|XP_009794496.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana sylvestris]
Length=1218

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  VQFH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVQFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_004982004.1| PREDICTED: coatomer subunit alpha-3-like [Setaria italica]
Length=1219

 Score =   248 bits (632),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +   
Sbjct  203  HDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDI  262

Query  542  IVSASDDQ  565
            IVS S+D+
Sbjct  263  IVSNSEDK  270



>ref|XP_009599251.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana tomentosiformis]
Length=1218

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  VQFH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVQFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_008644216.1| PREDICTED: uncharacterized protein LOC100502115 isoform X1 [Zea 
mays]
 gb|AFW67844.1| hypothetical protein ZEAMMB73_579366 [Zea mays]
Length=1217

 Score =   247 bits (631),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +   
Sbjct  203  HDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAKQDI  262

Query  542  IVSASDDQ  565
            IVS S+D+
Sbjct  263  IVSNSEDK  270



>gb|KGN61838.1| hypothetical protein Csa_2G249920 [Cucumis sativus]
Length=595

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  13   MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  72

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  73   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  127



>ref|XP_008393301.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1218

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_008225617.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-1-like 
[Prunus mume]
Length=1195

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   TSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_007213296.1| hypothetical protein PRUPE_ppa000388mg [Prunus persica]
 gb|EMJ14495.1| hypothetical protein PRUPE_ppa000388mg [Prunus persica]
Length=1217

 Score =   246 bits (629),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   TSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_008448067.1| PREDICTED: coatomer subunit alpha-1 [Cucumis melo]
Length=1217

 Score =   246 bits (629),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               I+S S+D+
Sbjct  260  QDLIISNSEDK  270



>ref|XP_004293978.1| PREDICTED: coatomer subunit alpha-1-like [Fragaria vesca subsp. 
vesca]
Length=1219

 Score =   246 bits (629),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/115 (99%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_004300535.1| PREDICTED: coatomer subunit alpha-1-like [Fragaria vesca subsp. 
vesca]
Length=1218

 Score =   246 bits (629),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_010263850.1| PREDICTED: coatomer subunit alpha-1 [Nelumbo nucifera]
Length=1218

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_004150072.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis sativus]
Length=718

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|EPS65879.1| hypothetical protein M569_08896 [Genlisea aurea]
Length=1225

 Score =   246 bits (628),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDY+RTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYVRTVQFHHEYPWIVSASDDQ  115



>emb|CBI19788.3| unnamed protein product [Vitis vinifera]
Length=1062

 Score =   245 bits (625),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLFGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_006356758.1| PREDICTED: coatomer subunit alpha-1-like [Solanum tuberosum]
Length=1219

 Score =   246 bits (628),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH++RPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTQRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_004243143.1| PREDICTED: coatomer subunit alpha-1-like [Solanum lycopersicum]
Length=1219

 Score =   246 bits (628),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH++RPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTQRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_009346991.1| PREDICTED: coatomer subunit alpha-2-like [Pyrus x bretschneideri]
Length=1216

 Score =   246 bits (627),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_004148533.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis sativus]
 ref|XP_004156620.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis sativus]
 gb|KGN43163.1| hypothetical protein Csa_7G004160 [Cucumis sativus]
Length=1217

 Score =   246 bits (627),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               I+S S+D+
Sbjct  260  QDLIISNSEDK  270



>ref|XP_002501894.1| coatomer protein complex [Micromonas sp. RCC299]
 gb|ACO63152.1| coatomer protein complex [Micromonas sp. RCC299]
Length=1236

 Score =   246 bits (628),  Expect = 9e-72, Method: Composition-based stats.
 Identities = 109/115 (95%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVSFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKL RCL+TLLGHLDYIRTVQFH EYPWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLRRCLYTLLGHLDYIRTVQFHQEYPWIVSASDDQ  115



>ref|XP_002279779.1| PREDICTED: coatomer subunit alpha-1 [Vitis vinifera]
Length=1217

 Score =   246 bits (627),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLFGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_010271512.1| PREDICTED: coatomer subunit alpha-1-like [Nelumbo nucifera]
Length=1218

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKIHRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_008374746.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1216

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_008460997.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis melo]
 ref|XP_008460999.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis melo]
Length=1219

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_004165124.1| PREDICTED: coatomer subunit alpha-1-like, partial [Cucumis sativus]
Length=855

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010555274.1| PREDICTED: coatomer subunit alpha-1-like [Tarenaya hassleriana]
Length=1217

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_008461000.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis melo]
Length=1219

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010690807.1| PREDICTED: coatomer subunit alpha-1 [Beta vulgaris subsp. vulgaris]
Length=1220

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_006828935.1| hypothetical protein AMTR_s00001p00220200 [Amborella trichopoda]
 gb|ERM96351.1| hypothetical protein AMTR_s00001p00220200 [Amborella trichopoda]
Length=1216

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K+QPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQ
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQ  115



>gb|KGN61837.1| hypothetical protein Csa_2G249910 [Cucumis sativus]
Length=1219

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_003057643.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57594.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1238

 Score =   244 bits (624),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 109/115 (95%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTV FH EYPWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVAFHPEYPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH     
Sbjct  204  HDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHARQDI  263

Query  542  IVSASDDQ  565
            IVS S+D+
Sbjct  264  IVSNSEDK  271



>ref|XP_010526595.1| PREDICTED: coatomer subunit alpha-1 [Tarenaya hassleriana]
 ref|XP_010526596.1| PREDICTED: coatomer subunit alpha-1 [Tarenaya hassleriana]
 ref|XP_010526598.1| PREDICTED: coatomer subunit alpha-1 [Tarenaya hassleriana]
Length=1217

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            +SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_004165122.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis sativus]
Length=1219

 Score =   244 bits (623),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010109755.1| hypothetical protein L484_008431 [Morus notabilis]
 gb|EXC24660.1| hypothetical protein L484_008431 [Morus notabilis]
Length=1220

 Score =   244 bits (623),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  201  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  260

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  261  QDIIVSNSEDK  271



>ref|XP_008346150.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1217

 Score =   244 bits (623),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>ref|XP_004150060.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-1-like 
[Cucumis sativus]
Length=1183

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_009362204.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009362206.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009362207.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009362208.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
Length=1217

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>sp|Q9AUR7.1|COPA2_ORYSJ RecName: Full=Coatomer subunit alpha-2; AltName: Full=Alpha-coat 
protein 2; Short=Alpha-COP 2 [Oryza sativa Japonica Group]
 gb|AAK18837.1|AC082645_7 putative alpha-coat protein [Oryza sativa Japonica Group]
 gb|ABF98514.1| Coatomer alpha subunit, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY91611.1| hypothetical protein OsI_13245 [Oryza sativa Indica Group]
 gb|EAZ28340.1| hypothetical protein OsJ_12318 [Oryza sativa Japonica Group]
Length=1218

 Score =   244 bits (622),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 106/115 (92%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +   
Sbjct  203  HDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDI  262

Query  542  IVSASDDQ  565
            IVS S+D+
Sbjct  263  IVSNSEDK  270



>ref|XP_010919610.1| PREDICTED: coatomer subunit alpha-1 [Elaeis guineensis]
 ref|XP_010919611.1| PREDICTED: coatomer subunit alpha-1 [Elaeis guineensis]
 ref|XP_010919612.1| PREDICTED: coatomer subunit alpha-1 [Elaeis guineensis]
Length=1218

 Score =   244 bits (622),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010933643.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
 ref|XP_010933644.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
 ref|XP_010933645.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
Length=1217

 Score =   244 bits (622),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/115 (98%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_011398207.1| Coatomer subunit alpha-2 [Auxenochlorella protothecoides]
 gb|KFM25315.1| Coatomer subunit alpha-2 [Auxenochlorella protothecoides]
Length=1032

 Score =   242 bits (618),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 106/115 (92%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEH+GPVRG+HFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHEGPVRGIHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   PTQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH + PL VSG DD +IK+W     +   + TL GH++ + +V FH +   
Sbjct  209  HDRGVNWAAFHPTLPLVVSGADDRQIKLWRMNESKAWEVDTLRGHVNNVSSVIFHAKQDL  268

Query  542  IVSASDDQ  565
            I+S S+D+
Sbjct  269  IISDSEDK  276



>ref|XP_004507488.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Cicer arietinum]
 ref|XP_004507489.1| PREDICTED: coatomer subunit alpha-1-like isoform X2 [Cicer arietinum]
Length=1222

 Score =   243 bits (621),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115



>ref|XP_007042068.1| Coatomer, alpha subunit [Theobroma cacao]
 gb|EOX97899.1| Coatomer, alpha subunit [Theobroma cacao]
Length=1219

 Score =   243 bits (620),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010933642.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
Length=1217

 Score =   243 bits (620),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDVIVSNSEDK  270



>gb|KJB47565.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
 gb|KJB47566.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
 gb|KJB47567.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
 gb|KJB47568.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
Length=1216

 Score =   243 bits (620),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               +VS S+D+
Sbjct  260  QDIVVSNSEDK  270



>ref|XP_007042069.1| Coatomer, alpha subunit [Theobroma cacao]
 gb|EOX97900.1| Coatomer, alpha subunit [Theobroma cacao]
Length=1219

 Score =   243 bits (620),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_003540979.1| PREDICTED: coatomer subunit alpha-2-like isoform X1 [Glycine 
max]
 ref|XP_006592088.1| PREDICTED: coatomer subunit alpha-2-like isoform X2 [Glycine 
max]
Length=1221

 Score =   243 bits (620),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|KHN25415.1| Coatomer subunit alpha-2 [Glycine soja]
Length=1221

 Score =   243 bits (620),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|KHG21379.1| hypothetical protein F383_26788 [Gossypium arboreum]
Length=1213

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_002529504.1| coatomer alpha subunit, putative [Ricinus communis]
 gb|EEF32873.1| coatomer alpha subunit, putative [Ricinus communis]
Length=1217

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGV+FH
Sbjct  1    MLTKFETKSNRVKGLSFHCKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVNFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>gb|KJB32566.1| hypothetical protein B456_005G247300 [Gossypium raimondii]
Length=1213

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_008383465.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1021

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQ HHEYPWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQXHHEYPWIVSASDDQ  115



>ref|XP_007131781.1| hypothetical protein PHAVU_011G041000g [Phaseolus vulgaris]
 gb|ESW03775.1| hypothetical protein PHAVU_011G041000g [Phaseolus vulgaris]
Length=1221

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|KJB32563.1| hypothetical protein B456_005G247200 [Gossypium raimondii]
 gb|KJB32564.1| hypothetical protein B456_005G247200 [Gossypium raimondii]
Length=1213

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_003537852.1| PREDICTED: coatomer subunit alpha-2-like [Glycine max]
Length=1221

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEDPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|KHN39822.1| Coatomer subunit alpha-1 [Glycine soja]
Length=1221

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEDPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|KHG26300.1| hypothetical protein F383_08243 [Gossypium arboreum]
Length=1217

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRC+FTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCVFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 59/135 (44%), Gaps = 33/135 (24%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTL----------IDRFDE------------  367
            V   SFH K   ++++     +++WD  +G+L          I RF +            
Sbjct  138  VMCASFHPKEDLVVSASLDQTVRVWD--IGSLNKKTASPADDILRFSQMNSELFGGVDAV  195

Query  368  -------HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQ  520
                   HD  V    FH + PL VSG DD ++K+W     +   + T  GH++ +  V 
Sbjct  196  VKYVLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTFRGHMNNVSCVM  255

Query  521  FHHEYPWIVSASDDQ  565
            FH +   IVS S+D+
Sbjct  256  FHSKLDIIVSNSEDK  270



>gb|KHG24640.1| hypothetical protein F383_03247 [Gossypium arboreum]
Length=1218

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115



>ref|XP_008365997.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-1-like 
[Malus domestica]
Length=828

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQ HHEYPWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQXHHEYPWIVSASDDQ  115



>emb|CDY61804.1| BnaC03g76410D [Brassica napus]
Length=493

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_001417203.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95496.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=1222

 Score =   242 bits (617),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVW+YKL RC+FTLLGHLDYIRTV+FH EYPWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWSYKLRRCMFTLLGHLDYIRTVEFHQEYPWIVSASDDQ  115



>gb|KJB32565.1| hypothetical protein B456_005G247300 [Gossypium raimondii]
Length=1264

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|AAS58474.1| coatomer alpha subunit [Hordeum vulgare subsp. vulgare]
Length=1218

 Score =   242 bits (617),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 104/115 (90%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWILASLHSGV+Q+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILASLHSGVVQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQ  115


 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +   
Sbjct  203  HDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAKQDI  262

Query  542  IVSASDDQ  565
            IVS S+D+
Sbjct  263  IVSNSEDK  270



>ref|XP_009388919.1| PREDICTED: coatomer subunit alpha-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388927.1| PREDICTED: coatomer subunit alpha-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388935.1| PREDICTED: coatomer subunit alpha-1-like [Musa acuminata subsp. 
malaccensis]
Length=1216

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHMNNVSCVMFHAK  258

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  259  QDIIVSNSEDK  269



>emb|CAE45585.1| coatomer alpha subunit-like protein [Lotus japonicus]
Length=1221

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_009407817.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
Length=1215

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQ  115


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 62/132 (47%), Gaps = 28/132 (21%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWD--------------YRMGTL-IDRFDEHDGPV--  382
            V   SFH K   I+++     I++WD               R+G +  D F   D  V  
Sbjct  138  VMCASFHPKEDLIVSASLDQTIRVWDISSLRKKVSPADDILRLGQMNADLFGGVDAVVKY  197

Query  383  ------RGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHH  529
                  RGV+   FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH 
Sbjct  198  VLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHMNNVSSVMFHA  257

Query  530  EYPWIVSASDDQ  565
            +   IVS S+D+
Sbjct  258  KQDIIVSNSEDK  269



>ref|XP_006300379.1| hypothetical protein CARUB_v10019676mg [Capsella rubella]
 gb|EOA33277.1| hypothetical protein CARUB_v10019676mg [Capsella rubella]
Length=1218

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|KJB77745.1| hypothetical protein B456_012G154500 [Gossypium raimondii]
Length=852

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRC+FTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCVFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115



>ref|XP_008349149.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1217

 Score =   241 bits (616),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQ HHEYPWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQXHHEYPWIVSASDDQ  115



>gb|KDD75879.1| hypothetical protein H632_c457p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=313

 Score =   227 bits (579),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWIL SLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILTSLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   PSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQ  115



>ref|XP_005851353.1| hypothetical protein CHLNCDRAFT_137537 [Chlorella variabilis]
 gb|EFN59251.1| hypothetical protein CHLNCDRAFT_137537 [Chlorella variabilis]
Length=726

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   PSQPLFVSGGDDYKIKVWNYKQRRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115



>gb|KJB47562.1| hypothetical protein B456_008G031300 [Gossypium raimondii]
Length=1064

 Score =   240 bits (612),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRF+EHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFEEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115



>gb|KJB77746.1| hypothetical protein B456_012G154500 [Gossypium raimondii]
Length=1216

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRC+FTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCVFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115



>gb|KJB47564.1| hypothetical protein B456_008G031300 [Gossypium raimondii]
Length=1218

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRF+EHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFEEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010066199.1| PREDICTED: coatomer subunit alpha-1 [Eucalyptus grandis]
Length=1218

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTCRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 59/133 (44%), Gaps = 29/133 (22%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWD---------------YRMGTL-IDRF--------  361
            V   SFH K   ++++     +++WD                R+G +  D F        
Sbjct  138  VMCASFHPKEDLVVSASLDQTVRVWDISALKNKTASPGDDLLRLGQMNTDLFGGVDVVVK  197

Query  362  ---DEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFH  526
               + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH
Sbjct  198  YVLEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFH  257

Query  527  HEYPWIVSASDDQ  565
             +   IVS S+D+
Sbjct  258  AKQDIIVSNSEDK  270



>ref|XP_003607006.1| Coatomer alpha subunit-like protein [Medicago truncatula]
 gb|AES89203.1| coatomer subunit alpha-like protein [Medicago truncatula]
Length=1206

 Score =   241 bits (615),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            M TKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MFTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_009400896.1| PREDICTED: coatomer subunit alpha-3 [Musa acuminata subsp. malaccensis]
 ref|XP_009400897.1| PREDICTED: coatomer subunit alpha-3 [Musa acuminata subsp. malaccensis]
 ref|XP_009400898.1| PREDICTED: coatomer subunit alpha-3 [Musa acuminata subsp. malaccensis]
Length=1216

 Score =   241 bits (615),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPW+LASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWVLASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQ  115


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 52/130 (40%), Gaps = 26/130 (20%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR--------------------------CLFTLLGHLDYIRTVQFHHEY  535
            D  I+VW+    R                            + L GH   +    FH   
Sbjct  156  DQTIRVWDIGALRKKVAPADDILRLSQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTL  215

Query  536  PWIVSASDDQ  565
            P IVS +DD+
Sbjct  216  PLIVSGADDR  225


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH + +  V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSCVMFHAK  258

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  259  MEVIVSNSEDK  269



>ref|XP_007508098.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20589.1| predicted protein [Bathycoccus prasinos]
Length=1253

 Score =   241 bits (615),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 107/115 (93%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   TNQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVQFHVEHPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH     
Sbjct  209  HDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHARQDI  268

Query  542  IVSASDDQ  565
            IVS S+D+
Sbjct  269  IVSNSEDK  276



>ref|XP_002878550.1| hypothetical protein ARALYDRAFT_900556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54809.1| hypothetical protein ARALYDRAFT_900556 [Arabidopsis lyrata subsp. 
lyrata]
Length=1197

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115



>ref|XP_002888041.1| hypothetical protein ARALYDRAFT_475134 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64300.1| hypothetical protein ARALYDRAFT_475134 [Arabidopsis lyrata subsp. 
lyrata]
Length=1217

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKNHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|NP_176393.1| coatomer subunit alpha-1 [Arabidopsis thaliana]
 sp|Q94A40.2|COPA1_ARATH RecName: Full=Coatomer subunit alpha-1; AltName: Full=Alpha-coat 
protein 1; Short=Alpha-COP 1 [Arabidopsis thaliana]
 gb|AAC28519.1| Strong similarity to coatamer alpha subunit (HEPCOP) homolog 
gb|U24105 from Homo sapiens [Arabidopsis thaliana]
 gb|AEE33914.1| coatomer subunit alpha-1 [Arabidopsis thaliana]
Length=1216

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKNHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_006411704.1| hypothetical protein EUTSA_v10024240mg [Eutrema salsugineum]
 gb|ESQ53157.1| hypothetical protein EUTSA_v10024240mg [Eutrema salsugineum]
Length=1216

 Score =   240 bits (613),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK H+C FTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHKCNFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|KEH43347.1| coatomer subunit alpha-like protein [Medicago truncatula]
Length=1216

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQ  115



>ref|XP_004496148.1| PREDICTED: coatomer subunit alpha-1-like [Cicer arietinum]
Length=1218

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQ  115



>ref|XP_010672358.1| PREDICTED: coatomer subunit alpha-2-like [Beta vulgaris subsp. 
vulgaris]
Length=1211

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K+QPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_007144262.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
 ref|XP_007144263.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
 gb|ESW16256.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
 gb|ESW16257.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
Length=1218

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115



>ref|XP_001771211.1| predicted protein [Physcomitrella patens]
 gb|EDQ63922.1| predicted protein [Physcomitrella patens]
Length=1223

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSG+IQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGIIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+ RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMRRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_003536291.1| PREDICTED: coatomer subunit alpha-1-like [Glycine max]
Length=1218

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115



>gb|KHN37868.1| Coatomer subunit alpha-1 [Glycine soja]
Length=1218

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115



>ref|XP_003556297.1| PREDICTED: coatomer subunit alpha-2-like [Glycine max]
Length=1218

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115



>gb|KHN00939.1| Coatomer subunit alpha-1 [Glycine soja]
Length=1218

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115



>ref|XP_010066202.1| PREDICTED: coatomer subunit alpha-2-like [Eucalyptus grandis]
 gb|KCW64037.1| hypothetical protein EUGRSUZ_G01711 [Eucalyptus grandis]
Length=1218

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/115 (97%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLS HSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSLHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTCRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHTK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QEIIVSNSEDK  270



>ref|XP_001753855.1| predicted protein [Physcomitrella patens]
 gb|EDQ81177.1| predicted protein [Physcomitrella patens]
Length=1217

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSG+IQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGIIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+ RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMRRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010531460.1| PREDICTED: coatomer subunit alpha-1-like [Tarenaya hassleriana]
Length=1219

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRF+EH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFEEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   TSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHECPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 61/132 (46%), Gaps = 17/132 (13%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWD--YRMGTL-IDRFDEHDGPV--  382
            M   F  K + V   S   + R W + +L    +   D   R+G +  D F   D  V  
Sbjct  139  MCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMRLGQMNSDLFGGVDAIVKY  198

Query  383  ------RGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHH  529
                  RGV+   FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH 
Sbjct  199  VLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRVNDTKAWEVDTLRGHMNNVSCVMFHA  258

Query  530  EYPWIVSASDDQ  565
            +   IVS S+D+
Sbjct  259  KQDIIVSNSEDK  270



>ref|XP_010429041.1| PREDICTED: coatomer subunit alpha-2-like [Camelina sativa]
Length=1224

 Score =   239 bits (610),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010429048.1| PREDICTED: coatomer subunit alpha-2 [Camelina sativa]
 ref|XP_010429049.1| PREDICTED: coatomer subunit alpha-2 [Camelina sativa]
Length=1220

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010472129.1| PREDICTED: coatomer subunit alpha-2-like, partial [Camelina sativa]
Length=1118

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010416888.1| PREDICTED: coatomer subunit alpha-2-like [Camelina sativa]
Length=1221

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_006293578.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
 ref|XP_006293579.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
 gb|EOA26476.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
 gb|EOA26477.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
Length=1220

 Score =   239 bits (609),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|NP_179734.1| coatomer subunit alpha-2 [Arabidopsis thaliana]
 sp|Q9SJT9.1|COPA2_ARATH RecName: Full=Coatomer subunit alpha-2; AltName: Full=Alpha-coat 
protein 2; Short=Alpha-COP 2 [Arabidopsis thaliana]
 gb|AAD23699.1| coatomer alpha subunit [Arabidopsis thaliana]
 dbj|BAF00596.1| coatomer alpha subunit [Arabidopsis thaliana]
 gb|AEC07173.1| coatomer subunit alpha-2 [Arabidopsis thaliana]
Length=1218

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>emb|CEF97511.1| Coatomer, alpha subunit, C-terminal [Ostreococcus tauri]
Length=1222

 Score =   238 bits (608),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 106/115 (92%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVGFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVW+YKL RCLFTLLGHLDYIRTV+FH EYPWIVSASDDQ
Sbjct  61   ASQPLFVSGGDDYKIKVWSYKLRRCLFTLLGHLDYIRTVEFHAEYPWIVSASDDQ  115



>ref|XP_003567287.2| PREDICTED: coatomer subunit alpha-1-like [Brachypodium distachyon]
Length=277

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKG++FH +RPWILASLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGVAFHPRRPWILASLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQ  115



>gb|EMS45609.1| Coatomer subunit alpha-3 [Triticum urartu]
Length=1200

 Score =   238 bits (606),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLTGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_006404585.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
 ref|XP_006404586.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
 gb|ESQ46038.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
 gb|ESQ46039.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
Length=1214

 Score =   238 bits (606),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_002966115.1| hypothetical protein SELMODRAFT_85610 [Selaginella moellendorffii]
 gb|EFJ32142.1| hypothetical protein SELMODRAFT_85610 [Selaginella moellendorffii]
Length=1139

 Score =   237 bits (604),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMG+LIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQLWDYRMGSLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            +SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQ
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>gb|EMT27309.1| Coatomer subunit alpha-3 [Aegilops tauschii]
Length=1217

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLTGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_002982185.1| hypothetical protein SELMODRAFT_154977 [Selaginella moellendorffii]
 gb|EFJ16853.1| hypothetical protein SELMODRAFT_154977 [Selaginella moellendorffii]
Length=1216

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMG+LIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQLWDYRMGSLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            +SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQ
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010430239.1| PREDICTED: coatomer subunit alpha-1 [Camelina sativa]
Length=1216

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETK+NRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKNNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQ LFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   NSQSLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_001766709.1| predicted protein [Physcomitrella patens]
 gb|EDQ68562.1| predicted protein [Physcomitrella patens]
Length=1215

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHS+RPWILASLHSG+IQLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHSRRPWILASLHSGIIQLWDYRMGTLIDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK+ RCLFTLLGHLDYIRTV+FHHE PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMRRCLFTLLGHLDYIRTVKFHHESPWIVSASDDQ  115


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVLFHAR  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDVIVSNSEDK  270



>gb|ACN31006.1| unknown [Zea mays]
Length=251

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWIL+SLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILSSLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQ  115



>emb|CDY42637.1| BnaC01g00490D [Brassica napus]
Length=1068

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115



>emb|CDX90339.1| BnaA08g16450D [Brassica napus]
Length=904

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>emb|CDY53172.1| BnaA06g40510D [Brassica napus]
Length=831

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>emb|CDY41989.1| BnaA01g05610D [Brassica napus]
Length=850

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_005710742.1| Coatomer subunit alpha, WD40 repeat-containing protein [Chondrus 
crispus]
 emb|CDF40448.1| Coatomer subunit alpha, WD40 repeat-containing protein [Chondrus 
crispus]
Length=1269

 Score =   236 bits (603),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 101/115 (88%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH  RPWILASLH+G IQLWDYRMGTLIDRFDEH+GPVRG+ FH
Sbjct  1    MLTKFETKSNRVKGLAFHPTRPWILASLHNGAIQLWDYRMGTLIDRFDEHEGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            +SQPLFVSGGDDYKIKVWNYKL RC+FTL+GHLDYIRTV FHHE PWIVSASDDQ
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKLRRCIFTLIGHLDYIRTVYFHHESPWIVSASDDQ  115



>ref|XP_009397879.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
Length=1216

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDY MGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYSMGTLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 61/131 (47%), Gaps = 16/131 (12%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWD-YRMGTL-IDRFDEHDGPV---  382
            M   F  K + V   S   + R W + SL   V+   D  R+  +  D F   D  V   
Sbjct  139  MCASFHPKEDLVVSASLDQTIRVWDIGSLRQKVVPADDILRLSQMNTDLFGGIDAVVKYV  198

Query  383  -----RGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
                 RGV+   FH + PL VSG DD ++K+W     +   + TL GH + + +V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSSVMFHTK  258

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  259  MDIIVSNSEDK  269



>ref|XP_009101857.1| PREDICTED: coatomer subunit alpha-2-like [Brassica rapa]
Length=1230

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_008646256.1| PREDICTED: uncharacterized protein LOC100384351 isoform X1 [Zea 
mays]
 tpg|DAA50981.1| TPA: hypothetical protein ZEAMMB73_408440 [Zea mays]
Length=1218

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>tpg|DAA52914.1| TPA: hypothetical protein ZEAMMB73_412502 [Zea mays]
Length=258

 Score =   220 bits (561),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWIL+SLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILSSLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQ  115



>ref|XP_002466586.1| hypothetical protein SORBIDRAFT_01g010390 [Sorghum bicolor]
 gb|EER93584.1| hypothetical protein SORBIDRAFT_01g010390 [Sorghum bicolor]
Length=1217

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|NP_001051056.1| Os03g0711400 [Oryza sativa Japonica Group]
 sp|Q9AUR8.1|COPA1_ORYSJ RecName: Full=Coatomer subunit alpha-1; AltName: Full=Alpha-coat 
protein 1; Short=Alpha-COP 1 [Oryza sativa Japonica Group]
 gb|AAK18834.1|AC082645_4 putative alpha-coat protein [Oryza sativa Japonica Group]
 gb|ABF98513.1| Coatomer alpha subunit, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12970.1| Os03g0711400 [Oryza sativa Japonica Group]
 gb|EAZ28339.1| hypothetical protein OsJ_12317 [Oryza sativa Japonica Group]
 dbj|BAG94532.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1218

 Score =   236 bits (601),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_005759442.1| COPA1, alpha subunit of the coatomer [Emiliania huxleyi CCMP1516]
 gb|EOD07013.1| COPA1, alpha subunit of the coatomer [Emiliania huxleyi CCMP1516]
Length=1250

 Score =   236 bits (601),  Expect = 5e-68, Method: Composition-based stats.
 Identities = 102/115 (89%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FHS RPW+LASLH+GV+QLWD+RMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLAFHSSRPWVLASLHNGVVQLWDFRMGTLIDRFDEHDGPVRGVCFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            +SQPLFV+GGDDYKIKVWNYKL RCLF+LLGHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   QSQPLFVTGGDDYKIKVWNYKLRRCLFSLLGHLDYIRTVQFHVEHPWIVSASDDQ  115



>ref|XP_009101859.1| PREDICTED: coatomer subunit alpha-2 [Brassica rapa]
Length=1220

 Score =   236 bits (601),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 58/132 (44%), Gaps = 17/132 (13%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWDYRM-------------GTLIDR  358
            M   F  K + V   S   + R W + SL    +   D  M               ++  
Sbjct  139  MCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDLMRFTQMNSDLFGGVDAIVKY  198

Query  359  FDE-HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHH  529
            F E HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH 
Sbjct  199  FLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHA  258

Query  530  EYPWIVSASDDQ  565
            +   IVS S+D+
Sbjct  259  KQDIIVSNSEDK  270



>emb|CDY53168.1| BnaA06g40470D [Brassica napus]
Length=1208

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_009109461.1| PREDICTED: coatomer subunit alpha-2-like [Brassica rapa]
Length=1221

 Score =   236 bits (601),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_006743501.1| PREDICTED: coatomer subunit alpha-like [Leptonychotes weddellii]
Length=838

 Score =   233 bits (594),  Expect = 5e-68, Method: Composition-based stats.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_006411687.1| hypothetical protein EUTSA_v10024239mg [Eutrema salsugineum]
 gb|ESQ53140.1| hypothetical protein EUTSA_v10024239mg [Eutrema salsugineum]
Length=1221

 Score =   235 bits (600),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDY IKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYTIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQ  115


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD +IK+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQIKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_003523472.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006578995.1| PREDICTED: coatomer subunit alpha-1-like isoform X2 [Glycine 
max]
Length=1206

 Score =   235 bits (600),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTL+DRF+EH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHKKRPWILASLHSGVIQLWDYRMGTLVDRFEEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIK+WNYKLHRCLF+LLGHLDY+RTVQFHHE PWIVSASDDQ
Sbjct  61   DSQPLFVSGGDDYKIKLWNYKLHRCLFSLLGHLDYVRTVQFHHESPWIVSASDDQ  115


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 52/121 (43%), Gaps = 17/121 (14%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            V+ + FH + PWI+++     I++W+++  T I     H+  V    FH    L VS   
Sbjct  96   VRTVQFHHESPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPRDDLLVSASL  155

Query  434  DYKIKVWNYKLHR-----------------CLFTLLGHLDYIRTVQFHHEYPWIVSASDD  562
            D  ++VW+    R                   + L GH   +    FH   P IVSA+DD
Sbjct  156  DQTLRVWDISPLRKKSPSSDDMPFGSPDAVVKYVLEGHDRGVNWASFHPALPLIVSAADD  215

Query  563  Q  565
            +
Sbjct  216  R  216



>dbj|BAE42571.1| unnamed protein product [Mus musculus]
 gb|EDL39043.1| coatomer protein complex subunit alpha, isoform CRA_b [Mus musculus]
Length=129

 Score =   215 bits (547),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>gb|EPS70817.1| hypothetical protein M569_03938, partial [Genlisea aurea]
Length=1229

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/116 (95%), Positives = 113/116 (97%), Gaps = 1/116 (1%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDG-PVRGVHF  397
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGT ID+FDEH G PVRGVHF
Sbjct  11   MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTRIDQFDEHAGVPVRGVHF  70

Query  398  HKSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            HKSQPLFVSGGDD+KIKVWNYKLHRCLFTLLGHLDY+RTVQFHHEYPWIVSASDDQ
Sbjct  71   HKSQPLFVSGGDDFKIKVWNYKLHRCLFTLLGHLDYVRTVQFHHEYPWIVSASDDQ  126


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  211  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAK  270

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  271  QDIIVSNSEDK  281



>ref|XP_009526440.1| hypothetical protein PHYSODRAFT_545018 [Phytophthora sojae]
 gb|EGZ17382.1| hypothetical protein PHYSODRAFT_545018 [Phytophthora sojae]
Length=1229

 Score =   234 bits (597),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 100/115 (87%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQ
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQ  115



>gb|EWM26143.1| Coatomer, WD associated region [Nannochloropsis gaditana]
Length=1272

 Score =   234 bits (597),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 101/115 (88%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGLSFH  RPWI+ SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLSFHPVRPWIITSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K+QPL VSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQ
Sbjct  61   KTQPLIVSGGDDYKVKVWDYKLRRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQ  115



>ref|XP_008610604.1| coatomer protein complex, subunit alpha (xenin) [Saprolegnia 
diclina VS20]
 gb|EQC35842.1| coatomer protein complex, subunit alpha (xenin) [Saprolegnia 
diclina VS20]
Length=1225

 Score =   234 bits (596),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL FH  RPW+L SLH+GVIQLWD+RMGTLIDRFDEHDGPVR V FH
Sbjct  1    MLTKFESKSNRVKGLCFHPSRPWVLTSLHNGVIQLWDFRMGTLIDRFDEHDGPVRSVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWIVS SDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSCSDDQ  115



>ref|XP_002896974.1| coatomer protein complex, putative [Phytophthora infestans T30-4]
 gb|EEY66455.1| coatomer protein complex, putative [Phytophthora infestans T30-4]
Length=1243

 Score =   234 bits (596),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 100/115 (87%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQ
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQ  115



>ref|XP_008892963.1| hypothetical protein PPTG_01415 [Phytophthora parasitica INRA-310]
 gb|ETN21137.1| hypothetical protein PPTG_01415 [Phytophthora parasitica INRA-310]
Length=1243

 Score =   234 bits (596),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 100/115 (87%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQ
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQ  115


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = +2

Query  368  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  541
            HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  Y  
Sbjct  210  HDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPRYEL  269

Query  542  IVSASDDQ  565
            I+S S+D+
Sbjct  270  IISNSEDR  277



>gb|ETM45336.1| hypothetical protein L914_09580 [Phytophthora parasitica]
Length=1243

 Score =   234 bits (596),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 100/115 (87%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQ
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQ  115



>gb|ETL92039.1| hypothetical protein L917_09539 [Phytophthora parasitica]
 gb|ETO74204.1| hypothetical protein F444_10006 [Phytophthora parasitica P1976]
Length=1243

 Score =   234 bits (596),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 100/115 (87%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQ
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQ  115



>gb|ETK85490.1| hypothetical protein L915_09709 [Phytophthora parasitica]
 gb|ETP43418.1| hypothetical protein F442_09816 [Phytophthora parasitica P10297]
Length=1243

 Score =   234 bits (596),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 100/115 (87%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQ
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQ  115



>gb|ETP15371.1| hypothetical protein F441_09860 [Phytophthora parasitica CJ01A1]
Length=1243

 Score =   233 bits (595),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 100/115 (87%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQ
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQ  115



>gb|ETI45564.1| hypothetical protein F443_09913 [Phytophthora parasitica P1569]
 gb|ETL38915.1| hypothetical protein L916_09614 [Phytophthora parasitica]
Length=1243

 Score =   233 bits (595),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 100/115 (87%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQ
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQ  115



>ref|XP_009400691.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400692.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
Length=1216

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            ML+KFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMG+LIDRF+EHDGPVRG+HFH
Sbjct  1    MLSKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGSLIDRFEEHDGPVRGLHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   KLQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQ  115


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 52/130 (40%), Gaps = 26/130 (20%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEHPWIVSASDDQTIRIWNWQSRTCISALTGHNHFVMSASFHPKEDLLVSASL  155

Query  434  DYKIKVWNYKLHR--------------------------CLFTLLGHLDYIRTVQFHHEY  535
            D  I+VW+    R                            + L GH   +    FH   
Sbjct  156  DQTIRVWDISALRKKMAPADDILHLSQMNSDFFGGIDAVVKYVLEGHDRGVNWASFHPTL  215

Query  536  PWIVSASDDQ  565
            P IVS +DD+
Sbjct  216  PLIVSGADDR  225


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH + +  V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSCVMFHAK  258

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  259  MEIIVSNSEDK  269



>emb|CBN77093.1| Vesicle coat complex COPI, alpha subunit [Ectocarpus siliculosus]
Length=1258

 Score =   233 bits (594),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 101/115 (88%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGLSFH  RPWIL SLH+G+IQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLSFHPIRPWILTSLHNGIIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K+QPL VSGGDDYKIKVW+YKL RCLFTLLGHLDYIRTVQFH+EYPWI+SASDDQ
Sbjct  61   KTQPLIVSGGDDYKIKVWDYKLRRCLFTLLGHLDYIRTVQFHNEYPWIISASDDQ  115



>ref|XP_006650487.1| PREDICTED: coatomer subunit alpha-3-like [Oryza brachyantha]
Length=1219

 Score =   232 bits (592),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_010229358.1| PREDICTED: coatomer subunit alpha-3 [Brachypodium distachyon]
Length=1218

 Score =   232 bits (591),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH +RPWILASLHSGV+Q+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVVQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQ  115



>emb|CDY13820.1| BnaA09g43220D [Brassica napus]
Length=486

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFET SN+V+GLSFH KRPWIL+SLH+GVIQLWDYRM TLID F+EHDGPVRGVHFH
Sbjct  1    MLTKFETSSNQVRGLSFHPKRPWILSSLHTGVIQLWDYRMATLIDTFEEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK H+CLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   ISQPLFVSGGDDYKIKVWNYKTHKCLFTLLGHLDYIRTVQFHHECPWIVSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD K+K+W     +   + TL GH   + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRKVKLWRTNETKAWEVDTLRGHSSNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
            +  IVS S+D+
Sbjct  260  HDVIVSNSEDK  270



>ref|XP_004333061.1| alphaCOP, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR11048.1| alphaCOP, putative [Acanthamoeba castellanii str. Neff]
Length=1217

 Score =   232 bits (591),  Expect = 9e-67, Method: Composition-based stats.
 Identities = 101/115 (88%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTK ETKSNRVKGLSFH KRPWILASLH+G+IQLWDYR+ TL+DRFDEHDGPVRG+ FH
Sbjct  1    MLTKLETKSNRVKGLSFHPKRPWILASLHNGLIQLWDYRIRTLLDRFDEHDGPVRGISFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYKL RCLFTLLGH+DYIRTVQFHHEYPWI+SASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHMDYIRTVQFHHEYPWILSASDDQ  115


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 62/115 (54%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            +L +F+     V+G+SFH+ +P  ++      I++W+Y++   +     H   +R V FH
Sbjct  43   LLDRFDEHDGPVRGISFHATQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHMDYIRTVQFH  102

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
               P  +S  DD  I++WN++   C+  L GH  Y+ +  FH +   +VSAS DQ
Sbjct  103  HEYPWILSASDDQTIRIWNWQSRTCIAVLTGHNHYVMSAYFHPKEDLVVSASLDQ  157


 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 30/132 (23%), Positives = 53/132 (40%), Gaps = 28/132 (21%)
 Frame = +2

Query  254  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  433
            ++ + FH + PWIL++     I++W+++  T I     H+  V   +FH  + L VS   
Sbjct  96   IRTVQFHHEYPWILSASDDQTIRIWNWQSRTCIAVLTGHNHYVMSAYFHPKEDLVVSASL  155

Query  434  DYKIKVWNYKLHR----------------------------CLFTLLGHLDYIRTVQFHH  529
            D  +++W+    +                              + L GH   +    FH 
Sbjct  156  DQTVRIWDISGLKKKNVSPTGGLDDPLRLAQNDLFGNPNVVVKYVLEGHDRGVNWAAFHP  215

Query  530  EYPWIVSASDDQ  565
              P IVS +DD+
Sbjct  216  SLPLIVSGADDR  227



>ref|XP_002990232.1| hypothetical protein SELMODRAFT_447957 [Selaginella moellendorffii]
 gb|EFJ08647.1| hypothetical protein SELMODRAFT_447957 [Selaginella moellendorffii]
Length=1213

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLT FETKSNRVKGLSFH KRPWILASLH+GVI LWDYRMG+LIDRFDEHDGPVRGVHFH
Sbjct  1    MLTTFETKSNRVKGLSFHPKRPWILASLHTGVIHLWDYRMGSLIDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKARRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQ  115



>ref|XP_003564667.1| PREDICTED: coatomer subunit alpha-3-like [Brachypodium distachyon]
Length=1219

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWILASLHSGV+Q+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILASLHSGVVQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQ  115



>ref|XP_002455000.1| hypothetical protein SORBIDRAFT_03g002780 [Sorghum bicolor]
 gb|EES00120.1| hypothetical protein SORBIDRAFT_03g002780 [Sorghum bicolor]
Length=1122

 Score =   230 bits (587),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 100/115 (87%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RP I +SLHSGVIQ+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPRIRSSLHSGVIQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQ  115



>ref|XP_002961902.1| hypothetical protein SELMODRAFT_77651 [Selaginella moellendorffii]
 gb|EFJ37162.1| hypothetical protein SELMODRAFT_77651 [Selaginella moellendorffii]
Length=1213

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLT FETKSNRVKGLSFH KRPWILASLH+GVI LWDYRMG+LIDRFDEHDGPVRG+HFH
Sbjct  1    MLTTFETKSNRVKGLSFHPKRPWILASLHTGVIHLWDYRMGSLIDRFDEHDGPVRGIHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQ
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKARRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQ  115



>emb|CDX82024.1| BnaC08g35770D [Brassica napus]
Length=472

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFET SN+V+GLSFH KRPWIL+SLH+G IQLWDYRM TLID F+EHDGPVRGVHFH
Sbjct  1    MLTKFETSSNQVRGLSFHPKRPWILSSLHTGAIQLWDYRMATLIDTFEEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK H+CLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   ISQPLFVSGGDDYKIKVWNYKTHKCLFTLLGHLDYIRTVQFHHECPWIVSASDDQ  115



>gb|AAI50356.1| Copa protein [Danio rerio]
Length=538

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_005704483.1| coatomer (COPI) alpha subunit [Galdieria sulphuraria]
 gb|EME27963.1| coatomer (COPI) alpha subunit [Galdieria sulphuraria]
Length=1312

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGLSFH  RPWILASLH+GVIQLWDYRMGTL+DRF+EH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPARPWILASLHNGVIQLWDYRMGTLLDRFEEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTV FHHE PWIVSASDDQ
Sbjct  61   PSQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVFFHHESPWIVSASDDQ  115



>ref|XP_005768226.1| COPA1, alpha subunit of the coatomer, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD15797.1| COPA1, alpha subunit of the coatomer, partial [Emiliania huxleyi 
CCMP1516]
Length=803

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FHS RPW+LASLH+GV+QLWD+RMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLAFHSSRPWVLASLHNGVVQLWDFRMGTLIDRFDEHDGPVRGVCFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            +SQPLFV+GGDDYKIKVWNYKL RCLF+LLGHLDYIRTVQFH E+PWIVSASDDQ
Sbjct  61   QSQPLFVTGGDDYKIKVWNYKLRRCLFSLLGHLDYIRTVQFHVEHPWIVSASDDQ  115



>emb|CDQ86226.1| unnamed protein product [Oncorhynchus mykiss]
Length=512

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHH+YPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHDYPWILSASDDQ  115



>gb|KDO30127.1| hypothetical protein SPRG_19862 [Saprolegnia parasitica CBS 223.65]
Length=1002

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL FH  RPW+L SLH+GVIQLWD+RMGTLIDRFDEHDGPVR V FH
Sbjct  1    MLTKFESKSNRVKGLCFHPSRPWVLTSLHNGVIQLWDFRMGTLIDRFDEHDGPVRSVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            KSQPLFVSGGDDYKIKVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWIVS SDDQ
Sbjct  61   KSQPLFVSGGDDYKIKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSCSDDQ  115



>ref|XP_008672096.1| PREDICTED: uncharacterized protein LOC100192909 isoform X1 [Zea 
mays]
Length=1217

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKSNRVKGL+FH +RPWIL+SLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILSSLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQ  115


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  533  YPWIVSASDDQ  565
               IVS S+D+
Sbjct  260  QDIIVSNSEDK  270



>ref|XP_008544952.1| PREDICTED: coatomer subunit alpha [Microplitis demolitor]
Length=1218

 Score =   226 bits (576),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 98/115 (85%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TL+++FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLLEKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
              QPLFVSGGDDYKIKVWNYK  RC+FTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   NQQPLFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTVFHHEYPWILSASDDQ  115



>dbj|BAE02266.1| unnamed protein product [Macaca fascicularis]
Length=672

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_002878551.1| hypothetical protein ARALYDRAFT_900557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54810.1| hypothetical protein ARALYDRAFT_900557 [Arabidopsis lyrata subsp. 
lyrata]
Length=1151

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKF+TKSNRVKGLSFH KRPWILASLHSGVIQLWDYR+GTLID+FD H GPVRGVHFH
Sbjct  1    MLTKFKTKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRVGTLIDKFDGHQGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDD KIKVWNYK H CLFTLLGHLDYIRTVQFHHEYPWI+SASDDQ
Sbjct  61   TSQPLFVSGGDDCKIKVWNYKTHWCLFTLLGHLDYIRTVQFHHEYPWILSASDDQ  115


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 60/132 (45%), Gaps = 17/132 (13%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWD--YRMGTL-IDRFDEHDGPV--  382
            M   F  K + V   S   + R W + +L    +   D   R+  +  D FD  D  V  
Sbjct  139  MCASFHPKDDLVVSASLDQTVRVWEIGALKKKTVSPSDDIMRLAEINSDLFDSVDVTVKY  198

Query  383  ------RGV---HFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHH  529
                  RGV    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH 
Sbjct  199  VLEGHERGVIWAAFHPNLPLIVSGSDDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHA  258

Query  530  EYPWIVSASDDQ  565
            +   IVS S+D 
Sbjct  259  KQDIIVSNSEDN  270



>ref|XP_008862869.1| hypothetical protein H310_01524 [Aphanomyces invadans]
 gb|ETW09064.1| hypothetical protein H310_01524 [Aphanomyces invadans]
Length=1240

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL FH  RPW+L SLH+GVIQLWD+RMGTLIDRFDEHDGPVR V FH
Sbjct  1    MLTKFESKSNRVKGLCFHPSRPWVLTSLHNGVIQLWDFRMGTLIDRFDEHDGPVRSVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K+QPLFVSGGDDYKIKVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWIVS SDDQ
Sbjct  61   KTQPLFVSGGDDYKIKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSCSDDQ  115



>emb|CDS11681.1| hypothetical protein LRAMOSA03944 [Absidia idahoensis var. thermophila]
Length=1233

 Score =   225 bits (573),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 96/115 (83%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKG++FH KRPWILASLH+G IQLWDYRMGTL++RFDEHDGPVRG+ FH
Sbjct  3    MLTKFESKSNRVKGIAFHPKRPWILASLHNGSIQLWDYRMGTLLERFDEHDGPVRGIAFH  62

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWN+K  RCLFTL GHLDY+RTV FHHEYPWI+SASDDQ
Sbjct  63   PTQPLFVSGGDDYKIKVWNHKTRRCLFTLSGHLDYVRTVYFHHEYPWIISASDDQ  117



>emb|CDH50700.1| coatomer alpha subunit [Lichtheimia corymbifera JMRC:FSU:9682]
Length=1233

 Score =   225 bits (573),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 96/115 (83%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKG++FH KRPWILASLH+G IQLWDYRMGTL++RFDEHDGPVRG+ FH
Sbjct  3    MLTKFESKSNRVKGIAFHPKRPWILASLHNGSIQLWDYRMGTLLERFDEHDGPVRGIAFH  62

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWN+K  RCLFTL GHLDY+RTV FHHEYPWI+SASDDQ
Sbjct  63   PTQPLFVSGGDDYKIKVWNHKTRRCLFTLSGHLDYVRTVYFHHEYPWIISASDDQ  117



>ref|XP_011172118.1| PREDICTED: coatomer subunit alpha [Solenopsis invicta]
 gb|EFZ10037.1| hypothetical protein SINV_04529 [Solenopsis invicta]
Length=1209

 Score =   224 bits (572),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 97/115 (84%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM  L+D+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCALLDKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
              QPLFVSGGDDYKIKVWNYK  RC+FTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   NQQPLFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTMFHHEYPWILSASDDQ  115



>ref|XP_009821126.1| hypothetical protein H257_00241 [Aphanomyces astaci]
 gb|ETV88726.1| hypothetical protein H257_00241 [Aphanomyces astaci]
Length=1241

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKGL FH  RPW+L+SLH+GVIQLWD+RMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLCFHPTRPWVLSSLHNGVIQLWDFRMGTLIDRFDEHDGPVRGVDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K+QPLFVSGGDDYKIKVW+YKL RCLFTLLGHLDYIR+VQFHHEYPWI S SDDQ
Sbjct  61   KTQPLFVSGGDDYKIKVWDYKLRRCLFTLLGHLDYIRSVQFHHEYPWITSCSDDQ  115



>emb|CDQ67339.1| unnamed protein product [Oncorhynchus mykiss]
Length=1223

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_010888093.1| PREDICTED: coatomer subunit alpha [Esox lucius]
Length=1222

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|NP_001133825.1| Coatomer subunit alpha [Salmo salar]
 gb|ACI33965.1| Coatomer subunit alpha [Salmo salar]
Length=1307

 Score =   224 bits (571),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>gb|AAI62474.1| Copa protein [Danio rerio]
Length=1224

 Score =   223 bits (569),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_011345251.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha [Cerapachys 
biroi]
Length=1206

 Score =   223 bits (569),  Expect = 9e-64, Method: Composition-based stats.
 Identities = 97/115 (84%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TL+D+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLLDKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
              QPLFVSGGDDYKIKVWNYK  RC+FTLLGHLDYIRT  FH EYPWI+SASDDQ
Sbjct  61   NQQPLFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTMFHQEYPWILSASDDQ  115



>gb|EZA50399.1| Coatomer subunit alpha [Cerapachys biroi]
Length=1195

 Score =   223 bits (569),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 97/115 (84%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TL+D+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLLDKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
              QPLFVSGGDDYKIKVWNYK  RC+FTLLGHLDYIRT  FH EYPWI+SASDDQ
Sbjct  61   NQQPLFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTMFHQEYPWILSASDDQ  115



>ref|XP_007234429.1| PREDICTED: coatomer subunit alpha-like [Astyanax mexicanus]
Length=1224

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|NP_001001941.2| coatomer subunit alpha [Danio rerio]
 gb|AAT68072.1| cotamer alpha [Danio rerio]
Length=1224

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_010750764.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha [Larimichthys 
crocea]
Length=1222

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>gb|AAQ63170.1| coatomer protein complex subunit alpha [Danio rerio]
Length=1226

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_011298436.1| PREDICTED: coatomer subunit alpha [Fopius arisanus]
 ref|XP_011298437.1| PREDICTED: coatomer subunit alpha [Fopius arisanus]
Length=1216

 Score =   223 bits (569),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 97/115 (84%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TL+++FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLLEKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
              QPLFVSGGDDYKIKVWNYK  RC+FTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   NQQPLFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>gb|EPB85739.1| coatomer protein complex, subunit alpha (xenin) [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=1257

 Score =   223 bits (569),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKG+SFH+KRPWILASLH+G IQLWDYRMGTLI+RF+EH GPVRG+ FH
Sbjct  3    MLTKFESKSNRVKGISFHAKRPWILASLHNGCIQLWDYRMGTLIERFEEHQGPVRGIAFH  62

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKI+VWNYK  +CLFTL GHLDY+RTV FHHEYPWI+SASDDQ
Sbjct  63   STQPLFVSGGDDYKIRVWNYKTRKCLFTLNGHLDYVRTVYFHHEYPWIISASDDQ  117


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/115 (34%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            ++ +FE     V+G++FHS +P  ++      I++W+Y+    +   + H   VR V+FH
Sbjct  45   LIERFEEHQGPVRGIAFHSTQPLFVSGGDDYKIRVWNYKTRKCLFTLNGHLDYVRTVYFH  104

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
               P  +S  DD  I++WN++  +C+  L GH  Y+ + QFH    +IVSAS DQ
Sbjct  105  HEYPWIISASDDQTIRIWNWQSRKCIAILTGHNHYVMSAQFHPTQDYIVSASMDQ  159



>ref|XP_009117406.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-2 [Brassica 
rapa]
Length=1062

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFET SN+V+GLSFH KRPWIL+SLH+GVIQLWDYRM TLID F+EH+GPVRGVHFH
Sbjct  1    MLTKFETSSNQVRGLSFHPKRPWILSSLHTGVIQLWDYRMTTLIDTFEEHEGPVRGVHFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             SQPLFVSGGDDYKIKVWNYK H+CLFTLLGHLDYIRTVQFHHE PWIVSASDDQ
Sbjct  61   ISQPLFVSGGDDYKIKVWNYKTHKCLFTLLGHLDYIRTVQFHHECPWIVSASDDQ  115


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +2

Query  359  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  532
             + HD  V    FH + PL VSG DD K+K+W     +   + TL GH   + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRKVKLWRTNETKAWEVDTLRGHSSNVSSVMFHAK  259

Query  533  YPWIVSASDDQ  565
            +  IVS S+D+
Sbjct  260  HDVIVSNSEDK  270



>ref|XP_623198.1| PREDICTED: coatomer subunit alpha isoform 1 [Apis mellifera]
Length=1214

 Score =   223 bits (568),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 97/115 (84%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TL+D+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLLDKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
              QPLFVSGGDDYKIKVWNYK  RC+FTLLGHLDYIRT  FH EYPWI+SASDDQ
Sbjct  61   NQQPLFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTVFHQEYPWILSASDDQ  115



>ref|XP_006622894.1| PREDICTED: coatomer subunit alpha-like [Apis dorsata]
Length=1214

 Score =   223 bits (568),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 97/115 (84%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TL+D+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLLDKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
              QPLFVSGGDDYKIKVWNYK  RC+FTLLGHLDYIRT  FH EYPWI+SASDDQ
Sbjct  61   NQQPLFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTVFHQEYPWILSASDDQ  115



>ref|XP_005796611.1| PREDICTED: coatomer subunit alpha-like isoform X2 [Xiphophorus 
maculatus]
Length=1222

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_004210494.1| PREDICTED: coatomer subunit alpha-like, partial [Hydra vulgaris]
Length=559

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGL+FHSKRPW+LASLH+GVIQLWDYRM TL+DRFDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLAFHSKRPWVLASLHNGVIQLWDYRMCTLLDRFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            ++QPLFVSGGDDYKIKVWNYK  +C+FTLLGHLDYIRT  FHHEYPWIVS SDDQ
Sbjct  61   ENQPLFVSGGDDYKIKVWNYKQKKCIFTLLGHLDYIRTTFFHHEYPWIVSCSDDQ  115



>ref|XP_003978283.1| PREDICTED: coatomer subunit alpha-like [Takifugu rubripes]
Length=1222

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_796805.3| PREDICTED: coatomer subunit alpha-like [Strongylocentrotus purpuratus]
Length=1802

 Score =   224 bits (571),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 98/115 (85%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGL FH  RPWILASLH+G IQLWDYRM TL+++FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLCFHPNRPWILASLHNGNIQLWDYRMCTLLEKFDEHDGPVRGISFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            + QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWIVSASDDQ
Sbjct  61   QQQPLFVSGGDDYKIKVWNYKLKRCLFTLLGHLDYIRTTFFHHEYPWIVSASDDQ  115


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            +L KF+     V+G+SFH ++P  ++      I++W+Y++   +     H   +R   FH
Sbjct  43   LLEKFDEHDGPVRGISFHQQQPLFVSGGDDYKIKVWNYKLKRCLFTLLGHLDYIRTTFFH  102

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
               P  VS  DD  I++WN++   C   L GH  Y+    FH     +VSAS DQ
Sbjct  103  HEYPWIVSASDDQTIRIWNWQSRNCACVLTGHNHYVMCANFHPSEDLVVSASLDQ  157



>ref|XP_005796610.1| PREDICTED: coatomer subunit alpha-like isoform X1 [Xiphophorus 
maculatus]
Length=1232

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_008293242.1| PREDICTED: coatomer subunit alpha [Stegastes partitus]
Length=1222

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_009496181.1| hypothetical protein H696_04035 [Fonticula alba]
 gb|KCV69616.1| hypothetical protein H696_04035 [Fonticula alba]
Length=914

 Score =   221 bits (562),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 91/115 (79%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            ML KFETKSNRVKG++FH +RPW++ASLH+GVIQLWDYR+  L+DRFDEH+GPVR V FH
Sbjct  17   MLVKFETKSNRVKGVAFHPRRPWVIASLHTGVIQLWDYRVAVLLDRFDEHEGPVRTVSFH  76

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYK+KVWNYK  RCLFTL GH DYIRTV FHHEYPWI+SASDDQ
Sbjct  77   ATQPLFVSGGDDYKVKVWNYKQRRCLFTLTGHQDYIRTVAFHHEYPWIISASDDQ  131



>ref|XP_008432228.1| PREDICTED: coatomer subunit alpha [Poecilia reticulata]
Length=1222

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_006792415.1| PREDICTED: coatomer subunit alpha-like [Neolamprologus brichardi]
Length=1222

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|NP_001166192.1| coatomer protein complex subunit alpha [Bombyx mori]
 gb|ADB66734.1| coatomer protein complex subunit alpha [Bombyx mori]
Length=1230

 Score =   223 bits (568),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 96/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            ML KFETKS RVKG+SFH+KRPW+LASLH+GVIQLWDYRM TL+++FDEHDGPVRG+ FH
Sbjct  1    MLKKFETKSARVKGISFHAKRPWVLASLHNGVIQLWDYRMCTLLEKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
              QPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   IQQPLFVSGGDDYKIKVWNYKQRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_007552064.1| PREDICTED: coatomer subunit alpha [Poecilia formosa]
Length=1222

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_004078629.1| PREDICTED: coatomer subunit alpha [Oryzias latipes]
Length=1219

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_003447511.1| PREDICTED: coatomer subunit alpha-like [Oreochromis niloticus]
Length=1222

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_005918171.1| PREDICTED: coatomer subunit alpha-like [Haplochromis burtoni]
Length=1223

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_004555248.1| PREDICTED: coatomer subunit alpha-like [Maylandia zebra]
Length=1222

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_011269171.1| PREDICTED: coatomer subunit alpha [Camponotus floridanus]
 gb|EFN72866.1| Coatomer subunit alpha [Camponotus floridanus]
Length=1208

 Score =   223 bits (567),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 97/115 (84%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TL+D+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLLDKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
              QPLFVSGGDDYKIKVWNYK  RC+FTLLGHLDYIRT  FH EYPWI+SASDDQ
Sbjct  61   NQQPLFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTVFHQEYPWILSASDDQ  115



>ref|XP_005729030.1| PREDICTED: coatomer subunit alpha-like isoform X2 [Pundamilia 
nyererei]
Length=1217

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_005729029.1| PREDICTED: coatomer subunit alpha-like isoform X1 [Pundamilia 
nyererei]
Length=1225

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_006999128.1| PREDICTED: LOW QUALITY PROTEIN: coatomer protein complex, subunit 
alpha [Peromyscus maniculatus bairdii]
Length=1133

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>gb|KFB45492.1| AGAP010251-PA-like protein [Anopheles sinensis]
Length=1230

 Score =   223 bits (567),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 96/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLT FETKS RVKGLSFH KRPWILASLHSGVIQLWDYR+ TLI++FDEHDGPVRG+ FH
Sbjct  1    MLTNFETKSARVKGLSFHPKRPWILASLHSGVIQLWDYRISTLIEKFDEHDGPVRGIAFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
              QPLFVSGGDD+KIKVWNYK  RC+FTLLGHLDY+RT  FHHEYPWI+SASDDQ
Sbjct  61   NQQPLFVSGGDDFKIKVWNYKQRRCIFTLLGHLDYVRTTVFHHEYPWILSASDDQ  115


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/116 (33%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            ++ KF+     V+G++FH+++P  ++      I++W+Y+    I     H   VR   FH
Sbjct  43   LIEKFDEHDGPVRGIAFHNQQPLFVSGGDDFKIKVWNYKQRRCIFTLLGHLDYVRTTVFH  102

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFH-HEYPWIVSASDDQ  565
               P  +S  DD  I++WN++   C+  L GH  Y+   QFH  +   IVSAS DQ
Sbjct  103  HEYPWILSASDDQTIRIWNWQSRSCICVLTGHNHYVMCAQFHPSDEDIIVSASLDQ  158



>ref|XP_005368658.1| PREDICTED: coatomer subunit alpha [Microtus ochrogaster]
Length=1180

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_008152467.1| PREDICTED: coatomer subunit alpha isoform X1 [Eptesicus fuscus]
Length=1232

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_006096969.1| PREDICTED: coatomer subunit alpha isoform X1 [Myotis lucifugus]
Length=1232

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_008494291.1| PREDICTED: coatomer subunit alpha isoform X2 [Calypte anna]
Length=1224

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_008152468.1| PREDICTED: coatomer subunit alpha isoform X2 [Eptesicus fuscus]
Length=1223

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_002801923.1| PREDICTED: coatomer subunit alpha-like [Macaca mulatta]
Length=1138

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_005141102.1| PREDICTED: coatomer subunit alpha [Melopsittacus undulatus]
Length=1224

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_004775909.1| PREDICTED: coatomer subunit alpha isoform X1 [Mustela putorius 
furo]
 ref|XP_004819830.1| PREDICTED: coatomer subunit alpha isoform X1 [Mustela putorius 
furo]
Length=1233

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_006096970.1| PREDICTED: coatomer subunit alpha isoform X2 [Myotis lucifugus]
Length=1223

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>gb|EIE80782.1| coatomer protein alpha subunit [Rhizopus delemar RA 99-880]
Length=1230

 Score =   222 bits (566),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFE+KSNRVKG++FH KRPWILASLH+G IQLWDYRMGTL++RF+EHDGPVRG+ FH
Sbjct  3    MLTKFESKSNRVKGIAFHPKRPWILASLHNGCIQLWDYRMGTLLERFEEHDGPVRGISFH  62

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDY+RTV FHHE PWI+SASDDQ
Sbjct  63   PTQPLFVSGGDDYKIKVWNYKTRRCLFTLNGHLDYVRTVFFHHELPWIISASDDQ  117



>ref|XP_011052978.1| PREDICTED: coatomer subunit alpha [Acromyrmex echinatior]
 gb|EGI66327.1| Coatomer subunit alpha [Acromyrmex echinatior]
Length=1209

 Score =   222 bits (566),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 96/115 (83%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM  L+D+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCALLDKFDEHDGPVRGICFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
              QPLFVSGGDDYKIKVWNYK  RC+FTLLGHLDYIRT  FH EYPWI+SASDDQ
Sbjct  61   NQQPLFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTMFHQEYPWILSASDDQ  115



>ref|XP_004775910.1| PREDICTED: coatomer subunit alpha isoform X2 [Mustela putorius 
furo]
 ref|XP_004819831.1| PREDICTED: coatomer subunit alpha isoform X2 [Mustela putorius 
furo]
Length=1224

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_010562443.1| PREDICTED: coatomer subunit alpha [Haliaeetus leucocephalus]
Length=1224

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_009080612.1| PREDICTED: coatomer subunit alpha [Acanthisitta chloris]
Length=1224

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_006267538.1| PREDICTED: coatomer subunit alpha [Alligator mississippiensis]
Length=1224

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_005233226.1| PREDICTED: coatomer subunit alpha isoform X2 [Falco peregrinus]
Length=1233

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|XP_009474826.1| PREDICTED: coatomer subunit alpha [Nipponia nippon]
 ref|XP_009887821.1| PREDICTED: coatomer subunit alpha isoform X2 [Charadrius vociferus]
Length=1224

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



>ref|NP_001026576.1| coatomer subunit alpha [Gallus gallus]
 emb|CAH65430.1| hypothetical protein RCJMB04_34d13 [Gallus gallus]
Length=1224

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  400
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  401  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQ  565
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQ
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQ  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960