BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G06

Length=552
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343129.1|  PREDICTED: putative lipid-transfer protein D...  90.1    2e-19   
gb|AEB33951.1|  defective in induced resistance 3 protein             89.4    7e-19   Nicotiana tabacum [American tobacco]
ref|XP_009595290.1|  PREDICTED: LOW QUALITY PROTEIN: putative lip...  89.4    8e-19   
ref|XP_009790835.1|  PREDICTED: LOW QUALITY PROTEIN: putative lip...  89.4    1e-18   Nicotiana sylvestris
ref|XP_008222678.1|  PREDICTED: putative lipid-transfer protein DIR1  87.4    1e-18   
ref|XP_007223557.1|  hypothetical protein PRUPE_ppa013722mg           87.0    2e-18   
emb|CDO97873.1|  unnamed protein product                              85.9    4e-18   Coffea canephora [robusta coffee]
ref|XP_010318493.1|  PREDICTED: putative lipid-transfer protein DIR1  85.9    5e-18   
ref|XP_002268742.1|  PREDICTED: putative lipid-transfer protein DIR1  85.5    6e-18   Vitis vinifera
ref|XP_002529688.1|  lipid binding protein, putative                  84.7    1e-17   Ricinus communis
ref|XP_008386579.1|  PREDICTED: putative lipid-transfer protein DIR1  83.2    5e-17   Malus domestica [apple tree]
gb|KJB71760.1|  hypothetical protein B456_011G140600                  81.3    2e-16   Gossypium raimondii
ref|XP_009339893.1|  PREDICTED: putative lipid-transfer protein DIR1  81.6    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_008386755.1|  PREDICTED: putative lipid-transfer protein DIR1  81.6    2e-16   Malus domestica [apple tree]
ref|XP_008387060.1|  PREDICTED: putative lipid-transfer protein DIR1  81.3    2e-16   Malus domestica [apple tree]
emb|CBI39455.3|  unnamed protein product                              81.3    3e-16   Vitis vinifera
ref|XP_009339897.1|  PREDICTED: putative lipid-transfer protein DIR1  80.9    4e-16   Pyrus x bretschneideri [bai li]
gb|KDP42884.1|  hypothetical protein JCGZ_23826                       80.5    4e-16   Jatropha curcas
ref|XP_004296699.1|  PREDICTED: putative lipid-transfer protein DIR1  80.5    5e-16   Fragaria vesca subsp. vesca
ref|XP_002529687.1|  lipid binding protein, putative                  79.3    9e-16   
gb|KJB71759.1|  hypothetical protein B456_011G140500                  79.0    2e-15   Gossypium raimondii
gb|EYU45876.1|  hypothetical protein MIMGU_mgv1a022443mg              77.8    4e-15   Erythranthe guttata [common monkey flower]
gb|KHG11809.1|  Putative lipid-transfer DIR1 -like protein            75.9    2e-14   Gossypium arboreum [tree cotton]
ref|XP_004296700.1|  PREDICTED: putative lipid-transfer protein DIR1  74.7    7e-14   Fragaria vesca subsp. vesca
ref|XP_008792988.1|  PREDICTED: putative lipid-transfer protein DIR1  74.7    7e-14   Phoenix dactylifera
ref|XP_006443147.1|  hypothetical protein CICLE_v10022967mg           74.3    1e-13   
ref|XP_008775676.1|  PREDICTED: putative lipid-transfer protein DIR1  73.9    1e-13   
gb|EYU21344.1|  hypothetical protein MIMGU_mgv1a016805mg              72.4    4e-13   Erythranthe guttata [common monkey flower]
gb|ACM90158.1|  trypsin-alpha amylase inhibitor                       72.0    6e-13   Jatropha curcas
ref|XP_006606947.1|  PREDICTED: putative lipid-transfer protein D...  71.6    8e-13   
gb|KHN27145.1|  Putative lipid-transfer protein DIR1                  70.9    1e-12   Glycine soja [wild soybean]
ref|XP_009379984.1|  PREDICTED: putative lipid-transfer protein DIR1  70.9    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010258605.1|  PREDICTED: putative lipid-transfer protein DIR1  70.5    2e-12   
gb|ABK93190.1|  unknown                                               70.5    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010241751.1|  PREDICTED: putative lipid-transfer protein DIR1  70.1    3e-12   
ref|XP_009782537.1|  PREDICTED: putative lipid-transfer protein DIR1  70.1    3e-12   Nicotiana sylvestris
ref|XP_010241749.1|  PREDICTED: putative lipid-transfer protein DIR1  70.1    3e-12   
gb|AEB33949.1|  defective in induced resistance 1 protein             69.7    3e-12   Nicotiana tabacum [American tobacco]
ref|XP_002320450.2|  hypothetical protein POPTR_0014s14740g           69.7    4e-12   Populus trichocarpa [western balsam poplar]
gb|KDO50536.1|  hypothetical protein CISIN_1g046518mg                 69.3    5e-12   Citrus sinensis [apfelsine]
ref|XP_004152081.1|  PREDICTED: putative lipid-transfer protein D...  69.3    5e-12   
ref|XP_010908873.1|  PREDICTED: putative lipid-transfer protein DIR1  68.9    6e-12   Elaeis guineensis
gb|KJB42593.1|  hypothetical protein B456_007G159400                  68.6    1e-11   Gossypium raimondii
ref|XP_010069361.1|  PREDICTED: putative lipid-transfer protein DIR1  69.3    1e-11   Eucalyptus grandis [rose gum]
ref|XP_009604201.1|  PREDICTED: putative lipid-transfer protein DIR1  67.8    2e-11   
emb|CEG62452.1|  Lipid binding/ Lipid transporter protein             67.4    2e-11   Cucumis sativus [cucumbers]
ref|XP_008453924.1|  PREDICTED: putative lipid-transfer protein DIR1  67.0    3e-11   Cucumis melo [Oriental melon]
ref|XP_003622804.1|  hypothetical protein MTR_7g052640                66.6    4e-11   Medicago truncatula
gb|AFK37599.1|  unknown                                               66.6    5e-11   Lotus japonicus
ref|XP_007142607.1|  hypothetical protein PHAVU_007G001800g           66.6    5e-11   Phaseolus vulgaris [French bean]
gb|KJB84111.1|  hypothetical protein B456_N003400                     65.9    8e-11   Gossypium raimondii
ref|XP_007049604.1|  Defective in induced resistance 1 protein        65.5    1e-10   
ref|XP_009399057.1|  PREDICTED: putative lipid-transfer protein DIR1  65.1    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002283832.1|  PREDICTED: putative lipid-transfer protein DIR1  64.7    2e-10   Vitis vinifera
ref|XP_004229235.1|  PREDICTED: putative lipid-transfer protein DIR1  64.7    2e-10   Solanum lycopersicum
ref|XP_009342728.1|  PREDICTED: putative lipid-transfer protein DIR1  63.9    5e-10   Pyrus x bretschneideri [bai li]
ref|XP_010069597.1|  PREDICTED: putative lipid-transfer protein DIR1  63.9    5e-10   
ref|XP_006590235.1|  PREDICTED: putative lipid-transfer protein D...  63.2    9e-10   Glycine max [soybeans]
ref|XP_008235902.1|  PREDICTED: putative lipid-transfer protein DIR1  62.8    1e-09   Prunus mume [ume]
ref|XP_011080533.1|  PREDICTED: putative lipid-transfer protein DIR1  62.8    1e-09   Sesamum indicum [beniseed]
gb|EYU46119.1|  hypothetical protein MIMGU_mgv1a022331mg              62.4    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_008358527.1|  PREDICTED: putative lipid-transfer protein DIR1  62.8    1e-09   Malus domestica [apple tree]
ref|XP_006342794.1|  PREDICTED: putative lipid-transfer protein D...  62.8    1e-09   Solanum tuberosum [potatoes]
gb|KHN37258.1|  Putative lipid-transfer protein DIR1                  62.4    1e-09   Glycine soja [wild soybean]
ref|NP_199660.1|  bifunctional inhibitor/lipid-transfer protein/s...  62.4    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493672.1|  PREDICTED: putative lipid-transfer protein DIR1  61.6    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009396800.1|  PREDICTED: putative lipid-transfer protein DIR1  61.6    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS67451.1|  hypothetical protein M569_07329                       61.2    3e-09   Genlisea aurea
pdb|2RKN|A  Chain A, X-Ray Structure Of The Self-Defense And Sign...  60.5    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568699.1|  putative lipid-transfer protein DIR1                60.8    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009358980.1|  PREDICTED: putative lipid-transfer protein DIR1  60.8    5e-09   Pyrus x bretschneideri [bai li]
ref|XP_004290137.2|  PREDICTED: putative lipid-transfer protein DIR1  61.6    5e-09   Fragaria vesca subsp. vesca
gb|AAM62457.1|  unknown                                               60.8    6e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AFK40872.1|  unknown                                               60.5    7e-09   Lotus japonicus
ref|XP_008369792.1|  PREDICTED: putative lipid-transfer protein DIR1  60.1    8e-09   
ref|XP_010482097.1|  PREDICTED: putative lipid-transfer protein DIR1  60.1    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_007140732.1|  hypothetical protein PHAVU_008G137100g           60.1    1e-08   Phaseolus vulgaris [French bean]
ref|XP_010442271.1|  PREDICTED: putative lipid-transfer protein DIR1  59.7    1e-08   
ref|NP_001059387.1|  Os07g0287400                                     59.7    1e-08   
ref|XP_002865640.1|  protease inhibitor/seed storage/lipid transf...  59.7    1e-08   Arabidopsis lyrata subsp. lyrata
emb|CDP03961.1|  unnamed protein product                              59.7    1e-08   Coffea canephora [robusta coffee]
ref|XP_006423199.1|  hypothetical protein CICLE_v10029642mg           59.3    2e-08   Citrus clementina [clementine]
ref|XP_002865639.1|  hypothetical protein ARALYDRAFT_917749           59.3    2e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_006492236.1|  PREDICTED: putative lipid-transfer protein D...  59.3    2e-08   Citrus sinensis [apfelsine]
gb|AAO22703.1|  unknown protein                                       59.3    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447223.1|  PREDICTED: putative lipid-transfer protein DIR1  59.3    2e-08   Cucumis melo [Oriental melon]
ref|XP_006281372.1|  hypothetical protein CARUB_v10027430mg           58.9    2e-08   Capsella rubella
ref|XP_007131858.1|  hypothetical protein PHAVU_011G047400g           58.9    2e-08   Phaseolus vulgaris [French bean]
ref|XP_006448002.1|  hypothetical protein CICLE_v10017274mg           58.9    3e-08   Citrus clementina [clementine]
ref|XP_007200118.1|  hypothetical protein PRUPE_ppa018886mg           58.5    3e-08   
ref|XP_002301823.1|  hypothetical protein POPTR_0002s25240g           58.2    4e-08   
gb|EMS50543.1|  Putative lipid-transfer protein DIR1                  58.2    4e-08   Triticum urartu
gb|KFK31324.1|  hypothetical protein AALP_AA6G097600                  57.0    1e-07   Arabis alpina [alpine rockcress]
ref|XP_009364632.1|  PREDICTED: putative lipid-transfer protein DIR1  57.0    1e-07   
emb|CDY05673.1|  BnaC02g38640D                                        56.6    1e-07   
ref|NP_001237117.1|  uncharacterized protein LOC100527769             56.6    2e-07   Glycine max [soybeans]
gb|KDO51453.1|  hypothetical protein CISIN_1g042956mg                 56.2    2e-07   Citrus sinensis [apfelsine]
gb|AFK44652.1|  unknown                                               56.2    2e-07   Medicago truncatula
gb|AFK43895.1|  unknown                                               56.2    2e-07   Medicago truncatula
gb|AAM28295.1|  PVR3-like protein                                     56.2    2e-07   Ananas comosus
ref|XP_006657616.1|  PREDICTED: putative lipid-transfer protein D...  55.8    3e-07   Oryza brachyantha
gb|EYU46116.1|  hypothetical protein MIMGU_mgv1a025642mg              55.8    3e-07   Erythranthe guttata [common monkey flower]
gb|KDP42880.1|  hypothetical protein JCGZ_23822                       55.8    3e-07   Jatropha curcas
gb|KEH30405.1|  Lipid transfer protein                                55.8    3e-07   Medicago truncatula
ref|XP_006395174.1|  hypothetical protein EUTSA_v10005129mg           55.8    4e-07   
gb|KDP45250.1|  hypothetical protein JCGZ_15115                       55.5    4e-07   Jatropha curcas
ref|XP_004507410.1|  PREDICTED: putative lipid-transfer protein D...  55.1    5e-07   Cicer arietinum [garbanzo]
ref|XP_006845070.1|  hypothetical protein AMTR_s00005p00084040        55.5    5e-07   
ref|NP_001236926.1|  uncharacterized protein LOC100527244 precursor   55.1    5e-07   Glycine max [soybeans]
gb|KDP46220.1|  hypothetical protein JCGZ_10060                       55.1    6e-07   Jatropha curcas
ref|XP_004230985.1|  PREDICTED: putative lipid-transfer protein DIR1  55.1    6e-07   Solanum lycopersicum
ref|XP_009601194.1|  PREDICTED: putative lipid-transfer protein DIR1  55.1    6e-07   Nicotiana tomentosiformis
ref|XP_010096215.1|  hypothetical protein L484_026950                 55.1    7e-07   Morus notabilis
ref|XP_002527254.1|  lipid binding protein, putative                  54.7    7e-07   Ricinus communis
ref|NP_001236410.1|  uncharacterized protein LOC100305511 precursor   54.7    7e-07   Glycine max [soybeans]
ref|XP_004292000.1|  PREDICTED: putative lipid-transfer protein DIR1  54.3    9e-07   Fragaria vesca subsp. vesca
ref|XP_010908200.1|  PREDICTED: putative lipid-transfer protein DIR1  54.3    1e-06   Elaeis guineensis
ref|XP_009797273.1|  PREDICTED: putative lipid-transfer protein DIR1  54.3    1e-06   Nicotiana sylvestris
ref|XP_006365510.1|  PREDICTED: putative lipid-transfer protein D...  54.3    1e-06   Solanum tuberosum [potatoes]
ref|XP_008236806.1|  PREDICTED: putative lipid-transfer protein DIR1  54.3    1e-06   Prunus mume [ume]
ref|XP_007200836.1|  hypothetical protein PRUPE_ppa026221mg           53.9    1e-06   
gb|ACG42309.1|  PVR3-like protein                                     54.3    1e-06   Zea mays [maize]
gb|KEH30406.1|  Lipid transfer protein                                53.9    1e-06   Medicago truncatula
ref|XP_009339389.1|  PREDICTED: putative lipid-transfer protein DIR1  53.5    2e-06   
ref|XP_004492249.1|  PREDICTED: putative lipid-transfer protein D...  53.5    2e-06   Cicer arietinum [garbanzo]
ref|NP_001238322.1|  uncharacterized protein LOC100305636             53.5    2e-06   Glycine max [soybeans]
ref|XP_009335428.1|  PREDICTED: putative lipid-transfer protein DIR1  53.5    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_002459717.1|  hypothetical protein SORBIDRAFT_02g009300        53.5    2e-06   Sorghum bicolor [broomcorn]
ref|XP_008385814.1|  PREDICTED: putative lipid-transfer protein DIR1  53.5    3e-06   
ref|XP_009375630.1|  PREDICTED: putative lipid-transfer protein DIR1  53.1    3e-06   Pyrus x bretschneideri [bai li]
ref|XP_004166453.1|  PREDICTED: putative lipid-transfer protein D...  53.1    3e-06   
ref|XP_006845077.1|  hypothetical protein AMTR_s00005p00100950        53.1    3e-06   
ref|XP_004150334.1|  PREDICTED: putative lipid-transfer protein D...  53.1    3e-06   
gb|KJB79487.1|  hypothetical protein B456_013G052600                  53.1    3e-06   Gossypium raimondii
gb|AEB33950.1|  defective in induced resistance 2 protein             52.8    3e-06   Nicotiana tabacum [American tobacco]
ref|XP_004955968.1|  PREDICTED: putative lipid-transfer protein D...  52.8    4e-06   Setaria italica
gb|EMT01414.1|  hypothetical protein F775_28625                       52.8    4e-06   
ref|XP_006845076.1|  hypothetical protein AMTR_s00005p00099640        52.4    8e-06   
ref|XP_011092905.1|  PREDICTED: putative lipid-transfer protein DIR1  51.6    9e-06   Sesamum indicum [beniseed]
ref|XP_009403612.1|  PREDICTED: putative lipid-transfer protein DIR1  51.6    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008779441.1|  PREDICTED: putative lipid-transfer protein DIR1  51.6    1e-05   
ref|XP_006856839.1|  hypothetical protein AMTR_s00055p00181150        52.0    1e-05   
ref|XP_010679256.1|  PREDICTED: putative lipid-transfer protein DIR1  51.6    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009129731.1|  PREDICTED: putative lipid-transfer protein DIR1  51.2    1e-05   Brassica rapa
gb|KJB53515.1|  hypothetical protein B456_009G445200                  51.2    1e-05   Gossypium raimondii
ref|XP_008227058.1|  PREDICTED: putative lipid-transfer protein DIR1  51.2    1e-05   
ref|XP_008809954.1|  PREDICTED: putative lipid-transfer protein DIR1  51.2    1e-05   
ref|XP_010252660.1|  PREDICTED: putative lipid-transfer protein DIR1  50.8    2e-05   
ref|NP_001152561.1|  PVR3-like protein                                50.8    2e-05   
ref|NP_001146924.1|  PVR3-like protein                                50.8    2e-05   Zea mays [maize]
dbj|BAJ87124.1|  predicted protein                                    50.4    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007042728.1|  Bifunctional inhibitor/lipid-transfer protei...  50.4    2e-05   
ref|NP_001235288.1|  uncharacterized protein LOC100305686 precursor   50.4    2e-05   Glycine max [soybeans]
ref|XP_002519093.1|  lipid binding protein, putative                  50.1    3e-05   
gb|KHG21649.1|  Putative lipid-transfer DIR1 -like protein            50.4    6e-05   Gossypium arboreum [tree cotton]
ref|XP_010545262.1|  PREDICTED: putative lipid-transfer protein DIR1  49.3    6e-05   Tarenaya hassleriana [spider flower]
gb|EYU42633.1|  hypothetical protein MIMGU_mgv1a024655mg              49.3    8e-05   Erythranthe guttata [common monkey flower]
ref|XP_007212412.1|  hypothetical protein PRUPE_ppa016471mg           48.9    8e-05   
ref|XP_002275805.1|  PREDICTED: putative lipid-transfer protein DIR1  48.9    9e-05   Vitis vinifera
emb|CAN61352.1|  hypothetical protein VITISV_027758                   48.5    2e-04   Vitis vinifera
ref|XP_006845078.1|  hypothetical protein AMTR_s00005p00101720        48.1    2e-04   
ref|XP_003570573.1|  PREDICTED: putative lipid-transfer protein DIR1  48.1    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_010097506.1|  hypothetical protein L484_024714                 47.8    2e-04   
ref|XP_008236785.1|  PREDICTED: putative lipid-transfer protein DIR1  48.1    2e-04   Prunus mume [ume]
ref|XP_007200072.1|  hypothetical protein PRUPE_ppa021237mg           48.1    2e-04   Prunus persica
gb|ACG31932.1|  PVR3-like protein                                     47.0    3e-04   Zea mays [maize]
ref|XP_010646191.1|  PREDICTED: putative lipid-transfer protein DIR1  47.0    4e-04   Vitis vinifera
gb|KHG12015.1|  Putative lipid-transfer DIR1 -like protein            47.0    4e-04   Gossypium arboreum [tree cotton]
gb|KJB13794.1|  hypothetical protein B456_002G094700                  47.0    5e-04   Gossypium raimondii
gb|ACG31910.1|  PVR3-like protein                                     46.2    5e-04   Zea mays [maize]
emb|CAN72894.1|  hypothetical protein VITISV_022314                   47.4    5e-04   Vitis vinifera



>ref|XP_006343129.1| PREDICTED: putative lipid-transfer protein DIR1-like [Solanum 
tuberosum]
Length=129

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 1/103 (1%)
 Frame = +3

Query  96   ETIMEAYTKLSNVKIIVLAVVMLGGIG-EVCHAQSVCNMSREALMSCRpaatppnpppps  272
            E  ME Y     +  + L  ++L  +  EV  AQ +CN+S E LMSCRP+ TPP P  P+
Sbjct  21   EIEMEHYNFAKKIMTLALVAIVLSSVSIEVSQAQGICNVSGEGLMSCRPSITPPYPTAPT  80

Query  273  aacctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            A CC A+SHAD+ CLCSYKNS  LPSLG+DPNLA+ LP+KC+ 
Sbjct  81   AQCCNALSHADMACLCSYKNSQLLPSLGIDPNLAIQLPQKCRL  123



>gb|AEB33951.1| defective in induced resistance 3 protein [Nicotiana tabacum]
Length=150

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc  284
            ME Y     V + ++A+++     EV  AQ +CN+S E LMSC+P+ TPPNP  P+A CC
Sbjct  46   MEHYLAKKPVALALVAILLSSFSIEVSRAQGICNISGEGLMSCKPSVTPPNPSAPTAKCC  105

Query  285  taISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            +A++HAD GCLCSY NS WLPSLGVDP LAM LP+KCK 
Sbjct  106  SALAHADWGCLCSYMNSHWLPSLGVDPTLAMQLPQKCKL  144



>ref|XP_009595290.1| PREDICTED: LOW QUALITY PROTEIN: putative lipid-transfer protein 
DIR1 [Nicotiana tomentosiformis]
Length=150

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc  284
            ME Y     V + ++A+++     EV  AQ +CN+S E LMSC+P+ TPPNP  P+A CC
Sbjct  46   MEHYLAKKPVALALVAILLSSFSIEVSRAQGICNISGEGLMSCKPSVTPPNPSAPTAKCC  105

Query  285  taISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            +A++HAD GCLCSY NS WLPSLGVDP LAM LP+KCK 
Sbjct  106  SALAHADWGCLCSYMNSHWLPSLGVDPTLAMQLPQKCKL  144



>ref|XP_009790835.1| PREDICTED: LOW QUALITY PROTEIN: putative lipid-transfer protein 
DIR1 [Nicotiana sylvestris]
Length=178

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%), Gaps = 8/101 (8%)
 Frame = +3

Query  132  VKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLG  311
            V + ++A+V+     EV  AQ +CN+S E LMSC+P+ T PNP  P+A CC+A+S AD G
Sbjct  83   VALALVAIVLSSFSIEVSRAQGICNVSGEGLMSCKPSVTTPNPSAPTAKCCSALSQADWG  142

Query  312  CLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALAC*RSPNP  434
            CLCSYKNS WLPSLGVDP LAM LP+KCKF        PNP
Sbjct  143  CLCSYKNSQWLPSLGVDPTLAMQLPEKCKF--------PNP  175



>ref|XP_008222678.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=107

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  165  GGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWL  344
            GG  +VC AQ++CN+S   LM+CRPA T PNP PP+ ACC+A+SHAD+GCLCSYKNS+ L
Sbjct  23   GGFVQVCDAQNICNVSMNGLMTCRPAVTAPNPAPPTTACCSALSHADMGCLCSYKNSNLL  82

Query  345  PSLGVDPNLAMTLPKKCKF  401
            PSLG+DPNLA+ LP KC+ 
Sbjct  83   PSLGIDPNLALQLPAKCRL  101



>ref|XP_007223557.1| hypothetical protein PRUPE_ppa013722mg [Prunus persica]
 gb|EMJ24756.1| hypothetical protein PRUPE_ppa013722mg [Prunus persica]
Length=107

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  165  GGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWL  344
            GG  +VC AQ++CN+S   LM+CRPA T PNP PP+ ACC+A+SHAD+GCLCSYKNS+ L
Sbjct  23   GGFVQVCDAQNICNVSLNGLMTCRPAVTAPNPAPPTTACCSALSHADMGCLCSYKNSNLL  82

Query  345  PSLGVDPNLAMTLPKKCKF  401
            PSLG+DPNLA+ LP KC+ 
Sbjct  83   PSLGIDPNLALQLPAKCRL  101



>emb|CDO97873.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +3

Query  129  NVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADL  308
            N+ ++VL +V       V H Q++C MS + LMSC+PA TPP P  PS+ACC A+ HAD+
Sbjct  8    NIFVLVLFLVAFASNVVVMHGQTICKMSAQELMSCKPAVTPPEPSDPSSACCAALKHADV  67

Query  309  GCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
             CLCS+K+SSWLPSLG+DPNLA  LP+KCK 
Sbjct  68   ACLCSFKSSSWLPSLGIDPNLATQLPEKCKL  98



>ref|XP_010318493.1| PREDICTED: putative lipid-transfer protein DIR1 [Solanum lycopersicum]
Length=106

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIG-EVCHAQSVCNMSREALMSCRpaatppnppppsaac  281
            ME Y     +  + L  ++L  +  EV  AQ +CN+S E LMSCRP+ TPP P  P+A C
Sbjct  1    MEHYNFAQKIMTLALFAIVLSSVNIEVVRAQGICNVSGEGLMSCRPSITPPYPTAPTAQC  60

Query  282  ctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            C A+S AD+ CLCSYKNS  LPSLG+DPNLA+ LP+KC+ 
Sbjct  61   CNALSRADMACLCSYKNSQLLPSLGIDPNLAIQLPQKCRL  100



>ref|XP_002268742.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=98

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 77/99 (78%), Gaps = 7/99 (7%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc  284
            MEA+ KL+ V +++ ++          +AQ++CNMS E LM+C+PA +PPNP PPSAACC
Sbjct  1    MEAFGKLAIVALVLASLA-------SSNAQTICNMSGEGLMACKPAVSPPNPAPPSAACC  53

Query  285  taISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            +A+SHAD+ CLCSY+NS  LPS+G+DPNLA+ LPKKCKF
Sbjct  54   SALSHADMHCLCSYRNSKLLPSMGIDPNLALQLPKKCKF  92



>ref|XP_002529688.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF32699.1| lipid binding protein, putative [Ricinus communis]
Length=106

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  IIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCL  317
            I+V+A+    G+ +VC+AQSVCN+    LM+C+PA TPPNP  P++ACC+A++HAD+ CL
Sbjct  15   ILVIAIAN-NGVVQVCNAQSVCNVPISGLMACKPAVTPPNPSAPTSACCSALTHADMRCL  73

Query  318  CSYKNSSWLPSLGVDPNLAMTLPKKCKFSALAC  416
            CSYKNS+ LPSLG+DPNLA+ LP KCK     C
Sbjct  74   CSYKNSNVLPSLGIDPNLALQLPPKCKLPRPNC  106



>ref|XP_008386579.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  165  GGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWL  344
            GG  +V +AQ++CN+S   LM+CRPA T PNP PP+ ACC A+SHA+L CLCSYKNSS L
Sbjct  24   GGFVQVANAQNICNISVTGLMTCRPAVTSPNPAPPTKACCAALSHANLSCLCSYKNSSVL  83

Query  345  PSLGVDPNLAMTLPKKCKF  401
            PSLG+DPNLA+ LP KCK 
Sbjct  84   PSLGIDPNLALQLPAKCKL  102



>gb|KJB71760.1| hypothetical protein B456_011G140600 [Gossypium raimondii]
Length=101

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +3

Query  120  KLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISH  299
            K+  ++ ++LA+VM+  I     AQS+CNM    LM+C+PA TPPNPPPP++ CC+A+SH
Sbjct  3    KMKGLQALILAMVMVMAIATT-DAQSICNMPASGLMACKPAVTPPNPPPPTSTCCSALSH  61

Query  300  ADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            AD+ CLCSYKNS  LPSLG+DPNLAM LP  CK 
Sbjct  62   ADMRCLCSYKNSKLLPSLGIDPNLAMKLPSLCKL  95



>ref|XP_009339893.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=108

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  165  GGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWL  344
            GG  +V +AQ++CN+S   LM+CRPA T PNP PP+ ACC+A+SHA++ CLCSYKNSS L
Sbjct  24   GGFVQVANAQNICNVSVTGLMTCRPAVTSPNPAPPTKACCSALSHANVSCLCSYKNSSVL  83

Query  345  PSLGVDPNLAMTLPKKCKF  401
            PSLG+DPNLA+ LP KCK 
Sbjct  84   PSLGIDPNLALQLPAKCKL  102



>ref|XP_008386755.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
 ref|XP_008387154.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
 ref|XP_008343359.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  165  GGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWL  344
            GG  +V +AQ++CN+S   LM CRPA T PNP PP+ ACC A+SHA+L CLCSYKNSS L
Sbjct  24   GGFVQVANAQNICNVSVTDLMKCRPAVTSPNPAPPTKACCAALSHANLSCLCSYKNSSVL  83

Query  345  PSLGVDPNLAMTLPKKCKF  401
            PSLG+DPNLA+ LP KCK 
Sbjct  84   PSLGIDPNLALQLPAKCKL  102



>ref|XP_008387060.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  165  GGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWL  344
            GG  +V +AQ++CN+S   LM+CR A T PN  PP+ ACC A+SHA+L CLCSYKNSS L
Sbjct  24   GGFVQVDNAQNICNVSVTDLMTCRAAVTSPNLAPPTKACCAALSHANLSCLCSYKNSSVL  83

Query  345  PSLGVDPNLAMTLPKKCKF  401
            PSLG+DPNLA+ LP KCK 
Sbjct  84   PSLGIDPNLALQLPAKCKL  102



>emb|CBI39455.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 76/98 (78%), Gaps = 7/98 (7%)
 Frame = +3

Query  108  EAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacct  287
            +A+ KL+ V +++ ++          +AQ++CNMS E LM+C+PA +PPNP PPSAACC+
Sbjct  18   KAFGKLAIVALVLASLA-------SSNAQTICNMSGEGLMACKPAVSPPNPAPPSAACCS  70

Query  288  aISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            A+SHAD+ CLCSY+NS  LPS+G+DPNLA+ LPKKCKF
Sbjct  71   ALSHADMHCLCSYRNSKLLPSMGIDPNLALQLPKKCKF  108



>ref|XP_009339897.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=112

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  165  GGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWL  344
            GG   V +AQ++CN+S   LM+CRPA T PNP PP+ ACC A+SHA+L CLCSYKNSS L
Sbjct  28   GGFVHVVNAQNICNVSVSDLMTCRPAVTSPNPAPPTKACCAALSHANLSCLCSYKNSSVL  87

Query  345  PSLGVDPNLAMTLPKKCKF  401
            PSLG+DPNLA+ LP KCK 
Sbjct  88   PSLGIDPNLALQLPAKCKL  106



>gb|KDP42884.1| hypothetical protein JCGZ_23826 [Jatropha curcas]
Length=101

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  KIIVLAVVMLGGI-GEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLG  311
            K++V+ +VM+ GI     + QS+CN+S   L SCRPA TPPNP PP++ACC+A+SHADL 
Sbjct  6    KLLVIMLVMVAGIFSSSINGQSICNVSISGLTSCRPAVTPPNPAPPTSACCSALSHADLR  65

Query  312  CLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            CLCSYKNS+ LPSLG+DP LA+ LP+KC+ 
Sbjct  66   CLCSYKNSTLLPSLGIDPKLALKLPEKCRL  95



>ref|XP_004296699.1| PREDICTED: putative lipid-transfer protein DIR1 [Fragaria vesca 
subsp. vesca]
Length=104

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +3

Query  177  EVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLG  356
            EV  AQ++CN+S   LMSC+PA T PNP  P+ ACC+A+SHADLGCLCSY+NS+ LPSLG
Sbjct  24   EVSEAQTICNVSVNNLMSCKPAVTKPNPARPTQACCSALSHADLGCLCSYRNSNLLPSLG  83

Query  357  VDPNLAMTLPKKCKF  401
            +DP LAM LP KCK 
Sbjct  84   IDPKLAMQLPGKCKL  98



>ref|XP_002529687.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF32698.1| lipid binding protein, putative [Ricinus communis]
Length=93

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +3

Query  138  IIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCL  317
            I+V+A+    G+ +V +AQS+CN+    LM+C+PA TPPNP  P++ACC+A++HAD+ CL
Sbjct  2    ILVIAIAN-NGVVQVSNAQSICNVPISGLMACKPAVTPPNPSAPTSACCSALTHADMRCL  60

Query  318  CSYKNSSWLPSLGVDPNLAMTLPKKCKFSALAC  416
            CSYKNS+ LPSLG+DPNLA+ LP KC      C
Sbjct  61   CSYKNSNLLPSLGIDPNLALQLPPKCNLPRPNC  93



>gb|KJB71759.1| hypothetical protein B456_011G140500 [Gossypium raimondii]
Length=101

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +3

Query  120  KLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISH  299
            K+  ++ ++LA++M+  I     AQS+CNM    LM+C+PA TPPNPPPP++ CC+A+S+
Sbjct  3    KMKGLQALILAMIMVMAIATT-DAQSICNMPASGLMACKPAVTPPNPPPPTSTCCSALSY  61

Query  300  ADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            AD+ CLCSYKNS  LPSLG+DPNLAM LP  CK 
Sbjct  62   ADMRCLCSYKNSKLLPSLGIDPNLAMKLPSLCKL  95



>gb|EYU45876.1| hypothetical protein MIMGU_mgv1a022443mg, partial [Erythranthe 
guttata]
Length=89

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +3

Query  177  EVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLG  356
             VC+ QSVCNMS E LM+C+P+ATPP PPPPSA CC+A+SHAD+ CLC++KNS  LPSLG
Sbjct  9    NVCYGQSVCNMSGEDLMACKPSATPPQPPPPSARCCSALSHADIRCLCTFKNSKLLPSLG  68

Query  357  VDPNLAMTLPKKCKF  401
            +DPNLA+ LP KCK 
Sbjct  69   IDPNLAIQLPDKCKL  83



>gb|KHG11809.1| Putative lipid-transfer DIR1 -like protein [Gossypium arboreum]
Length=104

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  LSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHA  302
            +  VK++V+ ++M+G   E   A S+C+M+ E L +C+P+ T P+P  P+  CC A+  A
Sbjct  1    MGTVKLVVVMIIMVGLTVEGSRAISLCDMNDEGLEACKPSVTQPDPVDPTPQCCEALKGA  60

Query  303  DLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            +L CLCSYKNS WLPSLG+DP LAM LP KC   
Sbjct  61   NLTCLCSYKNSMWLPSLGIDPTLAMGLPAKCSLD  94



>ref|XP_004296700.1| PREDICTED: putative lipid-transfer protein DIR1 [Fragaria vesca 
subsp. vesca]
Length=104

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +3

Query  177  EVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLG  356
            EV  AQ++CN+    LMSCR A T PNP  PS ACC+A+S ADLGCLCSYKNS+ LPSLG
Sbjct  24   EVSDAQTICNVPLNNLMSCRAAITRPNPAKPSKACCSALSLADLGCLCSYKNSNLLPSLG  83

Query  357  VDPNLAMTLPKKCKF  401
            +DP LAM LP KC  
Sbjct  84   IDPELAMQLPGKCNL  98



>ref|XP_008792988.1| PREDICTED: putative lipid-transfer protein DIR1 [Phoenix dactylifera]
Length=107

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = +3

Query  141  IVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc-taISHADLGCL  317
            IVL V     +     AQ  CNM+R+ LM+C+P+ +   P    A  C TA+SHADL CL
Sbjct  14   IVLVVATTMEMSLASGAQGFCNMTRDELMACKPSISTAKPVEKPADACCTALSHADLPCL  73

Query  318  CSYKNSSWLPSLGVDPNLAMTLPKKCKFSALA  413
            C+YKNS  LP LG+DPNLAM LP KC   A A
Sbjct  74   CAYKNSGMLPYLGIDPNLAMQLPAKCSVPAPA  105



>ref|XP_006443147.1| hypothetical protein CICLE_v10022967mg [Citrus clementina]
 gb|ESR56387.1| hypothetical protein CICLE_v10022967mg [Citrus clementina]
Length=109

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 67/100 (67%), Gaps = 7/100 (7%)
 Frame = +3

Query  123  LSNVKIIVLAVVMLGGIG-----EVCHAQS--VCNMSREALMSCRpaatppnppppsaac  281
            L  +  +V+ V+M+ GIG        HAQ   +CNM+   LM+C+P+ TPPNP  P+ AC
Sbjct  4    LKKIIALVVKVIMVVGIGVGMSIGSSHAQGTVICNMTGAGLMACKPSVTPPNPTRPTTAC  63

Query  282  ctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            CTA+SHADL C C YKNS  LPSLG+DP LAM LP KCK 
Sbjct  64   CTALSHADLECFCKYKNSKLLPSLGIDPKLAMQLPDKCKL  103



>ref|XP_008775676.1| PREDICTED: putative lipid-transfer protein DIR1 [Phoenix dactylifera]
Length=105

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 70/105 (67%), Gaps = 4/105 (4%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVC--HAQSVCNMSREALMSCRpaatppnppppsaa  278
            ME+  KL  + ++VL++++  G GE+    A   CNM+ E   +C+PA T P P  PS  
Sbjct  1    MESLQKLVIMVMLVLSIIL--GCGEIALLRADGFCNMTMEGFNACKPAVTGPEPTEPSEE  58

Query  279  cctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALA  413
            CC A+S+ADL CLCSY++S  LPSLG+DP+LAM LP+KC  +  A
Sbjct  59   CCEALSNADLPCLCSYRHSMLLPSLGIDPDLAMQLPQKCNLTPPA  103



>gb|EYU21344.1| hypothetical protein MIMGU_mgv1a016805mg [Erythranthe guttata]
Length=106

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +3

Query  108  EAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacct  287
             +Y K++ + I    VV+LG      + Q VC M+    ++C+ AATPPNPPPPSAACC+
Sbjct  5    SSYQKIAILAIFF--VVVLGVATTTANGQMVCKMTLGDFLACKSAATPPNPPPPSAACCS  62

Query  288  aISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCK  398
             ISHADL CLCS+KN++ LPS G+DPNLA+ LPKKC 
Sbjct  63   GISHADLSCLCSFKNNTLLPSFGIDPNLALQLPKKCN  99



>gb|ACM90158.1| trypsin-alpha amylase inhibitor [Jatropha curcas]
Length=101

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  KIIVLAVVMLGGI-GEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLG  311
            K++V+ +VM+ GI     + QS+CN+S   L SC PA TPPNP PP++ACC+A+SHADL 
Sbjct  6    KLLVIMLVMVAGIFSSSINGQSICNVSISGLTSCSPAVTPPNPAPPTSACCSALSHADLR  65

Query  312  CLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            CLCSYKNS+ LPSLG+D  L + LP+KC+ 
Sbjct  66   CLCSYKNSTLLPSLGIDQKLPLKLPEKCRL  95



>ref|XP_006606947.1| PREDICTED: putative lipid-transfer protein DIR1-like [Glycine 
max]
Length=101

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = +3

Query  114  YTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaI  293
            Y K   + + V  VV L  I      QS+CN+S   LM+C+PA TPPNP PPS  CC+ +
Sbjct  2    YLKQKQMIVGVALVVFLLLISV--KGQSICNVSLPDLMTCKPAVTPPNPTPPSQQCCSVL  59

Query  294  SHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            SHADL CLCSYKNS  LPSLG+DP LA+ LP KC   
Sbjct  60   SHADLPCLCSYKNSPLLPSLGIDPKLALQLPAKCNLP  96



>gb|KHN27145.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=94

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +3

Query  192  QSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNL  371
            QS+CN+S   LM+C+PA TPPNP PPS  CC+ +SHADL CLCSYKNS  LPSLG+DP L
Sbjct  19   QSICNVSLPDLMTCKPAVTPPNPTPPSQQCCSVLSHADLPCLCSYKNSPLLPSLGIDPKL  78

Query  372  AMTLPKKCKF  401
            A+ LP KC  
Sbjct  79   ALQLPAKCNL  88



>ref|XP_009379984.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=97

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 69/96 (72%), Gaps = 7/96 (7%)
 Frame = +3

Query  114  YTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaI  293
            + + + + I++L++   GG       ++VCNM++E   +C+P+ TPPNPPPPS ACC A+
Sbjct  3    FLRTAAMAILLLSMTFEGG-------EAVCNMTQEGFDACKPSVTPPNPPPPSVACCKAL  55

Query  294  SHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            ++ADL CLCSYKNS  LP+LG+DP LAMTLP KC  
Sbjct  56   ANADLPCLCSYKNSPLLPALGIDPGLAMTLPPKCNL  91



>ref|XP_010258605.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=103

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +3

Query  123  LSNVKIIVLAVVMLGGIGEVCHAQ-SVCNMSREALMSCRpaatppnppppsaacctaISH  299
            L  + ++ L + ++ G+ EV   + S+CNMS   L++C+PA +  NP  PS ACC A+S 
Sbjct  4    LPRIVVVFLVMTVIFGMQEVMSKEVSLCNMSENDLLACKPAVSKQNPADPSPACCKALSS  63

Query  300  ADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALA  413
            ADL CLCSYKNS  LPSLG++P+ AM LP KC  +  A
Sbjct  64   ADLSCLCSYKNSILLPSLGINPDFAMQLPTKCNLNPPA  101



>gb|ABK93190.1| unknown [Populus trichocarpa]
Length=103

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +3

Query  174  GEVCHAQS-VCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPS  350
              + +AQS +C M    LMSC+P+ TPPNP  PSA CC+A+SHADL CLCSYKNS+ LPS
Sbjct  21   SNIANAQSTICKMPVAGLMSCKPSVTPPNPTAPSADCCSALSHADLNCLCSYKNSNLLPS  80

Query  351  LGVDPNLAMTLPKKCKF  401
            LG+DP LAM LP KCK 
Sbjct  81   LGIDPKLAMQLPGKCKL  97



>ref|XP_010241751.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=106

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 69/107 (64%), Gaps = 8/107 (7%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQS----VCNMSREALMSCRpaatppnpppps  272
            ME   KL    ++V+ ++++    E   A+S    +CNMS + LM+C+PA   PNP  P+
Sbjct  1    MEMQRKL----VVVMVLLIMAAAFETQVARSKEVNLCNMSEDDLMACKPAVIKPNPADPT  56

Query  273  aacctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALA  413
             ACC A+S ADL CLCSYK+S  LP+ G+DP+LAM LP KCK +  A
Sbjct  57   PACCKALSGADLSCLCSYKHSLLLPTFGIDPDLAMQLPTKCKLTPPA  103



>ref|XP_009782537.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana sylvestris]
Length=104

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = +3

Query  135  KIIVLAVVMLGG---IGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHAD  305
            K+ VL  V LG    I E+ +  S+CNM  + L +C+P+ T PNP  PSA+CC A+S AD
Sbjct  7    KVGVLVTVFLGILLLIAELTNGLSLCNMGDDGLTACKPSVTKPNPVEPSASCCEALSGAD  66

Query  306  LGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALA  413
            L CLCSY+NS  LPSLG+DP LA+ LP KC  ++ A
Sbjct  67   LQCLCSYRNSLLLPSLGIDPELALALPPKCNLTSPA  102



>ref|XP_010241749.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=103

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  180  VCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGV  359
            V ++Q++CNM   +LM+C P+ T   P PPS  CC+A+SHADL CLCSYKNS  LPSLG+
Sbjct  24   VSYSQTICNMPAASLMACMPSVTGTKPSPPSGDCCSALSHADLKCLCSYKNSKLLPSLGI  83

Query  360  DPNLAMTLPKKCKF  401
            +P LA+ LP KCK 
Sbjct  84   NPKLAIQLPAKCKL  97



>gb|AEB33949.1| defective in induced resistance 1 protein [Nicotiana tabacum]
Length=104

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 3/96 (3%)
 Frame = +3

Query  135  KIIVLAVVMLGG---IGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHAD  305
            K+ VL  V LG    I E+ +  S+CNM  + L +C+P+ T PNP  PSA+CC A+S AD
Sbjct  7    KVGVLVTVFLGILLLIAELTNGLSLCNMGDDGLTACKPSVTKPNPVEPSASCCEALSGAD  66

Query  306  LGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALA  413
            L CLCSY+NS  LPSLG+DP LA+ LP KC  ++ A
Sbjct  67   LQCLCSYRNSLLLPSLGIDPELALALPPKCNLTSPA  102



>ref|XP_002320450.2| hypothetical protein POPTR_0014s14740g [Populus trichocarpa]
 gb|ABK94334.1| unknown [Populus trichocarpa]
 gb|EEE98765.2| hypothetical protein POPTR_0014s14740g [Populus trichocarpa]
Length=103

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +3

Query  174  GEVCHAQS-VCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPS  350
              + +AQS +C M    LMSC+P+ TPPNP  PSA CC+A+SHAD+ CLCSYKNS+ LPS
Sbjct  21   SNIANAQSTICKMPVAGLMSCKPSVTPPNPTAPSADCCSALSHADINCLCSYKNSNLLPS  80

Query  351  LGVDPNLAMTLPKKCKF  401
            LG+DP LAM LP KCK 
Sbjct  81   LGIDPKLAMQLPGKCKL  97



>gb|KDO50536.1| hypothetical protein CISIN_1g046518mg [Citrus sinensis]
Length=94

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 2/74 (3%)
 Frame = +3

Query  186  HAQS--VCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGV  359
            HAQ   +CNM+   LM+C+P+ TPPNP  P+ ACCTA+SHADL C C YKNS  LPSLG+
Sbjct  15   HAQGTVICNMTGAGLMACKPSVTPPNPTRPTTACCTALSHADLECFCKYKNSKLLPSLGI  74

Query  360  DPNLAMTLPKKCKF  401
            DP LAM LP KCK 
Sbjct  75   DPKLAMQLPDKCKL  88



>ref|XP_004152081.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
 ref|XP_004167435.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
 gb|KGN53126.1| hypothetical protein Csa_4G017140 [Cucumis sativus]
Length=101

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 12/104 (12%)
 Frame = +3

Query  132  VKIIVLAVVMLG----GIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISH  299
            +K++ LA+V++     G GE   AQS+CNM    L +CRP+ TPPNP PP+  CC+A++H
Sbjct  5    MKVVALALVLMVVNNIGFGE---AQSICNMPIAGLYACRPSVTPPNPTPPTTQCCSALTH  61

Query  300  ADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALAC*RSPN  431
            ADL C C+Y+NS  L S G++P LAM LPK+C  S     +SPN
Sbjct  62   ADLHCFCAYRNSGALSSFGINPELAMELPKRCNIS-----KSPN  100



>ref|XP_010908873.1| PREDICTED: putative lipid-transfer protein DIR1 [Elaeis guineensis]
Length=104

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc  284
            ME+  KL  V ++VL++ +  G   V  A  +CNM+ +   +C+PAAT P P  PS  CC
Sbjct  1    MESLQKLVMV-MLVLSITLGCGEITVSRADGLCNMTMDGFNACKPAATGPEPTEPSKECC  59

Query  285  taISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
             A+++ADL CLCSY++S  LPSLG+DP+LAM LP+KC  +
Sbjct  60   EALANADLPCLCSYRHSVLLPSLGIDPDLAMQLPEKCNLT  99



>gb|KJB42593.1| hypothetical protein B456_007G159400 [Gossypium raimondii]
 gb|KJB42594.1| hypothetical protein B456_007G159400 [Gossypium raimondii]
 gb|KJB42595.1| hypothetical protein B456_007G159400 [Gossypium raimondii]
Length=101

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +3

Query  129  NVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADL  308
             VK++V+ ++ +G + E   A S+C+M+ E L +C+P+ T P+P  P+  CC A+  A+L
Sbjct  5    TVKLVVVMMITVGLMVEGSRAISLCDMNDEGLEACKPSVTQPDPVDPTPQCCEALKGANL  64

Query  309  GCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
             CLCSYKNS  LPSLG+DP LAM LP KC   
Sbjct  65   TCLCSYKNSMLLPSLGIDPTLAMGLPAKCSLD  96



>ref|XP_010069361.1| PREDICTED: putative lipid-transfer protein DIR1 [Eucalyptus grandis]
Length=171

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +3

Query  150  AVVMLG---GIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLC  320
            AV++LG    I    +AQ++CNMS   LM+C+PAATPPNPPPP++ACCT +SHA+L C C
Sbjct  79   AVILLGLMVAIACCANAQTICNMSYSELMACKPAATPPNPPPPTSACCTGLSHANLKCFC  138

Query  321  SYKNSSWLPSLGVDPNLAMTLPKKCKF  401
             YKNS  LPS+GV+P LAM LP KC+ 
Sbjct  139  QYKNSPILPSVGVNPKLAMQLPSKCQI  165



>ref|XP_009604201.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana tomentosiformis]
Length=104

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +3

Query  135  KIIVLAVVMLG---GIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHAD  305
            K+ VL  ++LG    + E+ +  S+CNM+ + L +C+P+   PNP  PSA+CC A+S AD
Sbjct  7    KVGVLGTMVLGILLVLVELTNGLSLCNMNEDGLTACKPSVIQPNPVAPSASCCEALSGAD  66

Query  306  LGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALA  413
            L CLCSY+NS  LPSLG+DP LA+ LP KC  ++ A
Sbjct  67   LQCLCSYRNSLLLPSLGIDPELALALPPKCNLTSPA  102



>emb|CEG62452.1| Lipid binding/ Lipid transporter protein [Cucumis sativus]
Length=101

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 12/104 (12%)
 Frame = +3

Query  132  VKIIVLAVVMLG----GIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISH  299
            +K++ LA+V++     G G+   AQS+CNM    L +CRP+ TPPNP PP+  CC+A++H
Sbjct  5    MKVVALALVLMVVNNIGFGK---AQSICNMPIAGLYACRPSVTPPNPTPPTTQCCSALTH  61

Query  300  ADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALAC*RSPN  431
            ADL C C+Y+NS  L S G++P LAM LPK+C  S     +SPN
Sbjct  62   ADLHCFCAYRNSGALSSFGINPELAMELPKRCNIS-----KSPN  100



>ref|XP_008453924.1| PREDICTED: putative lipid-transfer protein DIR1 [Cucumis melo]
Length=101

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 58/88 (66%), Gaps = 8/88 (9%)
 Frame = +3

Query  168  GIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLP  347
            G GE   AQS+CNM    L +CRPA TPPNP  P+A CC A+  ADL C C+Y+NS  L 
Sbjct  21   GFGE---AQSICNMPIAGLYACRPAVTPPNPTAPTAQCCMALGQADLHCFCAYRNSGALS  77

Query  348  SLGVDPNLAMTLPKKCKFSALAC*RSPN  431
            S G+DPNLAM LPK+C  S     +SPN
Sbjct  78   SFGIDPNLAMQLPKRCNIS-----KSPN  100



>ref|XP_003622804.1| hypothetical protein MTR_7g052640 [Medicago truncatula]
 gb|AES79022.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
 gb|AFK43469.1| unknown [Medicago truncatula]
Length=104

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 68/101 (67%), Gaps = 3/101 (3%)
 Frame = +3

Query  102  IMEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaac  281
            +M+ + KL +   +++ VV++  + +  +  S+CNM+ + L +C+P+ T P P  PS  C
Sbjct  2    VMKEHRKLVS---LLMVVVIMASMLKFSNGMSLCNMNEDGLDACKPSVTQPYPAKPSTEC  58

Query  282  ctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            C A++ ADL CLCSYKNS+ LP LG+DP LA +LPK+C  +
Sbjct  59   CKALTGADLQCLCSYKNSAELPLLGIDPTLAASLPKECDLT  99



>gb|AFK37599.1| unknown [Lotus japonicus]
Length=107

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = +3

Query  141  IVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLC  320
            +++ ++M+    +V    S+CNM+ + +M+C+P+ T PNP  PS  CC A++ ADL CLC
Sbjct  15   LMVVLLMMASTLKVSKGISLCNMNEDGIMACKPSVTKPNPVDPSPECCQALTGADLKCLC  74

Query  321  SYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            SYKNSS LP LG+DP LA++LP KC  +
Sbjct  75   SYKNSSELPLLGIDPTLAVSLPAKCNLT  102



>ref|XP_007142607.1| hypothetical protein PHAVU_007G001800g [Phaseolus vulgaris]
 gb|ESW14601.1| hypothetical protein PHAVU_007G001800g [Phaseolus vulgaris]
Length=101

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  KLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISH  299
            K++ + +  L V  +  +G    A  VC +S   LM+C+ A TPP+P  PS  CC+ +S 
Sbjct  2    KMNAIVVAALVVTEVLLMGAAIDALDVCGVSVTDLMTCKAAVTPPSPSEPSDECCSVVSK  61

Query  300  ADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
             D+ CLC+YKNS  LPSLG+DP+LA+ LP KCK  
Sbjct  62   VDMDCLCNYKNSPLLPSLGIDPDLALQLPAKCKLD  96



>gb|KJB84111.1| hypothetical protein B456_N003400 [Gossypium raimondii]
Length=98

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  KIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGC  314
            K +VL +VM+  + E   A ++C+M+ E L +C+P+   PNP  PS  CC A+  ADL C
Sbjct  5    KFVVL-MVMVALMVEGSRAMTLCDMNDEGLEACKPSVRQPNPVDPSPECCKALKGADLPC  63

Query  315  LCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            LCSYKNS WL S G+DP LA+ LP KCK  
Sbjct  64   LCSYKNSVWLGSFGIDPKLALDLPPKCKLQ  93



>ref|XP_007049604.1| Defective in induced resistance 1 protein [Theobroma cacao]
 gb|EOX93761.1| Defective in induced resistance 1 protein [Theobroma cacao]
Length=99

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = +3

Query  135  KIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGC  314
            K++   ++M+  + E   A ++C++  + L  C+P+ T PNP  PS  CC A+  ADL C
Sbjct  5    KLVASMLIMVALMFEGSRAMTLCDIDDKGLADCKPSVTQPNPVDPSPDCCEALKGADLAC  64

Query  315  LCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            LCSYKNS WLPS G+DP LA++LP KC   
Sbjct  65   LCSYKNSMWLPSFGIDPMLALSLPPKCNLQ  94



>ref|XP_009399057.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=103

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +3

Query  120  KLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc-taIS  296
            KL +V + +  V+ +    EV  AQS+C MS+E L +CRP  +   P    +  C  A+ 
Sbjct  4    KLRSVALAMAVVLAVACTMEV-AAQSLCKMSQEGLDACRPCISTVKPAEQPSDACCAALK  62

Query  297  HADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSA  407
             ADL CLCSYKNS  LP +G+DP  AM LP KC  +A
Sbjct  63   QADLPCLCSYKNSVLLPYIGIDPKRAMQLPAKCSMAA  99



>ref|XP_002283832.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=99

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 6/97 (6%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc  284
            MEAY +   + ++++  V+  G G      S+C M+++ L +C+P+ +  +P PPS ACC
Sbjct  1    MEAYKRFVILALVLVVAVVANGQG------SICRMTQDGLTACKPSVSGQSPLPPSPACC  54

Query  285  taISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKC  395
             AIS ADL CLCS+KNS+ LP LG+DPN+A  LP KC
Sbjct  55   AAISKADLPCLCSFKNSALLPYLGIDPNMATQLPAKC  91



>ref|XP_004229235.1| PREDICTED: putative lipid-transfer protein DIR1 [Solanum lycopersicum]
Length=101

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  IGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPS  350
            I E     ++CNM  + L SC+P+ T PNP  PSA+CC A+S ADL CLCSY+NS  LPS
Sbjct  19   IVEFASGMNICNMDDDGLTSCKPSVTQPNPVEPSASCCEALSGADLQCLCSYRNSFVLPS  78

Query  351  LGVDPNLAMTLPKKCKFSA  407
            LG+DP LA+ LP KC  ++
Sbjct  79   LGIDPELALALPTKCNLTS  97



>ref|XP_009342728.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=106

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc  284
            MEAY KL  +  + LAV +          QS C M++E L +C P+    NP PPSA CC
Sbjct  1    MEAYRKLLVIVALFLAVAIGSDTLMANSDQSFCRMTKEGLNACAPSVNGANPQPPSALCC  60

Query  285  taISHADLGCLCSYKN-SSWLPSLGVDPNLAMTLPKKCK  398
            TA+S+AD GCLC +K  S++L + G+DPNLAM LP KC 
Sbjct  61   TALSYADFGCLCLFKKYSNFLSAYGIDPNLAMQLPAKCN  99



>ref|XP_010069597.1| PREDICTED: putative lipid-transfer protein DIR1 [Eucalyptus grandis]
 gb|KCW57997.1| hypothetical protein EUGRSUZ_H00727 [Eucalyptus grandis]
Length=102

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  186  HAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDP  365
             A ++C MS + L +C+PA T P+P  P+  CC  +S ADL CLCSYKNS+ LP+LG+DP
Sbjct  25   EAITLCKMSDDQLTACKPAVTKPDPAEPTKECCEGLSGADLSCLCSYKNSAILPALGIDP  84

Query  366  NLAMTLPKKCKFSALA  413
            +LAM LP KC  +  A
Sbjct  85   DLAMGLPAKCGLTPPA  100



>ref|XP_006590235.1| PREDICTED: putative lipid-transfer protein DIR1-like [Glycine 
max]
Length=103

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  195  SVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            S CN+S   L++C+PA TPPNPPPP+  CC+ +SHADL CLC YKNS  LPSLG+DP LA
Sbjct  29   STCNVSMSDLLTCKPAVTPPNPPPPTPECCSVLSHADLPCLCPYKNSPLLPSLGIDPKLA  88

Query  375  MTLPKKCKF  401
            + LP KC  
Sbjct  89   LQLPAKCNL  97



>ref|XP_008235902.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=105

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 54/100 (54%), Gaps = 5/100 (5%)
 Frame = +3

Query  129  NVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacct-----aI  293
            N K++ + VV +  + E      +CNMS E L  C+PA     P  P+    T     A+
Sbjct  4    NFKLVFVLVVAMAVLLEGSRVLGLCNMSDEGLAFCKPAVAKATPDKPNPEKPTPECCKAL  63

Query  294  SHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALA  413
              ADL CLC YKNS  LPSLG+DP LAM LP KC  +  A
Sbjct  64   EGADLKCLCGYKNSFLLPSLGIDPALAMALPAKCNLTPPA  103



>ref|XP_011080533.1| PREDICTED: putative lipid-transfer protein DIR1 [Sesamum indicum]
Length=102

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  186  HAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDP  365
            +A S+CN++ +   +C+P+ TPPNP  PS  CC A++ ADL CLCSYKNS  LPSLG+DP
Sbjct  25   NAMSLCNVTEDGFTACKPSVTPPNPEAPSPECCEAVAGADLECLCSYKNSFMLPSLGIDP  84

Query  366  NLAMTLPKKCK  398
            +LA+ LP KC 
Sbjct  85   DLALALPAKCN  95



>gb|EYU46119.1| hypothetical protein MIMGU_mgv1a022331mg, partial [Erythranthe 
guttata]
Length=78

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +3

Query  186  HAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDP  365
             A  +CN++ + L +C+P+   PNP  PS  CC A+S ADL CLCSYKNS  LPSLG+DP
Sbjct  1    KAMDLCNVTEDGLTACKPSVVQPNPVEPSPECCDAVSGADLKCLCSYKNSFMLPSLGIDP  60

Query  366  NLAMTLPKKCKF  401
            +LA+ LP KC  
Sbjct  61   DLALALPAKCNI  72



>ref|XP_008358527.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
 ref|XP_008365974.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=106

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc  284
            MEAY KL  +  + LAV +          Q  C M++E L +C  +    NP PPSA CC
Sbjct  1    MEAYRKLLVIVALFLAVAIGSNALTANSDQRFCRMTKEGLNACALSVNGANPQPPSALCC  60

Query  285  taISHADLGCLCSYKN-SSWLPSLGVDPNLAMTLPKKCK  398
            TA+S+AD GCLC +K  S++L + G+DPNLAM LP KC 
Sbjct  61   TALSYADFGCLCLFKKYSNFLSAYGIDPNLAMQLPAKCN  99



>ref|XP_006342794.1| PREDICTED: putative lipid-transfer protein DIR1-like [Solanum 
tuberosum]
Length=103

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  171  IGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPS  350
            I E     S+C M+ + L SC+P+ T PNP  PSA+CC A+S ADL CLCSY+NS  LPS
Sbjct  21   IVEFTSGLSICKMNDDGLTSCKPSVTQPNPVRPSASCCEALSAADLRCLCSYRNSFVLPS  80

Query  351  LGVDPNLAMTLPKKCKFSA  407
            LG+DP LA+ LP KC  ++
Sbjct  81   LGIDPELALALPTKCNLTS  99



>gb|KHN37258.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=99

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  195  SVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            S CN+S   L++C+PA TPPNPPPP+  CC+ +SHADL CLC YKNS  LPSLG+DP LA
Sbjct  25   STCNVSMSDLLTCKPAVTPPNPPPPTPECCSVLSHADLPCLCPYKNSPLLPSLGIDPKLA  84

Query  375  MTLPKKCKF  401
            + LP KC  
Sbjct  85   LQLPAKCNL  93



>ref|NP_199660.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 dbj|BAA96969.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM64774.1| unknown [Arabidopsis thaliana]
 gb|ABF82604.1| At5g48490 [Arabidopsis thaliana]
 gb|AED95677.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=101

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +3

Query  132  VKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLG  311
            V I+V+ +VM   + E   A  +C M++  L  C PA +  NP  PS  CC A+ HAD  
Sbjct  6    VAIMVIVMVMASLVVERSVAIDLCGMTQAELNECLPAVSKNNPTSPSLLCCNALKHADYT  65

Query  312  CLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            CLC YKNS WL S GVDP LA +LPK+C  +
Sbjct  66   CLCGYKNSPWLGSFGVDPKLASSLPKECDLT  96



>ref|XP_010493672.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
 ref|XP_010493673.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=100

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 57/93 (61%), Gaps = 3/93 (3%)
 Frame = +3

Query  117  TKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaIS  296
            +K +   IIV+ + ML    +   A  +C M+++ L  C+PA T  NP  P+  CCTA+ 
Sbjct  3    SKKAATAIIVMIMAMLV---DRSVAIDLCGMTQDELNECKPAVTKGNPTNPTQPCCTALQ  59

Query  297  HADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKC  395
            HAD  CLC YKNS WL S GVDP LA  LPK+C
Sbjct  60   HADFACLCGYKNSPWLGSFGVDPELASGLPKEC  92



>ref|XP_009396800.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=105

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 3/92 (3%)
 Frame = +3

Query  138  IIVLAVVMLGGIGEVCHA--QSVCNMSREALMSCRpaatppnppppsaacc-taISHADL  308
            ++ +A+V+L        A  QS+C M++E L +C+P      P    +  C  A+  ADL
Sbjct  9    VVAMAMVLLMVAASTTKAADQSLCKMTQEGLAACKPCIAMVKPEEKPSEACCAALKQADL  68

Query  309  GCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
             CLCSYKNS  LP LG+DP  AM LP KC  +
Sbjct  69   PCLCSYKNSDLLPYLGIDPKQAMQLPAKCNIA  100



>gb|EPS67451.1| hypothetical protein M569_07329 [Genlisea aurea]
Length=98

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +3

Query  141  IVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLC  320
            I++A+++   +      Q VC+++   LM CRPAATPP P  PSAACC A+ HAD  CLC
Sbjct  7    ILVAILVFEFVVSAAKGQEVCSLTVGELMECRPAATPPKPENPSAACCKALKHADFKCLC  66

Query  321  SYKNSSWLPSLGVDPNLAMTLPKKCKFSALAC  416
            +Y ++  LPSL +DP LA+ +PKKC      C
Sbjct  67   NYLDNPVLPSLNIDPKLALQIPKKCGLPTPQC  98



>pdb|2RKN|A Chain A, X-Ray Structure Of The Self-Defense And Signaling Protein 
Dir1 From Arabidopsis Taliana
Length=77

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  AQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPN  368
            A  +C MS++ L  C+PA +  NP  PS  CCTA+ HAD  CLC YKNS WL S GVDP 
Sbjct  1    AIDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSFGVDPE  60

Query  369  LAMTLPKKC  395
            LA  LPK+C
Sbjct  61   LASALPKQC  69



>ref|NP_568699.1| putative lipid-transfer protein DIR1 [Arabidopsis thaliana]
 sp|Q8W453.1|DIRL1_ARATH RecName: Full=Putative lipid-transfer protein DIR1; AltName: 
Full=Protein DEFECTIVE IN INDUCED RESISTANCE 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL32935.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL76110.1| DIR1 protein [Arabidopsis thaliana]
 gb|AAP21318.1| At5g48485 [Arabidopsis thaliana]
 gb|AED95676.1| putative lipid-transfer protein DIR1 [Arabidopsis thaliana]
Length=102

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  198  VCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNLAM  377
            +C MS++ L  C+PA +  NP  PS  CCTA+ HAD  CLC YKNS WL S GVDP LA 
Sbjct  29   LCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSFGVDPELAS  88

Query  378  TLPKKC  395
             LPK+C
Sbjct  89   ALPKQC  94



>ref|XP_009358980.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=100

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  192  QSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNL  371
             S+CNM+ E +  C+P+ T  NP PP+  CC A+  ADL CLC YKNS  LPSLG+DP L
Sbjct  25   SSLCNMTDEGIADCKPSVTKTNPTPPTPECCEALKGADLKCLCGYKNSFLLPSLGIDPTL  84

Query  372  AMTLPKKCKFS  404
            AM LP KC  +
Sbjct  85   AMALPAKCNLT  95



>ref|XP_004290137.2| PREDICTED: putative lipid-transfer protein DIR1 [Fragaria vesca 
subsp. vesca]
Length=129

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 55/95 (58%), Gaps = 1/95 (1%)
 Frame = +3

Query  129  NVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADL  308
            N  + +L V ML    E   A + CNMS + L +C+P+   PNP  P+A CC  +S ADL
Sbjct  34   NKLMAILVVAMLVSF-EGSRAFTFCNMSEDGLTACKPSVMKPNPSDPTAECCKDLSAADL  92

Query  309  GCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALA  413
             CLC YK S  LP  G+DP LAM LP KC  +  A
Sbjct  93   DCLCGYKTSPVLPGFGIDPTLAMGLPAKCGLTPPA  127



>gb|AAM62457.1| unknown [Arabidopsis thaliana]
Length=102

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  AQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPN  368
            A  +C MS++ L  C+PA +  NP  PS  CCTA+ HAD  CLC YKNS WL S GVDP 
Sbjct  26   AIDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSFGVDPE  85

Query  369  LAMTLPKKC  395
            LA  LPK+C
Sbjct  86   LASALPKQC  94



>gb|AFK40872.1| unknown [Lotus japonicus]
Length=101

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  135  KIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGC  314
            K++V+  ++L     + + QS+CNMS + L SC PA +  NP  P+ ACC+AI++ADL C
Sbjct  6    KMVVIMGMLLLATAMLANVQSLCNMSNDGLKSCLPAVSGENPADPTLACCSAIANADLPC  65

Query  315  LCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            LC YK+S  L   GVDP+ AM LP KCK 
Sbjct  66   LCHYKSSGLLSFYGVDPDEAMDLPVKCKL  94



>ref|XP_008369792.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=100

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  192  QSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNL  371
             S+CNM+ E +  C+P+ T  NP PP+  CC A+  ADL CLC YKNS  LPSLG+DP L
Sbjct  25   SSLCNMTDEGIADCKPSVTKTNPTPPTPECCEALKGADLKCLCGYKNSFLLPSLGIDPAL  84

Query  372  AMTLPKKCKFS  404
            AM LP KC  +
Sbjct  85   AMALPAKCNLT  95



>ref|XP_010482097.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=103

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  AQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPN  368
            A  +C M+++ L  C+PA T  NP  PS  CCTA+ HAD  CLC YKNS WL S GVDP 
Sbjct  27   AIDLCGMTQDELNECKPAVTKGNPTSPSQLCCTALQHADFACLCGYKNSPWLGSFGVDPE  86

Query  369  LAMTLPKKC  395
            LA  LPK+C
Sbjct  87   LASGLPKEC  95



>ref|XP_007140732.1| hypothetical protein PHAVU_008G137100g [Phaseolus vulgaris]
 gb|ESW12726.1| hypothetical protein PHAVU_008G137100g [Phaseolus vulgaris]
Length=103

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  183  CHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVD  362
            C   S C+M+ E L +C+P+ T PNP  PS  CC A++ ADL CLCSYKNSS LP LG+D
Sbjct  25   CKGLSFCDMNEEGLEACKPSVTEPNPVDPSPECCKALAGADLKCLCSYKNSSELPFLGID  84

Query  363  PNLAMTLPKKCKFS  404
            P LA +LP KC  +
Sbjct  85   PILATSLPAKCNLT  98



>ref|XP_010442271.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=94

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  AQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPN  368
            A  +C M+++ L  C+PA T  NP  PS  CCTA+ HAD  CLC YKNS WL S GVDP 
Sbjct  18   AIDLCGMTQDELNECKPAVTKGNPTSPSQLCCTALQHADFACLCGYKNSPWLGSFGVDPE  77

Query  369  LAMTLPKKC  395
            LA  LPK+C
Sbjct  78   LASGLPKEC  86



>ref|NP_001059387.1| Os07g0287400 [Oryza sativa Japonica Group]
 dbj|BAC16424.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21301.1| Os07g0287400 [Oryza sativa Japonica Group]
 gb|EAZ03527.1| hypothetical protein OsI_25663 [Oryza sativa Indica Group]
 gb|EAZ39444.1| hypothetical protein OsJ_23875 [Oryza sativa Japonica Group]
 dbj|BAG97136.1| unnamed protein product [Oryza sativa Japonica Group]
Length=104

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +3

Query  201  CNMSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            CNMS +  M C+PAA   + P  + +    +A+SHADL CLCSYKNS WL    +DPN A
Sbjct  30   CNMSNDEFMKCQPAAAATSNPTTNPSAGCCSALSHADLNCLCSYKNSPWLSIYNIDPNRA  89

Query  375  MTLPKKC  395
            M LP KC
Sbjct  90   MQLPAKC  96



>ref|XP_002865640.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41899.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=101

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  IIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCL  317
            I+V+ +VM   + E   A  +C M++  L  C PA +  NP  PS  CC A+ HAD  CL
Sbjct  8    IMVIVMVMASLVIERSVAIDLCGMTQAELNECLPAVSKNNPKSPSQLCCNALKHADYTCL  67

Query  318  CSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            C YKNS WL S GVDP LA  LPK+C  +
Sbjct  68   CGYKNSPWLGSFGVDPKLASGLPKECDLA  96



>emb|CDP03961.1| unnamed protein product [Coffea canephora]
Length=111

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +3

Query  177  EVCHAQSVCNMSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPS  350
            E   A S+CNM  + LM+C+P+ TPP P P         A+  ADL CLCSYKNS  LPS
Sbjct  29   EWSRAMSLCNMDEKGLMACKPSVTPPPPDPVDPTSDCCDALKGADLKCLCSYKNSFTLPS  88

Query  351  LGVDPNLAMTLPKKCKFS  404
            LG+DP+LA+ LP KC  +
Sbjct  89   LGIDPDLALALPSKCNLA  106



>ref|XP_006423199.1| hypothetical protein CICLE_v10029642mg [Citrus clementina]
 gb|ESR36439.1| hypothetical protein CICLE_v10029642mg [Citrus clementina]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 63/102 (62%), Gaps = 8/102 (8%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEV---CHAQSVCNMSREALMSCRpaatppnppppsa  275
            MEAY     VK+++LAV++   IG V    +   +C M+++ L +C+PA    NP PPS 
Sbjct  1    MEAY-----VKLLILAVILGLAIGSVPTGVNGDGLCRMTKDGLTACQPAVAASNPSPPST  55

Query  276  acctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            ACC+A+S ADL C C++KNS  L   G+D N AM LP KC  
Sbjct  56   ACCSALSKADLQCFCAFKNSRVLSLYGIDFNQAMQLPAKCNL  97



>ref|XP_002865639.1| hypothetical protein ARALYDRAFT_917749 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41898.1| hypothetical protein ARALYDRAFT_917749 [Arabidopsis lyrata subsp. 
lyrata]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  AQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPN  368
            A  +C M+++ L  C+PA +  NP  PS  CC+A+ HAD  CLC YKNS WL S GVDP 
Sbjct  27   AIDLCGMTQDELNECKPAVSKENPTSPSQPCCSALQHADFTCLCGYKNSPWLGSFGVDPE  86

Query  369  LAMTLPKKC  395
            LA  LPK+C
Sbjct  87   LASGLPKQC  95



>ref|XP_006492236.1| PREDICTED: putative lipid-transfer protein DIR1-like [Citrus 
sinensis]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 7/99 (7%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc  284
            ME   KL    +++LAVVM+ GI E   A S+C MS   L +C+P  T   P   + +  
Sbjct  1    METGKKL----VVLLAVVMMMGI-ESSRALSLCKMSDAGLEACKPYVTQDAPNTAAPSAQ  55

Query  285  --taISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKC  395
               A++ ADL CLC YK S  L + G+DP+LA+ LP KC
Sbjct  56   CCKALAGADLQCLCGYKGSPMLKAFGIDPDLALALPAKC  94



>gb|AAO22703.1| unknown protein [Arabidopsis thaliana]
Length=100

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +3

Query  141  IVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLC  320
            +V+ +VM   + E   A  +C M++  L  C PA +  NP  PS  CC A+ HAD  CLC
Sbjct  8    MVIVMVMASLVVERSVAIDLCGMTQAELNECLPAVSKNNPTSPSLLCCNALKHADYTCLC  67

Query  321  SYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
             YKNS WL S GVDP LA +LPK+C  +
Sbjct  68   GYKNSPWLGSFGVDPKLASSLPKECDLT  95



>ref|XP_008447223.1| PREDICTED: putative lipid-transfer protein DIR1 [Cucumis melo]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = +3

Query  132  VKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRp-aatppnppppsaacctaISHADL  308
            +K+ + AVV+L GI  +  A  +C +  E L +C+P    P     P A CC  +S+AD 
Sbjct  5    LKVKITAVVILVGIAGISIAMEMCGVDEEGLTACKPWVTKPCPTEMPPATCCNKLSNADF  64

Query  309  GCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
             C C YKNS  L S G+DP+LA+ LP KC  +
Sbjct  65   SCFCKYKNSMLLSSFGIDPDLALALPVKCNIT  96



>ref|XP_006281372.1| hypothetical protein CARUB_v10027430mg [Capsella rubella]
 gb|EOA14270.1| hypothetical protein CARUB_v10027430mg [Capsella rubella]
Length=102

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  AQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPN  368
            A  +C M+++ L  C+PA    NP  P+  CCTA+ HAD  CLC YKNS WL S GVDP 
Sbjct  25   AIDLCGMTQDELNECKPAVNKENPTTPTQPCCTALQHADFACLCGYKNSPWLGSFGVDPE  84

Query  369  LAMTLPKKC  395
            LA  LPK C
Sbjct  85   LASGLPKVC  93



>ref|XP_007131858.1| hypothetical protein PHAVU_011G047400g [Phaseolus vulgaris]
 gb|AAC49370.1| non-specific lipid transfer-like protein [Phaseolus vulgaris]
 gb|ESW03852.1| hypothetical protein PHAVU_011G047400g [Phaseolus vulgaris]
Length=102

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 60/99 (61%), Gaps = 5/99 (5%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQ-SVCNMSREALMSCRpaatppnppppsaac  281
            MEAY K    K++++ +++LG +    +AQ S C M ++ L SC  + +  NP  P++ C
Sbjct  1    MEAYKK----KVMIVVMMVLGIVMSGSNAQYSFCRMPKDGLKSCLASVSGDNPVDPTSDC  56

Query  282  ctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCK  398
            C AI+ ADL C C YK+S  L   GVDPN  M LP KCK
Sbjct  57   CLAIAKADLQCFCRYKDSGLLSIYGVDPNKCMELPVKCK  95



>ref|XP_006448002.1| hypothetical protein CICLE_v10017274mg [Citrus clementina]
 gb|ESR61242.1| hypothetical protein CICLE_v10017274mg [Citrus clementina]
Length=103

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = +3

Query  138  IIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc--taISHADLG  311
            +++LAVVM+ GI E   A S+C MS   L +C+P  T   P   + +     A++ ADL 
Sbjct  8    VVLLAVVMMMGI-ESSRALSLCKMSDAGLEACKPYVTQDAPNTAAPSAQCCKALAGADLQ  66

Query  312  CLCSYKNSSWLPSLGVDPNLAMTLPKKC  395
            CLC YK S  L + G+DP+LA+ LP KC
Sbjct  67   CLCGYKGSPMLKAFGIDPDLALALPAKC  94



>ref|XP_007200118.1| hypothetical protein PRUPE_ppa018886mg [Prunus persica]
 gb|EMJ01317.1| hypothetical protein PRUPE_ppa018886mg [Prunus persica]
Length=91

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 45/77 (58%), Gaps = 5/77 (6%)
 Frame = +3

Query  198  VCNMSREALMSCRpaatppnppppsaacct-----aISHADLGCLCSYKNSSWLPSLGVD  362
            +CNMS E L SC+PA     P  P+    T     A+  ADL CLC YKNS  LPSLG+D
Sbjct  13   LCNMSDEGLASCKPAVAKATPEKPNPDKPTPECCEALKGADLKCLCGYKNSFLLPSLGID  72

Query  363  PNLAMTLPKKCKFSALA  413
            P LAM LP KC  +  A
Sbjct  73   PALAMALPAKCNLTPPA  89



>ref|XP_002301823.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
 ref|XP_006386890.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
 gb|ABK93979.1| unknown [Populus trichocarpa]
 gb|EEE81096.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
 gb|ERP64687.1| hypothetical protein POPTR_0002s25240g [Populus trichocarpa]
Length=102

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +3

Query  177  EVCHAQSVCNMSREALMSCRpaatppnppppsaacc-taISHADLGCLCSYKNSSWLPSL  353
            E   A SVC++S + L +C+P+ T P+P  P +  C  A+S A+  CLCSYKNS  LP L
Sbjct  20   EGSRAVSVCDISEDGLAACKPSVTKPDPVEPPSVDCCKAVSGANFTCLCSYKNSYLLPYL  79

Query  354  GVDPNLAMTLPKKCKFS  404
            G+DP+LAM LP KC  S
Sbjct  80   GIDPDLAMALPSKCNLS  96



>gb|EMS50543.1| Putative lipid-transfer protein DIR1 [Triticum urartu]
Length=100

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = +3

Query  144  VLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc--taISHADLGCL  317
             LA+ +L  +     AQ+VC+M  +  M+C+PAA     P P+ +      +  ADL CL
Sbjct  7    ALALTVLLVVALAATAQAVCDMDNDDFMACQPAAAATTDPQPAPSEACCATLGKADLRCL  66

Query  318  CSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            CSYKNS WL    +DP  AM LP KC  +
Sbjct  67   CSYKNSPWLSLYNIDPKRAMELPAKCGLT  95



>gb|KFK31324.1| hypothetical protein AALP_AA6G097600 [Arabis alpina]
Length=100

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +3

Query  171  IGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPS  350
            +G    A  +C MS   L  C+PA    +P  PS  CC A+ HAD  CLC YK S WL S
Sbjct  18   VGRSVVAIELCGMSEAELNECKPAVNKESPTTPSQLCCNALEHADFNCLCGYKTSPWLGS  77

Query  351  LGVDPNLAMTLPKKC  395
             G+DP LA+ LP KC
Sbjct  78   FGIDPTLAVGLPTKC  92



>ref|XP_009364632.1| PREDICTED: putative lipid-transfer protein DIR1, partial [Pyrus 
x bretschneideri]
 ref|XP_009364650.1| PREDICTED: putative lipid-transfer protein DIR1, partial [Pyrus 
x bretschneideri]
Length=108

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 63/104 (61%), Gaps = 7/104 (7%)
 Frame = +3

Query  84   DR*IETIMEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnpp  263
            +R  ET+    + +S   +I+L  ++ G       A S+CN+  + L  CRPA T  +P 
Sbjct  1    ERERETMARTSSVVSWAPVILLLALVAGST-----AVSICNIESDQLKECRPAVTGKSPK  55

Query  264  ppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKC  395
            PP+  CC+ +  A+L CLC++K  S LPS+G+DP LAM LPKKC
Sbjct  56   PPTKRCCSVVRQANLPCLCNFK--SVLPSIGIDPALAMALPKKC  97



>emb|CDY05673.1| BnaC02g38640D [Brassica napus]
Length=103

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +3

Query  171  IGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPS  350
            + E   A  +C M++  L  C+PA +  NP  PS  CC  + HAD  CLC Y+NS WL S
Sbjct  21   LAERSVAIDLCGMTQSELNECKPAVSKENPTKPSTLCCDYLKHADFSCLCGYRNSPWLGS  80

Query  351  LGVDPNLAMTLPKKCKF-SALAC  416
             G+DP LA+ LP KC   +A AC
Sbjct  81   FGIDPALALGLPSKCDMPNAPAC  103



>ref|NP_001237117.1| uncharacterized protein LOC100527769 [Glycine max]
 gb|ACU16933.1| unknown [Glycine max]
 gb|KHN14850.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=104

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +3

Query  102  IMEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaac  281
            IME Y K   +  +VL + M   IG      S C M  + L +C+P+ +   P  PS AC
Sbjct  2    IMEGYNKKVMIVGMVLGMAM---IGMANGQYSFCRMPSDGLAACKPSVSGDYPADPSTAC  58

Query  282  ctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCK  398
            C+AI+ ADL C C +K+S  L   GVDPN  M LP KCK
Sbjct  59   CSAIAKADLKCFCRFKDSGLLSMYGVDPNKCMELPVKCK  97



>gb|KDO51453.1| hypothetical protein CISIN_1g042956mg [Citrus sinensis]
Length=103

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 62/101 (61%), Gaps = 8/101 (8%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEV---CHAQSVCNMSREALMSCRpaatppnppppsa  275
            MEAY     VK+++LAV++   IG V    +   +C M+++ L +C+PA    NP PPS 
Sbjct  1    MEAY-----VKLLILAVILGLAIGSVPTGVNGDGLCRMTKDGLTACQPAVAASNPSPPST  55

Query  276  acctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCK  398
            ACC+A+S ADL C C +KNS  L   G+D + AM LP KC 
Sbjct  56   ACCSALSKADLQCFCVFKNSRVLSFYGIDFHQAMQLPAKCN  96



>gb|AFK44652.1| unknown [Medicago truncatula]
 gb|KEH30408.1| Lipid transfer protein [Medicago truncatula]
Length=104

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 57/103 (55%), Gaps = 9/103 (9%)
 Frame = +3

Query  105  MEAYTKLSNVKII-VLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaac  281
            MEAY K+  V I+ ++A  ML     + + QS+C+M+++ L +C P  +  N        
Sbjct  1    MEAYNKVMIVGILLIIANTML-----LVNGQSLCHMTKQGLKACAPYVSGDNSVNGQKPS  55

Query  282  c---taISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
                +AI+ ADL CLC YK+S  L   G+DPN AM LP  CK 
Sbjct  56   DVCCSAIAKADLQCLCRYKDSGLLSFYGIDPNQAMELPVNCKL  98



>gb|AFK43895.1| unknown [Medicago truncatula]
Length=104

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 57/103 (55%), Gaps = 9/103 (9%)
 Frame = +3

Query  105  MEAYTKLSNVKII-VLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaac  281
            MEAY K+  V I+ ++A  ML     + + QS+C+M+++ L +C P  +  N        
Sbjct  1    MEAYNKVMIVGILLIIANAML-----LVNGQSLCHMTKQGLKACAPYVSGDNSVNGQKPS  55

Query  282  c---taISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
                +AI+ ADL CLC YK+S  L   G+DPN AM LP  CK 
Sbjct  56   DVCCSAIAKADLQCLCRYKDSGLLSFYGIDPNQAMELPVNCKL  98



>gb|AAM28295.1| PVR3-like protein, partial [Ananas comosus]
Length=112

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +3

Query  198  VCNMSREALMSCRpaatppnppppsaacc---taISHADLGCLCSYKNSSWLPSLGVDPN  368
            +CNM+R  L +C+P+    +  P +        A++ ADL CLCSY++S  LPSLG+DP+
Sbjct  36   LCNMTRGGLEACKPSVRSGSSDPAADPSKECCAALAGADLPCLCSYRHSFLLPSLGIDPD  95

Query  369  LAMTLPKKCKFSA  407
            LA+ LP KC  +A
Sbjct  96   LALQLPAKCNLTA  108



>ref|XP_006657616.1| PREDICTED: putative lipid-transfer protein DIR1-like [Oryza brachyantha]
Length=100

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +3

Query  201  CNMSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            CNMS +  M+C+PAA   + P PS +    TA+S ADL CLCSYKNS WL    +DP+ A
Sbjct  26   CNMSNDQFMACQPAAAATSNPTPSPSADCCTALSKADLSCLCSYKNSPWLSLYNIDPSRA  85

Query  375  MTLPKKCKFSA  407
            M LP KC  +A
Sbjct  86   MQLPAKCGLTA  96



>gb|EYU46116.1| hypothetical protein MIMGU_mgv1a025642mg [Erythranthe guttata]
Length=102

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +3

Query  186  HAQSVCNMSREALMSCRpaatppnppppsaac-ctaISHADLGCLCSYKNSSWLPSLGVD  362
             A  +CN++ + L +C+P+   PNP  PS  C    +S ADL CLCSYKN   LPSLG+D
Sbjct  24   KAMDLCNVTEDGLTACKPSVVQPNPVEPSPECCDAVVSGADLKCLCSYKNLFMLPSLGID  83

Query  363  PNLAMTLPKKCKF  401
            P+LA+ LP KC  
Sbjct  84   PDLALALPAKCNI  96



>gb|KDP42880.1| hypothetical protein JCGZ_23822 [Jatropha curcas]
Length=105

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +3

Query  123  LSNVKIIVLAVVMLGGIGEV--CHAQSVCNMSREALMSCRpaatppnppppsaacctaIS  296
            +  VK   +   +L  +GE+   +AQ+VCN   + L+ C+PA TPP+PPPP+  CC  ++
Sbjct  1    MERVKKFFVVATLLIIVGELYLSNAQNVCNTLPQDLLPCKPATTPPHPPPPTGECCLVLA  60

Query  297  HADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
               + CLCS+ NS+ LP+LG+DP+LA+ LP KC  
Sbjct  61   RGGMSCLCSFVNSNLLPALGIDPDLALQLPAKCNL  95



>gb|KEH30405.1| Lipid transfer protein [Medicago truncatula]
Length=104

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 53/103 (51%), Gaps = 9/103 (9%)
 Frame = +3

Query  105  MEAYTKLSNVKII-VLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaac  281
            MEAY K+  V I+ ++A  ML     +   QS+C M+ + L +C P  +           
Sbjct  1    MEAYKKIMIVGILLIIANTML-----LIDGQSLCQMTNKGLKACEPYVSGVKIAAFQIPS  55

Query  282  ct---aISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
                 A + ADL CLCSYK+S  L   G+DP+ AM LP KCK 
Sbjct  56   DACCHATAKADLECLCSYKDSGLLSFYGIDPDQAMDLPVKCKL  98



>ref|XP_006395174.1| hypothetical protein EUTSA_v10005129mg [Eutrema salsugineum]
 gb|ESQ32460.1| hypothetical protein EUTSA_v10005129mg [Eutrema salsugineum]
Length=126

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +3

Query  138  IIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCL  317
             +V+ VV++    E   A  +C M+   L  C+PA T  +P  PS  CC A+ HADL CL
Sbjct  33   FMVMIVVVMAISMESSVAIDLCGMTETELNECKPAVTKESPTSPSQLCCDALKHADLNCL  92

Query  318  CSYKNSSWLPSLGVDPNLAMTLPKKC  395
            C YK+S WL S G+DP LA+ LP  C
Sbjct  93   CGYKHSPWLGSFGIDPELAVGLPTIC  118



>gb|KDP45250.1| hypothetical protein JCGZ_15115 [Jatropha curcas]
Length=102

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +3

Query  177  EVCHAQSVCNMSREALMSCRpaatppnppppsaacc-taISHADLGCLCSYKNSSWLPSL  353
            E   + ++C+M  + L++C+P+ T PNP  P +  C  A+S A+L CLCSY+NS  LPSL
Sbjct  21   EGTRSLNLCDMDDDGLLACKPSVTKPNPVVPPSPKCCKALSGANLTCLCSYRNSLMLPSL  80

Query  354  GVDPNLAMTLPKKCKFSALA  413
            G+DP+LA+ LP KC  +  A
Sbjct  81   GIDPDLALALPAKCNLTTPA  100



>ref|XP_004507410.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cicer arietinum]
Length=105

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 55/104 (53%), Gaps = 10/104 (10%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVV--MLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaa  278
            ME+Y K+  V I++LA+   ML     + + QS C+M++  L SC+P  +  N       
Sbjct  1    MESYRKVMIVGIMLLAIANAML-----LVNGQSYCHMTKSGLNSCKPYVSGDNSVDDQIP  55

Query  279  cct---aISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
                  AIS ADL CLC Y +S  L   GVDP  AM LP KCK 
Sbjct  56   SNACCSAISKADLQCLCRYMDSGLLSFYGVDPKQAMELPVKCKL  99



>ref|XP_006845070.1| hypothetical protein AMTR_s00005p00084040 [Amborella trichopoda]
 gb|ERN06745.1| hypothetical protein AMTR_s00005p00084040 [Amborella trichopoda]
Length=121

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +3

Query  198  VCNMSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPSLGVDPNL  371
            +C MS++   +C+P+ +  +P P + +     A++ ADLGCLCSY++S  LPS G+DP+L
Sbjct  27   ICRMSQDGFKACQPSVSGSSPAPTNPSKVCCKALASADLGCLCSYRHSLLLPSFGIDPDL  86

Query  372  AMTLPKKCKFS  404
            AM LP KC  +
Sbjct  87   AMQLPAKCNLT  97



>ref|NP_001236926.1| uncharacterized protein LOC100527244 precursor [Glycine max]
 gb|ACU16299.1| unknown [Glycine max]
 gb|KHN10581.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=102

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +3

Query  195  SVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            S+CNM  + L +C+P+ T PNP  PS  CC A+  ADL CLCSYKNSS LP LG+D  LA
Sbjct  28   SLCNMDEDGLEACKPSVTQPNPVDPSPDCCKALDGADLKCLCSYKNSSELPLLGIDLTLA  87

Query  375  MTLPKKCKFS  404
             +LP KC  +
Sbjct  88   ASLPAKCNLT  97



>gb|KDP46220.1| hypothetical protein JCGZ_10060 [Jatropha curcas]
Length=109

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 64/100 (64%), Gaps = 3/100 (3%)
 Frame = +3

Query  105  MEAY-TKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaac  281
            MEAY  KL+ +  +V+ + ++        A++ C+M+ E L +CRP+ +  NP  PSAAC
Sbjct  1    MEAYMKKLATILALVMGIALVSNPVVANGAETFCHMTDEGLNACRPSVSGQNPVAPSAAC  60

Query  282  ctaISHADLGCLCSYKNS-SW-LPSLGVDPNLAMTLPKKC  395
            C+A+S ADL CLC YKN+  W L +  +DPN A+ LP KC
Sbjct  61   CSALSKADLQCLCFYKNNYPWLLTTYKIDPNQALQLPVKC  100



>ref|XP_004230985.1| PREDICTED: putative lipid-transfer protein DIR1 [Solanum lycopersicum]
Length=104

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = +3

Query  129  NVKIIVLAVVMLGGIG-EVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHAD  305
            N+ I+   +V++  IG E+  A S+C ++   LM+C+ A + P P PPS  CC A++ AD
Sbjct  6    NLVILFATLVIVAAIGIEMASADSLCGLTIYDLMTCKSAVSGPKPLPPSDKCCAALTKAD  65

Query  306  LGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALAC  416
              CLC++KNS  L    ++  LAM LP KCK  +  C
Sbjct  66   FPCLCTFKNSPMLSDFKINSTLAMDLPSKCKLDSPNC  102



>ref|XP_009601194.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana tomentosiformis]
Length=104

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 6/106 (6%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIG-EVCHA-QSVCNMSREALMSCRpaatppnppppsaa  278
            MEA  KL    +I +A+VM+  +G E+  A  S C +S   LMSC+PA + P P PPS  
Sbjct  1    MEAKQKL----VIFVALVMVASVGIEIAAAGDSSCGLSIADLMSCKPAVSGPKPMPPSEK  56

Query  279  cctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALAC  416
            CCTA+  ADL CLC++KNS  + +  ++  LAM LP KC  ++  C
Sbjct  57   CCTALGKADLPCLCTFKNSPIISTFKINATLAMDLPSKCNLNSPNC  102



>ref|XP_010096215.1| hypothetical protein L484_026950 [Morus notabilis]
 gb|EXB63610.1| hypothetical protein L484_026950 [Morus notabilis]
Length=114

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 58/102 (57%), Gaps = 9/102 (9%)
 Frame = +3

Query  117  TKLSNVKIIVLAVVML---------GGIGEVCHAQSVCNMSREALMSCRpaatppnpppp  269
            T +S   +I+ A++ L         G  GE+ +  S C M++E   SC+P+    NP PP
Sbjct  3    THMSKNLVIIQAILFLSALAILSGVGANGEMTYTYSFCRMTKEGFGSCQPSVDRSNPLPP  62

Query  270  saacctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKC  395
            S ACC AIS +D  CLC +K+S  L    VDP LA+ LP++C
Sbjct  63   SKACCAAISKSDFQCLCYFKDSPLLKIYQVDPQLAVDLPRQC  104



>ref|XP_002527254.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF35098.1| lipid binding protein, putative [Ricinus communis]
Length=102

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +3

Query  177  EVCHAQSVCNMSREALMSCRpaatppnppppsaacc-taISHADLGCLCSYKNSSWLPSL  353
            E   + ++C+M+ + L++C+P+ T P+P  P +  C  A++ A+L CLCSY+NS  LPSL
Sbjct  21   EGSRSLTLCDMNDDGLLACKPSVTKPDPVEPPSPACCQALTGANLTCLCSYRNSLMLPSL  80

Query  354  GVDPNLAMTLPKKCKFSALA  413
            G+DP+LA+ LP KC  +  A
Sbjct  81   GIDPDLALGLPSKCNLTPPA  100



>ref|NP_001236410.1| uncharacterized protein LOC100305511 precursor [Glycine max]
 gb|ACU13214.1| unknown [Glycine max]
 gb|KHN10927.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=103

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +3

Query  195  SVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            S+CNM    L +C+P+ T PNP  PS  CC A++ ADL CLCSYKNSS LP LG+D  LA
Sbjct  28   SLCNMDEGGLEACKPSVTQPNPVDPSPDCCKALAGADLKCLCSYKNSSELPFLGIDRTLA  87

Query  375  MTLPKKCKFS  404
             +LP KC  +
Sbjct  88   TSLPAKCNLT  97



>ref|XP_004292000.1| PREDICTED: putative lipid-transfer protein DIR1 [Fragaria vesca 
subsp. vesca]
Length=108

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 59/107 (55%), Gaps = 11/107 (10%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQS-VCNMSREALMSCRpaatppnppppsaac  281
            MEAY KL    +IV A+V+   IG     QS +C M+++  ++C P+ T    P    A 
Sbjct  1    MEAYKKL----VIVAALVLALAIGSNGQGQSSICRMTKDGFLACAPSVTASATPGFIPAA  56

Query  282  cta-----ISHADLGCLCSY-KNSSWLPSLGVDPNLAMTLPKKCKFS  404
             TA     +S AD  CLC + +NS  L + GVDP+LAM LP KC  +
Sbjct  57   PTAECCSALSVADFPCLCFFMRNSKILNAYGVDPSLAMQLPAKCNLA  103



>ref|XP_010908200.1| PREDICTED: putative lipid-transfer protein DIR1 [Elaeis guineensis]
Length=105

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  189  AQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPN  368
            + S C M+ E L++C P+ T   P  PS  CCTA+S ADL CLC YKNS  L  LG+ P 
Sbjct  28   SDSHCRMTEEGLLACLPSITGSRPVNPSVKCCTALSKADLRCLCHYKNSPMLSQLGIKPQ  87

Query  369  LAMTLPKKCKF  401
            LAM LP KCK 
Sbjct  88   LAMQLPAKCKL  98



>ref|XP_009797273.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana sylvestris]
Length=106

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 8/108 (7%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIG-EVCHA---QSVCNMSREALMSCRpaatppnpppps  272
            MEA  KL    +I +A+VM+  +G EV  A    S C +S   LMSC+PA + P P PPS
Sbjct  1    MEAKQKL----VIFVALVMVAAVGFEVAAAGSGDSPCGLSIGDLMSCKPAVSGPKPLPPS  56

Query  273  aacctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALAC  416
              CC A+  ADL CLC++KNS  + +  ++  LAM LP KC  ++  C
Sbjct  57   EKCCAALGKADLPCLCTFKNSPMISAFKINATLAMDLPSKCNLNSPNC  104



>ref|XP_006365510.1| PREDICTED: putative lipid-transfer protein DIR1-like [Solanum 
tuberosum]
Length=104

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 61/105 (58%), Gaps = 4/105 (4%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIG-EVCHAQSVCNMSREALMSCRpaatppnppppsaac  281
            MEA     N+ I    ++++  IG E+  A S C ++   LM+C+ A + P P PPS  C
Sbjct  1    MEAK---QNLVIFFATLLIVATIGIEMASADSFCGLTINDLMTCKSAVSGPKPLPPSDKC  57

Query  282  ctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALAC  416
            C A++ ADL CLC++KNS  L S  ++  LAM LP KCK  +  C
Sbjct  58   CAALTKADLPCLCTFKNSPMLSSFKINSTLAMDLPSKCKPDSPNC  102



>ref|XP_008236806.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=105

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (62%), Gaps = 8/102 (8%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQ---SVCNMSREALMSCRpaatppnppppsa  275
            M AY KL    + ++A+ +   IG   + Q   + C +++E L +C P+ +  NP PPSA
Sbjct  1    MAAYKKL----VAIVALFLALAIGSEANEQVQITFCRLTKEGLNACAPSVSGLNPLPPSA  56

Query  276  acctaISHADLGCLCSYKN-SSWLPSLGVDPNLAMTLPKKCK  398
             CC+A+S AD  CLC +KN S+ L S G+DPNLAM LP KC 
Sbjct  57   LCCSALSIADFQCLCFFKNYSNLLTSYGIDPNLAMQLPAKCN  98



>ref|XP_007200836.1| hypothetical protein PRUPE_ppa026221mg [Prunus persica]
 gb|EMJ02035.1| hypothetical protein PRUPE_ppa026221mg [Prunus persica]
Length=100

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (62%), Gaps = 8/102 (8%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQ---SVCNMSREALMSCRpaatppnppppsa  275
            M AY KL    ++++A+ +   IG   + Q   + C M++  L +C P+ +  NP PPSA
Sbjct  1    MAAYKKL----VVIVALFLALAIGPEANEQVQVTFCRMTKGGLNACAPSVSGLNPLPPSA  56

Query  276  acctaISHADLGCLCSYKN-SSWLPSLGVDPNLAMTLPKKCK  398
             CC+A+S AD  CLC +KN S+ L S G+DPNLAM LP KC 
Sbjct  57   LCCSALSIADFQCLCFFKNYSNLLTSYGIDPNLAMQLPAKCN  98



>gb|ACG42309.1| PVR3-like protein [Zea mays]
Length=112

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +3

Query  189  AQSVCNMSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPSLGVD  362
            A +VC+MS E  MSC+PAA     PP + +     A++ ADL CLC YKNS W+    +D
Sbjct  34   AAAVCDMSNEQFMSCQPAAAKTTDPPAAPSQACCDALAGADLKCLCGYKNSPWMGVYNID  93

Query  363  PNLAMTLPKKC  395
            P  AM LP KC
Sbjct  94   PKRAMELPAKC  104



>gb|KEH30406.1| Lipid transfer protein [Medicago truncatula]
Length=104

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 53/104 (51%), Gaps = 13/104 (13%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSV--CNMSREALMSCRpaatppnppppsaa  278
            M++Y K       V+ +VML  IG    + S+  CN++RE   +C P  +  N    +  
Sbjct  1    MDSYKK-------VMIMVMLLAIGNAKFSTSITICNLTREERETCEPYVSGENSVDATRK  53

Query  279  ccta----ISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCK  398
               A    ++ ADL C C YKNS  L   G+DP LA+ LP KCK
Sbjct  54   TFKACCSVMAKADLECFCRYKNSILLSYYGIDPKLALELPVKCK  97



>ref|XP_009339389.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=102

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = +3

Query  153  VVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKN  332
            V++L  +     A S+CN+  + L  CRPA T  +P PP+  CC+ +  A+L CLC++K 
Sbjct  13   VILLLALVAGSTAVSICNIESDQLKECRPAVTGKSPKPPTKRCCSVVRQANLPCLCNFK-  71

Query  333  SSWLPSLGVDPNLAMTLPKKC  395
             S LPS+G+DP LAM LPKKC
Sbjct  72   -SVLPSIGIDPALAMALPKKC  91



>ref|XP_004492249.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cicer arietinum]
Length=105

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  195  SVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            S+CNM+ + L +C+PA T P   P    C   ++ ADL CLCSYKNSS LP  G+DP LA
Sbjct  32   SLCNMNEDGLDACKPAVTQPPEDPKPECCKA-LNGADLRCLCSYKNSSELPLFGIDPILA  90

Query  375  MTLPKKCKFSA  407
             +LP KC  + 
Sbjct  91   SSLPAKCNLTP  101



>ref|NP_001238322.1| uncharacterized protein LOC100305636 [Glycine max]
 gb|ACU13421.1| unknown [Glycine max]
 gb|KHN25355.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=103

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 54/98 (55%), Gaps = 2/98 (2%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc  284
            ME Y     +  +VL +VM+G         S C M  + + +C+P+ +  NP  PS  CC
Sbjct  1    MEGYKMKVMIVGMVLGMVMIGMANG--QYYSFCRMPSDGMAACKPSVSGDNPVDPSTDCC  58

Query  285  taISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCK  398
            +AI+ ADL C C YK+S  L   GVDPN  M LP KCK
Sbjct  59   SAIAKADLKCFCRYKDSGLLSMYGVDPNKCMELPVKCK  96



>ref|XP_009335428.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=118

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = +3

Query  153  VVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKN  332
            V++L  +     A S+CN+  + L  CRPA T  +P PP+  CC+ +  A+L CLC++K 
Sbjct  29   VILLLALVAGSTAVSICNIESDQLKECRPAVTGKSPKPPTKRCCSVVRQANLPCLCNFK-  87

Query  333  SSWLPSLGVDPNLAMTLPKKC  395
             S LPS+G+DP LAM LPKKC
Sbjct  88   -SVLPSIGIDPALAMALPKKC  107



>ref|XP_002459717.1| hypothetical protein SORBIDRAFT_02g009300 [Sorghum bicolor]
 gb|EER96238.1| hypothetical protein SORBIDRAFT_02g009300 [Sorghum bicolor]
Length=124

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = +3

Query  192  QSVCNMSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPSLGVDP  365
            ++VC+MS E  MSC+PAA     PP + +     A++ ADL CLC YK+S W+    +DP
Sbjct  47   EAVCDMSNEQFMSCQPAAAKTTDPPAAPSQACCEALAGADLKCLCGYKDSPWMSVYNIDP  106

Query  366  NLAMTLPKKC  395
              AM LP KC
Sbjct  107  KRAMELPAKC  116



>ref|XP_008385814.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=114

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +3

Query  141  IVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLC  320
            ++L + ++ G   V    S+CN+  + L  CRPA T  +P PP+  CC  +  A+L CLC
Sbjct  25   VILLLALVAGXTAV----SICNIESDQLKECRPAVTGKSPKPPTKRCCXVVRQANLPCLC  80

Query  321  SYKNSSWLPSLGVDPNLAMTLPKKC  395
            ++K  S LPS+G+DP LAM LPKKC
Sbjct  81   NFK--SVLPSIGIDPALAMALPKKC  103



>ref|XP_009375630.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=106

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc  284
            MEAY KL  +  ++LAV +          +S C M++E L +C P+ +  NPPPPSA CC
Sbjct  1    MEAYRKLVVLVALLLAVAIGSDALMANSDESFCRMTKEGLNACAPSVSGANPPPPSALCC  60

Query  285  taISHADLGCLCSYKN-SSWLPSLGVDPNLAMTLPKKC  395
            +A+S+AD GCLC +K  S++L + G+DPNLAM LP +C
Sbjct  61   SALSYADFGCLCLFKKYSNFLSAYGIDPNLAMQLPARC  98



>ref|XP_004166453.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
Length=103

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  KIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRp-aatppnppppsaacctaISHADLG  311
            K+ V+ V++L G+  +  A  VC +  + L +C+P    P     P AACC  +S+AD  
Sbjct  6    KVTVMVVLILVGLAGISIAMEVCGVDEDGLTACKPWVTKPCPAEMPPAACCNKLSNADFD  65

Query  312  CLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            C C YKNS  L S G+D +LA+ LP KC  
Sbjct  66   CFCKYKNSMLLSSFGIDSDLALALPVKCNI  95



>ref|XP_006845077.1| hypothetical protein AMTR_s00005p00100950 [Amborella trichopoda]
 gb|ERN06752.1| hypothetical protein AMTR_s00005p00100950 [Amborella trichopoda]
Length=114

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +3

Query  198  VCNMSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPSLGVDPNL  371
            +C MS++   +C+P+ +   P P   +     A+  ADLGCLCSY++S  LP  G+DP+L
Sbjct  28   ICGMSQDGFKACQPSVSDSPPSPTDPSKACCKALGSADLGCLCSYRDSLLLPYFGIDPDL  87

Query  372  AMTLPKKCKFS  404
            AM LP KC  +
Sbjct  88   AMQLPAKCNLA  98



>ref|XP_004150334.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
 gb|KGN44690.1| hypothetical protein Csa_7G372360 [Cucumis sativus]
Length=103

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  KIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRp-aatppnppppsaacctaISHADLG  311
            K+ V+ V++L G+  +  A  VC +  + L +C+P    P     P AACC  +S+AD  
Sbjct  6    KVTVMVVLILVGLAGISIAMEVCGVDEDGLTACKPWVTKPCPAEMPPAACCNKLSNADFD  65

Query  312  CLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            C C YKNS  L S G+D +LA+ LP KC  
Sbjct  66   CFCKYKNSMLLSSFGIDSDLALALPVKCNI  95



>gb|KJB79487.1| hypothetical protein B456_013G052600 [Gossypium raimondii]
Length=106

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 61/102 (60%), Gaps = 3/102 (3%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCR--paatppnppppsaa  278
            ME Y KL  V ++V A + LG    V + Q VC M++E   +C+    A  P+PPPPSAA
Sbjct  1    MEGYAKLMIVTMVV-AGLALGSGPMVANGQKVCGMNKEGFKACQPSVTAGNPSPPPPSAA  59

Query  279  cctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            CC A++ ADL CLC +KNS  +   G+D N A  LP +C  +
Sbjct  60   CCMALNEADLTCLCFFKNSKLMNDYGIDFNRAKDLPVQCNLT  101



>gb|AEB33950.1| defective in induced resistance 2 protein [Nicotiana tabacum]
Length=106

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 64/108 (59%), Gaps = 8/108 (7%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIG-EVCHA---QSVCNMSREALMSCRpaatppnpppps  272
            MEA  KL    +I +A+VM+  +G E+  A    S C +S   LMSC+PA + P P PPS
Sbjct  1    MEAKQKL----VIFVALVMVAAVGFEMAAAGSGDSPCGLSIGDLMSCKPAVSGPKPLPPS  56

Query  273  aacctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALAC  416
              CC A+  ADL CLC++KNS  + +  ++  LAM LP KC  ++  C
Sbjct  57   EKCCAALGKADLPCLCTFKNSPMISAFKINATLAMDLPSKCNLNSPNC  104



>ref|XP_004955968.1| PREDICTED: putative lipid-transfer protein DIR1-like [Setaria 
italica]
Length=101

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +3

Query  201  CNMSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            C MS E  MSC+PAA     PP         A+  ADLGCLC YKNS W+    +DP+ A
Sbjct  26   CGMSNEQFMSCQPAAAKTTDPPAPPTQACCDALGGADLGCLCGYKNSPWMGVYNIDPSRA  85

Query  375  MTLPKKCKFS  404
            M LP KC  +
Sbjct  86   MALPAKCGLA  95



>gb|EMT01414.1| hypothetical protein F775_28625 [Aegilops tauschii]
Length=98

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 7/90 (8%)
 Frame = +3

Query  141  IVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc--taISHADLGC  314
            + L VV++        AQ+VC+M  +  M+C+PAA     P P+ +      +  ADL C
Sbjct  9    LALMVVLVAAT-----AQAVCDMDNDDFMACQPAAAATTAPQPAPSEACCATLGKADLRC  63

Query  315  LCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            LCSYKNS WL    +DP  AM LP KC  +
Sbjct  64   LCSYKNSPWLSLYNIDPKRAMELPAKCGLT  93



>ref|XP_006845076.1| hypothetical protein AMTR_s00005p00099640 [Amborella trichopoda]
 gb|ERN06751.1| hypothetical protein AMTR_s00005p00099640 [Amborella trichopoda]
Length=129

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  291  ISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSA  407
            I  ADLGCLCSY++S  LPSLG++P+ AM LP KC  + 
Sbjct  50   IGSADLGCLCSYRHSILLPSLGINPDHAMKLPAKCSLTT  88



>ref|XP_011092905.1| PREDICTED: putative lipid-transfer protein DIR1 [Sesamum indicum]
Length=111

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGGIGEVCHAQ----SVCNMSREALMSCRpaatppnpppps  272
            ME     +   I+ L V++   +     A     S+C MS++ L+ C+PA    +  PP 
Sbjct  1    MEVSRIATRALIVALVVIVSAAVSATAKANDEGGSLCGMSQDELLECKPAVATGSAAPPP  60

Query  273  aacc--taISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKC  395
             +     A+ HA+L C CS+KN+ +LP  G++   AM LP KC
Sbjct  61   PSGACCAALGHANLTCFCSFKNNKYLPMFGINSTRAMELPSKC  103



>ref|XP_009403612.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=104

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  192  QSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNL  371
            +S C M+ E L++C P+ T  +P  PS  CC A+  ADL CLC Y++S  LP LG++   
Sbjct  28   ESHCKMTEEGLIACLPSMTGASPAKPSPKCCAALGKADLACLCKYEDSPALPQLGINRTF  87

Query  372  AMTLPKKCKFS  404
            A+ LP KCK S
Sbjct  88   ALQLPAKCKLS  98



>ref|XP_008779441.1| PREDICTED: putative lipid-transfer protein DIR1, partial [Phoenix 
dactylifera]
Length=103

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  189  AQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPN  368
            + S C ++ E L++C P+ T   P  PS  CCTA+S ADL CLC YKNS  L  LG+ P 
Sbjct  28   SDSHCRITEEGLLACLPSITGSQPVKPSVWCCTALSKADLLCLCHYKNSPMLSQLGIKPK  87

Query  369  LAMTLPKKCKF  401
            LAM LP KCK 
Sbjct  88   LAMQLPAKCKL  98



>ref|XP_006856839.1| hypothetical protein AMTR_s00055p00181150 [Amborella trichopoda]
 gb|ERN18306.1| hypothetical protein AMTR_s00055p00181150 [Amborella trichopoda]
Length=147

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  177  EVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLG  356
            E  +   +C M    L  C PA   P+P  P+  CC+ I  ADL CLCSY++S  LP+ G
Sbjct  48   EFGNGMEICGMDSGELQQCLPAIRGPSPSAPNPGCCSTIRKADLLCLCSYRDSFLLPTFG  107

Query  357  VDPNLAMTLPKKC  395
            VDP LAM LP++C
Sbjct  108  VDPKLAMALPREC  120



>ref|XP_010679256.1| PREDICTED: putative lipid-transfer protein DIR1 [Beta vulgaris 
subsp. vulgaris]
Length=105

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 60/99 (61%), Gaps = 2/99 (2%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLGG-IGEVCHAQS-VCNMSREALMSCRpaatppnppppsaa  278
            ME   KL N+ I++  ++++GG + +   AQ+ VC +   +L+SC P+   PNP PPSA 
Sbjct  1    MEMGKKLVNLMIVISIIMVVGGELMQRADAQTEVCGIPVTSLLSCLPSVKQPNPAPPSAQ  60

Query  279  cctaISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKC  395
            CC  +  AD  CLCSY +S  LP  G+D  L + LP KC
Sbjct  61   CCATLKQADEKCLCSYSSSPLLPKYGIDKGLFLALPAKC  99



>ref|XP_009129731.1| PREDICTED: putative lipid-transfer protein DIR1 [Brassica rapa]
 emb|CDY48760.1| BnaA02g30210D [Brassica napus]
Length=104

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +3

Query  189  AQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPN  368
            A  +C M++  L  C+PA +  NP  PS  CC  + HAD+ CLC YKNS  L S G+DP 
Sbjct  28   AIDLCGMTQSELNECKPAVSKENPTNPSTLCCDYLKHADISCLCGYKNSPLLGSFGIDPA  87

Query  369  LAMTLPKKC  395
            LA  LP KC
Sbjct  88   LAAGLPTKC  96



>gb|KJB53515.1| hypothetical protein B456_009G445200 [Gossypium raimondii]
Length=106

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +3

Query  144  VLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCS  323
            ++A+ ++  + E     ++CN+    L  CRPA T   PPPP+  CC  I HADL CLC+
Sbjct  13   LVAIFVVIAMVEGAKGATICNIPSSRLNLCRPAVTGRYPPPPTKQCCLLIKHADLNCLCN  72

Query  324  YKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            +K++  LP+  ++P+ A  LPKKCK++
Sbjct  73   FKDA--LPAFNINPSRAFALPKKCKYN  97



>ref|XP_008227058.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=104

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = +3

Query  144  VLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCS  323
            V+A+ ++  +G    A S+CN+    L  CRPA T  +P PP+  CC  +  A+L CLC+
Sbjct  13   VMAIFLIALVGGA-RAVSICNIDSAKLNECRPAVTGNSPKPPTKKCCDVVHQANLPCLCN  71

Query  324  YKNSSWLPSLGVDPNLAMTLPKKC  395
            YK  S  P+ G++P LAM LPKKC
Sbjct  72   YK--SAFPAFGINPALAMALPKKC  93



>ref|XP_008809954.1| PREDICTED: putative lipid-transfer protein DIR1 [Phoenix dactylifera]
Length=104

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = +3

Query  123  LSNVKIIVLAV-VMLGGIGEVCHAQS-VCNMSREALMSCRpaatppnppppsaacctaIS  296
            L N  ++VL + V LG    +   ++  C MS   L+ CRPAA+  NP  PSA CC+AI+
Sbjct  4    LRNQAMVVLVLTVFLGDAVTILGVEAGACKMSTNDLLECRPAASLSNPTEPSAKCCSAIA  63

Query  297  HADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALA  413
             ADL C CSYK+S +L  LG+D N  + LP KC   A A
Sbjct  64   KADLPCFCSYKHSFFLFILGIDVNRVLQLPSKCNIDAHA  102



>ref|XP_010252660.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=100

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +3

Query  186  HAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDP  365
             A ++CNM    L  C PA   P+P  P++ CC  +  ADL CLCSYK  S LP+ G+DP
Sbjct  25   KAMTICNMDSSQLAQCLPAIRGPSPSAPTSECCNIMRTADLHCLCSYK--SILPNFGIDP  82

Query  366  NLAMTLPKKCKF  401
             LAM+LPK+C  
Sbjct  83   ALAMSLPKRCNL  94



>ref|NP_001152561.1| PVR3-like protein [Zea mays]
 gb|ACG41491.1| PVR3-like protein [Zea mays]
 gb|ACG48209.1| PVR3-like protein [Zea mays]
Length=112

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = +3

Query  201  CNMSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            C+MS E  MSC+PAA     PP + +     A++ ADL CLC YKNS W+    +DP  A
Sbjct  38   CDMSNEQFMSCQPAAAKTTDPPAAPSQACCDALAGADLKCLCGYKNSPWMGVYNIDPKRA  97

Query  375  MTLPKKC  395
            M LP KC
Sbjct  98   MELPAKC  104



>ref|NP_001146924.1| PVR3-like protein [Zea mays]
 gb|ACG24402.1| PVR3-like protein [Zea mays]
 gb|ACG24441.1| PVR3-like protein [Zea mays]
 gb|ACG24466.1| PVR3-like protein [Zea mays]
 gb|ACG25053.1| PVR3-like protein [Zea mays]
 gb|ACG25107.1| PVR3-like protein [Zea mays]
 tpg|DAA39398.1| TPA: putative bifunctional inhibitor/lipid-transfer protein/seed 
storage 2S albumin superfamily protein isoform 1 [Zea mays]
 tpg|DAA39399.1| TPA: putative bifunctional inhibitor/lipid-transfer protein/seed 
storage 2S albumin superfamily protein isoform 2 [Zea mays]
Length=115

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = +3

Query  201  CNMSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            C+MS E  MSC+PAA     PP + +     A++ ADL CLC YKNS W+    +DP  A
Sbjct  41   CDMSNEQFMSCQPAAAKTTDPPAAPSQACCDALAGADLKCLCGYKNSPWMGVYNIDPKRA  100

Query  375  MTLPKKC  395
            M LP KC
Sbjct  101  MELPAKC  107



>dbj|BAJ87124.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=102

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 2/94 (2%)
 Frame = +3

Query  129  NVKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacc--taISHA  302
            + K + L ++++     V  A++VC+M  +  M+C+PAA     P P+ +      +  A
Sbjct  4    DRKALALTLLIVVVAVAVVGARAVCDMENDDFMACQPAAAATTDPQPAPSEACCATLGKA  63

Query  303  DLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            DL CLCSYKNS WL    +DP  AM LP KC  +
Sbjct  64   DLRCLCSYKNSPWLSLYNIDPKRAMELPAKCGLT  97



>ref|XP_007042728.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOX98559.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=105

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 56/103 (54%), Gaps = 12/103 (12%)
 Frame = +3

Query  105  MEAYTKLSNVKIIVLAVVMLG-GIGE---VCHAQSVCNMSREALMSCRpaatppnpppps  272
            ME Y K      IVLA ++LG  IG    V + Q VC MS+E   +C P+ +  NP PP 
Sbjct  1    MEGYAK------IVLAAMVLGLAIGSEPFVANGQKVCGMSKEGFQACEPSVSSANPHPPP  54

Query  273  aacc--taISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKC  395
             +     A++ ADL C C +KNS  L + G+D + A  LP +C
Sbjct  55   PSPACCMALNDADLQCFCFFKNSKMLNAYGIDFDRATALPVQC  97



>ref|NP_001235288.1| uncharacterized protein LOC100305686 precursor [Glycine max]
 gb|ACU13501.1| unknown [Glycine max]
 gb|KHN05129.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=103

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +3

Query  132  VKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLG  311
            V+ +V A++ +  +    HA ++CN+    L  CR A T  NPPPP   CC  I  A+L 
Sbjct  10   VEWLVAALLFIALLSGSAHAVAICNIDSSQLNLCRAAVTGQNPPPPDEKCCAVIRQANLR  69

Query  312  CLCSYKNSSWLPSLGVDPNLAMTLPKKC  395
            CLCSYK  S LPS G++P  A+ LP KC
Sbjct  70   CLCSYK--SILPSFGINPKNALALPAKC  95



>ref|XP_002519093.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF43304.1| lipid binding protein, putative [Ricinus communis]
Length=99

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +3

Query  186  HAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNS-SWL-PSLGV  359
            + ++ C ++ E + +CRP+ T  NP  PS ACC A+S ADL CLC YKN+  WL  S  +
Sbjct  19   NGENPCRLTNEGIEACRPSVTGQNPAAPSDACCAALSKADLQCLCFYKNNYPWLLSSYKI  78

Query  360  DPNLAMTLPKKCKF  401
            DPNLAM LP KCK 
Sbjct  79   DPNLAMQLPVKCKL  92



>gb|KHG21649.1| Putative lipid-transfer DIR1 -like protein [Gossypium arboreum]
Length=152

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = +3

Query  144  VLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCS  323
            ++A+ ++  + E     ++CN+    L  CRPA T   PPPP+  CC  I HADL CLC 
Sbjct  13   LVAIFVVIAMVEGAKGATICNIPLSRLNLCRPAVTGRYPPPPTKKCCLLIKHADLNCLCK  72

Query  324  YKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            +K++  LP+  ++P+ A  LPKKCK++
Sbjct  73   FKDA--LPAFNINPSRAFALPKKCKYN  97



>ref|XP_010545262.1| PREDICTED: putative lipid-transfer protein DIR1 [Tarenaya hassleriana]
Length=103

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = +3

Query  132  VKIIVLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLG  311
            ++ +V+A+ +   + E  +   +CN+    L  CR A T   PPPP+  CC  I  +DL 
Sbjct  7    LQCLVMAMALTAIVVEEAYGIPICNIDTNDLGQCRAAVTGNQPPPPTGECCGVIKRSDLS  66

Query  312  CLCSYKNSSWLPSLGVDPNLAMTLPKKCKFS  404
            CLC YK  S+LP++G+DP+ A TL  KC  S
Sbjct  67   CLCKYK--SYLPAVGIDPSKATTLLSKCGIS  95



>gb|EYU42633.1| hypothetical protein MIMGU_mgv1a024655mg [Erythranthe guttata]
Length=112

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 54/98 (55%), Gaps = 4/98 (4%)
 Frame = +3

Query  132  VKIIVLAVVMLGGIGEVCHAQS--VCNMSREALMSCRpaatppnppppsaacc--taISH  299
            +  +V+A   + G+ +   +    +C MS++ L  C+PA    +  PP  +    TA++H
Sbjct  13   IAFVVIAASAVSGMAKAASSDDNGLCGMSQDELFECKPAVAAGSAIPPPPSAACCTALTH  72

Query  300  ADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKFSALA  413
            A+  C C++KN+ +LP  G++   AM LP KC  + +A
Sbjct  73   ANATCFCTFKNNKYLPLFGINSTRAMQLPSKCDPTQIA  110



>ref|XP_007212412.1| hypothetical protein PRUPE_ppa016471mg, partial [Prunus persica]
 gb|EMJ13611.1| hypothetical protein PRUPE_ppa016471mg, partial [Prunus persica]
Length=89

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 49/84 (58%), Gaps = 6/84 (7%)
 Frame = +3

Query  144  VLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCS  323
            +  + ++GG      A  +CN+    L  CRPA T  +P PP+  CC  +  A+L CLC+
Sbjct  3    IFLIALVGGA----RAVPICNIDSAKLNECRPAVTGNSPKPPTKKCCDVVHQANLPCLCN  58

Query  324  YKNSSWLPSLGVDPNLAMTLPKKC  395
            YK  S  P+ G++P LAM LPKKC
Sbjct  59   YK--SAFPAFGINPALAMALPKKC  80



>ref|XP_002275805.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=107

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 6/81 (7%)
 Frame = +3

Query  153  VVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKN  332
            + M+GG      A ++CN+    L  C PA +  +PPPP+ ACCTA+  ADL CLC+YK 
Sbjct  19   IAMVGGA----SAATICNIDTSKLAECLPAVSGRSPPPPTKACCTALLSADLHCLCNYK-  73

Query  333  SSWLPSLGVDPNLAMTLPKKC  395
             S LP+ G++P LAM LPKKC
Sbjct  74   -SALPAFGINPALAMALPKKC  93



>emb|CAN61352.1| hypothetical protein VITISV_027758 [Vitis vinifera]
Length=107

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 6/81 (7%)
 Frame = +3

Query  153  VVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKN  332
            + M+GG      A ++CN+    L  C PA +  +PPPP+ ACCTA+  ADL CLC+YK 
Sbjct  19   IAMVGGS----SAATICNIDTSKLAECLPAVSGRSPPPPTKACCTALLSADLHCLCNYK-  73

Query  333  SSWLPSLGVDPNLAMTLPKKC  395
             S LP+ G++P LAM LPKKC
Sbjct  74   -SALPAFGINPALAMALPKKC  93



>ref|XP_006845078.1| hypothetical protein AMTR_s00005p00101720 [Amborella trichopoda]
 gb|ERN06753.1| hypothetical protein AMTR_s00005p00101720 [Amborella trichopoda]
Length=91

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  291  ISHADLGCLCSYKNSSWLPSLGVDPNLAMTLPKKCKF  401
            I  ADLGCLCSY++S  L SLG++P+LA+ LP KC  
Sbjct  31   IGSADLGCLCSYRHSLLLHSLGINPDLALQLPAKCNL  67



>ref|XP_003570573.1| PREDICTED: putative lipid-transfer protein DIR1 [Brachypodium 
distachyon]
Length=103

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 37/74 (50%), Gaps = 3/74 (4%)
 Frame = +3

Query  201  CNMSREALMSCRpaatppnppppsaacct---aISHADLGCLCSYKNSSWLPSLGVDPNL  371
            C+M  +  M+C+PAA     P P          +  ADL CLCSYK S WL    +DP  
Sbjct  28   CDMDNDDFMACQPAAAATTSPTPPDPSAACCATLGKADLKCLCSYKKSPWLSLYNIDPKR  87

Query  372  AMTLPKKCKFSALA  413
            AM LP KC  S  A
Sbjct  88   AMELPAKCGLSPPA  101



>ref|XP_010097506.1| hypothetical protein L484_024714 [Morus notabilis]
 gb|EXB68697.1| hypothetical protein L484_024714 [Morus notabilis]
Length=90

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -3

Query  376  MARLGSTPREGSQEEFL*EQRQPRSAWEMAVQHaaeggggfggvaaGRQDISASLDMLQT  197
            MAR GS PREGS  EFL EQRQ RSA+  A Q   +GG GFG V AG QD+   +  LQ 
Sbjct  1    MARFGSIPREGSSCEFLYEQRQLRSAFVSAAQQVVDGGLGFGAVTAGLQDMRPLIGTLQM  60

Query  196  DWAWHT  179
             WA  +
Sbjct  61   VWALES  66



>ref|XP_008236785.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=107

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query  180  VCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKN-SSWLPSLG  356
            V + QS C M++E L +C PA +  NP PPSA CC+A+  AD  CLC +K  S+ L + G
Sbjct  27   VNNEQSFCRMTKEGLNACAPAVSGQNPLPPSALCCSALKTADFQCLCLFKKYSNLLSAYG  86

Query  357  VDPNLAMTLPKKC  395
            +DPNLAM LP KC
Sbjct  87   IDPNLAMQLPAKC  99



>ref|XP_007200072.1| hypothetical protein PRUPE_ppa021237mg [Prunus persica]
 gb|EMJ01271.1| hypothetical protein PRUPE_ppa021237mg [Prunus persica]
Length=107

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query  180  VCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKN-SSWLPSLG  356
            V + QS C M++E L +C PA +  NP PPSA CC+A+  AD  CLC +K  S+ L + G
Sbjct  27   VNNEQSFCRMTKEGLNACAPAVSGQNPLPPSALCCSALKTADFQCLCLFKKYSNLLSAYG  86

Query  357  VDPNLAMTLPKKC  395
            +DPNLAM LP KC
Sbjct  87   IDPNLAMQLPAKC  99



>gb|ACG31932.1| PVR3-like protein [Zea mays]
Length=73

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +3

Query  207  MSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPSLGVDPNLAMT  380
            MS E  MSC+ AA     PP + +      ++ ADL CLC YKNS W+    +DP  AM 
Sbjct  1    MSNEQFMSCQXAAAKTTDPPAAPSQACCDXLAGADLKCLCGYKNSPWMGVYNIDPKRAME  60

Query  381  LPKKC  395
            LP KC
Sbjct  61   LPAKC  65



>ref|XP_010646191.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
 ref|XP_010646192.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=104

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +3

Query  195  SVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            ++C+M    L  C PA   P+P PP+  CC  I  AD+ CLCSYK++  LP+ GV+P LA
Sbjct  29   TICSMDSTQLAQCLPAIRGPSPSPPTKECCAVIQKADMHCLCSYKHA--LPNFGVNPGLA  86

Query  375  MTLPKKC  395
            M LPKKC
Sbjct  87   MALPKKC  93



>gb|KHG12015.1| Putative lipid-transfer DIR1 -like protein [Gossypium arboreum]
Length=106

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = +3

Query  144  VLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCS  323
            ++A ++L    E     ++CN+  + L  C+PA T  NPPPP+  CC+ I  ADL CLC+
Sbjct  13   LVATLLLIAAVEGAKETTICNIPLKKLEQCKPAVTGKNPPPPTKECCSLIKQADLTCLCN  72

Query  324  YKNSSWLPSLGVDPNLAMTLPKKCK  398
            YK++  LP+  ++P+ A  LP+KCK
Sbjct  73   YKDA--LPAFQIEPSRAFALPQKCK  95



>gb|KJB13794.1| hypothetical protein B456_002G094700 [Gossypium raimondii]
Length=106

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = +3

Query  144  VLAVVMLGGIGEVCHAQSVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCS  323
            ++A ++L    E     ++CN+  + L  C+PA T  NPPPP+  CC+ I  ADL CLC+
Sbjct  13   LVATLLLIAAVEGAKETTICNIPLKKLEQCKPAVTGENPPPPTKECCSLIKQADLTCLCN  72

Query  324  YKNSSWLPSLGVDPNLAMTLPKKCK  398
            YK++  LP+  ++P+ A  LP+KCK
Sbjct  73   YKDA--LPAFQIEPSRAFALPQKCK  95



>gb|ACG31910.1| PVR3-like protein [Zea mays]
Length=73

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 37/65 (57%), Gaps = 2/65 (3%)
 Frame = +3

Query  207  MSREALMSCRpaatppnppppsaacc--taISHADLGCLCSYKNSSWLPSLGVDPNLAMT  380
            MS E  MSC PAA     PP + +     A++ ADL CLC YKNS W+    +DP  AM 
Sbjct  1    MSNEQFMSCXPAAAKTTDPPAAPSQACCDALAGADLKCLCGYKNSPWMGVYNIDPKRAME  60

Query  381  LPKKC  395
            LP KC
Sbjct  61   LPAKC  65



>emb|CAN72894.1| hypothetical protein VITISV_022314 [Vitis vinifera]
Length=133

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +3

Query  195  SVCNMSREALMSCRpaatppnppppsaacctaISHADLGCLCSYKNSSWLPSLGVDPNLA  374
            ++C+M    L  C PA   P+P PP+  CC  I  AD+ CLCSYK++  LP+ GV+P LA
Sbjct  29   TICSMDSTQLAQCLPAIXGPSPSPPTKECCAVIQKADMHCLCSYKHA--LPNFGVNPGLA  86

Query  375  MTLPKKC  395
            M LPKKC
Sbjct  87   MALPKKC  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760