BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G05

Length=462
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009597452.1|  PREDICTED: uncharacterized protein LOC104093419    108   2e-26   Nicotiana tomentosiformis
ref|XP_009787318.1|  PREDICTED: uncharacterized protein LOC104235292    105   3e-25   Nicotiana sylvestris
ref|XP_004241275.1|  PREDICTED: uncharacterized protein LOC101262623    105   4e-25   Solanum lycopersicum
ref|XP_009593461.1|  PREDICTED: uncharacterized protein LOC104090119    104   8e-25   Nicotiana tomentosiformis
ref|XP_009767681.1|  PREDICTED: uncharacterized protein LOC104218792    104   8e-25   Nicotiana sylvestris
gb|KDP44049.1|  hypothetical protein JCGZ_05516                         103   3e-24   Jatropha curcas
ref|XP_002285165.1|  PREDICTED: uncharacterized protein LOC100253658  99.0    1e-22   Vitis vinifera
ref|XP_010253678.1|  PREDICTED: uncharacterized protein LOC104594856  98.2    2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_007206026.1|  hypothetical protein PRUPE_ppa012473mg           98.2    2e-22   Prunus persica
emb|CAN61164.1|  hypothetical protein VITISV_001394                   98.2    2e-22   Vitis vinifera
ref|XP_006365734.1|  PREDICTED: uncharacterized protein LOC102600128  97.4    5e-22   Solanum tuberosum [potatoes]
ref|XP_006340195.1|  PREDICTED: uncharacterized protein LOC102589274  96.3    1e-21   Solanum tuberosum [potatoes]
gb|EYU18831.1|  hypothetical protein MIMGU_mgv1a015289mg              95.9    1e-21   Erythranthe guttata [common monkey flower]
ref|XP_010264683.1|  PREDICTED: uncharacterized protein LOC104602622  94.7    4e-21   Nelumbo nucifera [Indian lotus]
ref|XP_004291575.1|  PREDICTED: uncharacterized protein LOC101299444  94.7    5e-21   Fragaria vesca subsp. vesca
ref|XP_008225670.1|  PREDICTED: uncharacterized protein LOC103325290  94.0    8e-21   Prunus mume [ume]
gb|ACJ83912.1|  unknown                                               93.2    1e-20   Medicago truncatula
ref|XP_003606376.1|  hypothetical protein MTR_4g059320                93.2    1e-20   Medicago truncatula
ref|XP_010098187.1|  hypothetical protein L484_007649                 90.5    2e-19   Morus notabilis
ref|XP_011089909.1|  PREDICTED: uncharacterized protein LOC105170719  88.6    7e-19   Sesamum indicum [beniseed]
ref|XP_002864697.1|  hypothetical protein ARALYDRAFT_496217           88.6    7e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_004251136.1|  PREDICTED: uncharacterized protein LOC101259309  88.6    9e-19   Solanum lycopersicum
ref|XP_009126590.1|  PREDICTED: uncharacterized protein LOC103851491  88.2    1e-18   Brassica rapa
ref|XP_007150200.1|  hypothetical protein PHAVU_005G134900g           87.8    1e-18   Phaseolus vulgaris [French bean]
ref|XP_008385317.1|  PREDICTED: uncharacterized protein LOC103447887  87.8    2e-18   
ref|XP_011044356.1|  PREDICTED: uncharacterized protein LOC105139576  87.0    4e-18   Populus euphratica
ref|XP_006281214.1|  hypothetical protein CARUB_v10027254mg           86.7    5e-18   Capsella rubella
ref|XP_010483718.1|  PREDICTED: uncharacterized protein LOC104762175  85.9    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010456667.1|  PREDICTED: transcription initiation factor T...  85.1    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002314267.1|  hypothetical protein POPTR_0009s01960g           85.5    2e-17   
ref|XP_011089296.1|  PREDICTED: uncharacterized protein LOC105170296  83.2    9e-17   Sesamum indicum [beniseed]
ref|XP_010443870.1|  PREDICTED: transcription initiation factor T...  83.2    9e-17   Camelina sativa [gold-of-pleasure]
ref|XP_003543482.1|  PREDICTED: uncharacterized protein LOC100814909  81.3    3e-16   Glycine max [soybeans]
ref|XP_011089908.1|  PREDICTED: uncharacterized protein LOC105170718  80.9    5e-16   Sesamum indicum [beniseed]
ref|XP_010535607.1|  PREDICTED: uncharacterized protein LOC104810859  80.9    6e-16   Tarenaya hassleriana [spider flower]
gb|KJB20287.1|  hypothetical protein B456_003G141800                  80.5    9e-16   Gossypium raimondii
ref|XP_011040881.1|  PREDICTED: uncharacterized protein LOC105137020  80.1    2e-15   Populus euphratica
ref|XP_008359263.1|  PREDICTED: uncharacterized protein LOC103422971  79.3    2e-15   Malus domestica [apple tree]
ref|NP_200876.1|  uncharacterized protein                             78.6    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006424568.1|  hypothetical protein CICLE_v10029410mg           78.6    5e-15   Citrus clementina [clementine]
ref|XP_008462513.1|  PREDICTED: uncharacterized protein LOC103500846  78.6    5e-15   Cucumis melo [Oriental melon]
ref|XP_004139450.1|  PREDICTED: uncharacterized protein LOC101217269  77.8    9e-15   Cucumis sativus [cucumbers]
gb|KDO73285.1|  hypothetical protein CISIN_1g031000mg                 77.4    1e-14   Citrus sinensis [apfelsine]
gb|KJB83835.1|  hypothetical protein B456_013G266800                  77.0    2e-14   Gossypium raimondii
emb|CBI32733.3|  unnamed protein product                              77.0    2e-14   Vitis vinifera
emb|CAN66257.1|  hypothetical protein VITISV_001236                   76.6    2e-14   Vitis vinifera
ref|XP_006384902.1|  hypothetical protein POPTR_0004s22060g           76.3    2e-14   
ref|XP_003540175.1|  PREDICTED: uncharacterized protein LOC100817341  76.3    2e-14   Glycine max [soybeans]
ref|XP_008243937.1|  PREDICTED: uncharacterized protein LOC103342133  76.3    3e-14   Prunus mume [ume]
ref|XP_007207567.1|  hypothetical protein PRUPE_ppa016754mg           76.3    3e-14   Prunus persica
gb|AAM62875.1|  unknown                                               75.9    4e-14   Arabidopsis thaliana [mouse-ear cress]
gb|EPS60592.1|  hypothetical protein M569_14211                       75.1    7e-14   Genlisea aurea
ref|XP_006400822.1|  hypothetical protein EUTSA_v10015882mg           75.1    9e-14   Eutrema salsugineum [saltwater cress]
gb|EYU36187.1|  hypothetical protein MIMGU_mgv1a015493mg              74.7    1e-13   Erythranthe guttata [common monkey flower]
gb|KFK33927.1|  hypothetical protein AALP_AA5G079000                  74.3    1e-13   Arabis alpina [alpine rockcress]
ref|XP_009120602.1|  PREDICTED: uncharacterized protein LOC103845482  74.3    1e-13   Brassica rapa
emb|CDY65979.1|  BnaCnng49210D                                        73.6    2e-13   Brassica napus [oilseed rape]
ref|XP_002281329.1|  PREDICTED: uncharacterized protein LOC100258555  73.6    3e-13   Vitis vinifera
ref|XP_008463944.1|  PREDICTED: uncharacterized protein LOC103501949  73.6    3e-13   Cucumis melo [Oriental melon]
ref|XP_003597242.1|  hypothetical protein MTR_2g094410                73.2    3e-13   Medicago truncatula
gb|AFK43089.1|  unknown                                               73.2    3e-13   Medicago truncatula
ref|XP_009367072.1|  PREDICTED: uncharacterized protein LOC103956768  73.2    4e-13   Pyrus x bretschneideri [bai li]
ref|XP_010107536.1|  hypothetical protein L484_024389                 72.8    5e-13   Morus notabilis
ref|XP_007016742.1|  Uncharacterized protein TCM_042056               72.8    7e-13   Theobroma cacao [chocolate]
ref|XP_010520370.1|  PREDICTED: uncharacterized protein LOC104799504  71.6    1e-12   Tarenaya hassleriana [spider flower]
gb|KJB21560.1|  hypothetical protein B456_004G001300                  71.6    1e-12   Gossypium raimondii
ref|XP_010425944.1|  PREDICTED: uncharacterized protein LOC104710...  69.7    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010425942.1|  PREDICTED: uncharacterized protein LOC104710...  69.7    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010425943.1|  PREDICTED: uncharacterized protein LOC104710...  68.9    9e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010031997.1|  PREDICTED: uncharacterized protein LOC104421661  68.9    1e-11   Eucalyptus grandis [rose gum]
gb|KCW51389.1|  hypothetical protein EUGRSUZ_J00928                   68.9    2e-11   Eucalyptus grandis [rose gum]
emb|CAN74756.1|  hypothetical protein VITISV_021482                   69.7    2e-11   Vitis vinifera
ref|XP_009796302.1|  PREDICTED: uncharacterized protein LOC104242882  68.6    2e-11   Nicotiana sylvestris
ref|XP_010274752.1|  PREDICTED: uncharacterized protein LOC104609997  66.2    4e-11   
ref|XP_002877392.1|  hypothetical protein ARALYDRAFT_484911           67.0    5e-11   
ref|NP_180407.1|  uncharacterized protein                             67.0    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190107.1|  uncharacterized protein                             66.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004487109.1|  PREDICTED: uncharacterized protein LOC101512341  67.0    6e-11   
ref|XP_010261646.1|  PREDICTED: uncharacterized protein LOC104600417  67.0    7e-11   
ref|XP_008391399.1|  PREDICTED: uncharacterized protein LOC103453622  65.9    2e-10   
ref|XP_009122724.1|  PREDICTED: uncharacterized protein LOC103847398  65.9    2e-10   Brassica rapa
ref|XP_010689547.1|  PREDICTED: uncharacterized protein LOC104903237  65.5    2e-10   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX80857.1|  BnaC03g01110D                                        65.1    3e-10   
gb|KFK27594.1|  hypothetical protein AALP_AA8G404000                  64.7    3e-10   Arabis alpina [alpine rockcress]
ref|XP_007145215.1|  hypothetical protein PHAVU_007G220200g           64.7    4e-10   Phaseolus vulgaris [French bean]
ref|XP_010510626.1|  PREDICTED: uncharacterized protein LOC104786871  63.9    7e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010274532.1|  PREDICTED: uncharacterized protein LOC104609834  63.5    8e-10   
gb|KCW85739.1|  hypothetical protein EUGRSUZ_B02501                   64.3    9e-10   Eucalyptus grandis [rose gum]
ref|XP_009342883.1|  PREDICTED: uncharacterized protein LOC103934848  63.5    9e-10   Pyrus x bretschneideri [bai li]
ref|XP_010043750.1|  PREDICTED: uncharacterized protein LOC104432877  63.5    1e-09   Eucalyptus grandis [rose gum]
ref|XP_009786538.1|  PREDICTED: uncharacterized protein LOC104234640  63.2    1e-09   Nicotiana sylvestris
ref|XP_010514861.1|  PREDICTED: uncharacterized protein LOC104790774  62.4    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_002322879.1|  hypothetical protein POPTR_0016s09110g           62.4    2e-09   
ref|XP_009610044.1|  PREDICTED: uncharacterized protein LOC104103814  62.4    2e-09   Nicotiana tomentosiformis
ref|XP_006292450.1|  hypothetical protein CARUB_v10018671mg           62.4    3e-09   Capsella rubella
emb|CDY11244.1|  BnaA03g00800D                                        62.4    3e-09   Brassica napus [oilseed rape]
ref|XP_010553009.1|  PREDICTED: uncharacterized protein LOC104823238  62.0    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_010470084.1|  PREDICTED: uncharacterized protein LOC104750056  62.0    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006428783.1|  hypothetical protein CICLE_v10012912mg           62.0    4e-09   Citrus clementina [clementine]
gb|KDO45145.1|  hypothetical protein CISIN_1g030317mg                 62.0    4e-09   Citrus sinensis [apfelsine]
ref|XP_008387660.1|  PREDICTED: uncharacterized protein LOC103450120  61.6    4e-09   
ref|XP_009612829.1|  PREDICTED: uncharacterized protein LOC104106054  61.2    5e-09   Nicotiana tomentosiformis
ref|XP_006481461.1|  PREDICTED: uncharacterized protein LOC102610402  61.6    5e-09   Citrus sinensis [apfelsine]
ref|XP_006288791.1|  hypothetical protein CARUB_v10002114mg           61.2    5e-09   Capsella rubella
ref|XP_003542516.1|  PREDICTED: uncharacterized protein LOC100790091  61.2    6e-09   Glycine max [soybeans]
ref|XP_006398768.1|  hypothetical protein EUTSA_v10014814mg           61.2    6e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010414527.1|  PREDICTED: uncharacterized protein LOC104700687  60.5    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010543396.1|  PREDICTED: uncharacterized protein LOC104816337  60.5    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_010934341.1|  PREDICTED: uncharacterized protein LOC105054512  60.1    1e-08   Elaeis guineensis
ref|XP_003537294.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  60.5    1e-08   Glycine max [soybeans]
gb|KHN39078.1|  hypothetical protein glysoja_017372                   60.5    1e-08   Glycine soja [wild soybean]
ref|XP_009130722.1|  PREDICTED: uncharacterized protein LOC103855485  60.1    1e-08   Brassica rapa
ref|XP_002871018.1|  hypothetical protein ARALYDRAFT_908188           59.3    2e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_006419060.1|  hypothetical protein EUTSA_v10002696mg           59.3    3e-08   Eutrema salsugineum [saltwater cress]
ref|XP_003538194.2|  PREDICTED: uncharacterized protein LOC100782946  59.3    3e-08   Glycine max [soybeans]
emb|CDX77180.1|  BnaC04g39750D                                        59.3    3e-08   
ref|XP_006409865.1|  hypothetical protein EUTSA_v10017334mg           59.3    3e-08   Eutrema salsugineum [saltwater cress]
ref|XP_011007679.1|  PREDICTED: uncharacterized protein LOC105113274  58.9    3e-08   Populus euphratica
ref|XP_004145741.1|  PREDICTED: uncharacterized protein LOC101215539  58.9    3e-08   Cucumis sativus [cucumbers]
ref|XP_007027332.1|  Uncharacterized protein TCM_022158               58.9    3e-08   
gb|KDP29113.1|  hypothetical protein JCGZ_16502                       58.9    4e-08   Jatropha curcas
ref|XP_010503169.1|  PREDICTED: uncharacterized protein LOC104780370  58.5    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006381452.1|  hypothetical protein POPTR_0006s12970g           58.5    4e-08   
gb|KJB62453.1|  hypothetical protein B456_009G417700                  58.5    5e-08   Gossypium raimondii
ref|NP_195943.1|  uncharacterized protein                             58.5    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006354325.1|  PREDICTED: uncharacterized protein LOC102591579  58.2    7e-08   Solanum tuberosum [potatoes]
ref|XP_010490791.1|  PREDICTED: uncharacterized protein LOC104768490  57.8    8e-08   Camelina sativa [gold-of-pleasure]
gb|AFK48660.1|  unknown                                               57.8    8e-08   Lotus japonicus
ref|XP_006363694.1|  PREDICTED: uncharacterized protein LOC102595296  57.4    1e-07   Solanum tuberosum [potatoes]
dbj|BAJ92790.1|  predicted protein                                    57.8    1e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003539761.1|  PREDICTED: uncharacterized protein LOC100812183  57.8    1e-07   Glycine max [soybeans]
ref|XP_009140901.1|  PREDICTED: uncharacterized protein LOC103864886  57.0    1e-07   Brassica rapa
gb|EPS70245.1|  hypothetical protein M569_04515                       57.0    1e-07   Genlisea aurea
emb|CDY62461.1|  BnaA04g28420D                                        57.0    1e-07   Brassica napus [oilseed rape]
ref|NP_001053333.1|  Os04g0520700                                     57.4    1e-07   
gb|EYU38536.1|  hypothetical protein MIMGU_mgv1a018290mg              57.0    1e-07   Erythranthe guttata [common monkey flower]
gb|EPS62644.1|  hypothetical protein M569_12146                       56.6    2e-07   Genlisea aurea
ref|XP_008785283.1|  PREDICTED: uncharacterized protein LOC103703964  56.6    2e-07   Phoenix dactylifera
gb|KHN48294.1|  hypothetical protein glysoja_007963                   56.6    2e-07   Glycine soja [wild soybean]
ref|XP_010452194.1|  PREDICTED: uncharacterized protein LOC104734339  56.6    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_011048547.1|  PREDICTED: uncharacterized protein LOC105142559  56.6    2e-07   Populus euphratica
ref|XP_010423745.1|  PREDICTED: uncharacterized protein LOC104708816  55.8    5e-07   Camelina sativa [gold-of-pleasure]
gb|KJB36601.1|  hypothetical protein B456_006G166600                  55.8    5e-07   Gossypium raimondii
emb|CDY10396.1|  BnaCnng02970D                                        55.5    6e-07   Brassica napus [oilseed rape]
ref|XP_002879098.1|  hypothetical protein ARALYDRAFT_481665           55.1    7e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_003575409.1|  PREDICTED: uncharacterized protein LOC100843189  55.1    7e-07   Brachypodium distachyon [annual false brome]
emb|CDX70321.1|  BnaA10g26700D                                        55.1    8e-07   
ref|XP_004493973.1|  PREDICTED: uncharacterized protein LOC101494881  53.9    2e-06   Cicer arietinum [garbanzo]
ref|XP_004246659.1|  PREDICTED: uncharacterized protein LOC101246954  53.9    2e-06   Solanum lycopersicum
ref|XP_003625632.1|  hypothetical protein MTR_7g101250                53.5    3e-06   Medicago truncatula
ref|XP_011468685.1|  PREDICTED: uncharacterized protein LOC101312271  53.1    3e-06   Fragaria vesca subsp. vesca
gb|EMT20885.1|  hypothetical protein F775_09195                       53.1    4e-06   
ref|XP_006647550.1|  PREDICTED: uncharacterized protein LOC102719835  52.8    6e-06   Oryza brachyantha
gb|AFK35468.1|  unknown                                               52.4    7e-06   Lotus japonicus
ref|XP_008442681.1|  PREDICTED: uncharacterized protein LOC103486480  52.4    7e-06   Cucumis melo [Oriental melon]
ref|NP_001144115.1|  uncharacterized protein LOC100276955             52.4    9e-06   
gb|KFK24774.1|  hypothetical protein AALP_AA8G023000                  51.6    1e-05   Arabis alpina [alpine rockcress]
ref|XP_011094663.1|  PREDICTED: uncharacterized protein LOC105174308  51.2    2e-05   Sesamum indicum [beniseed]
gb|ACU21467.1|  unknown                                               50.4    3e-05   Glycine max [soybeans]
ref|XP_010920416.1|  PREDICTED: uncharacterized protein LOC105044291  50.1    3e-05   Elaeis guineensis
ref|XP_004137823.1|  PREDICTED: uncharacterized protein LOC101217342  50.1    5e-05   Cucumis sativus [cucumbers]
ref|XP_003554378.1|  PREDICTED: uncharacterized protein LOC100808952  49.7    5e-05   Glycine max [soybeans]
ref|XP_006295161.1|  hypothetical protein CARUB_v10024237mg           49.7    6e-05   Capsella rubella
ref|XP_004249833.1|  PREDICTED: uncharacterized protein LOC101261979  49.7    6e-05   Solanum lycopersicum
ref|XP_004497503.1|  PREDICTED: uncharacterized protein LOC101503850  49.3    9e-05   Cicer arietinum [garbanzo]
ref|XP_007162749.1|  hypothetical protein PHAVU_001G177200g           49.3    1e-04   Phaseolus vulgaris [French bean]
ref|XP_010557316.1|  PREDICTED: uncharacterized protein LOC104826363  48.5    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_002454206.1|  hypothetical protein SORBIDRAFT_04g026640        47.8    4e-04   Sorghum bicolor [broomcorn]
ref|XP_008791539.1|  PREDICTED: uncharacterized protein LOC103708409  47.4    5e-04   Phoenix dactylifera
ref|XP_007132259.1|  hypothetical protein PHAVU_011G079500g           47.4    5e-04   Phaseolus vulgaris [French bean]
ref|XP_002519536.1|  conserved hypothetical protein                   47.4    5e-04   Ricinus communis
gb|EYU34447.1|  hypothetical protein MIMGU_mgv1a023553mg              46.6    6e-04   Erythranthe guttata [common monkey flower]
gb|KHN02339.1|  hypothetical protein glysoja_002363                   46.6    6e-04   Glycine soja [wild soybean]
gb|KHN09502.1|  hypothetical protein glysoja_016601                   47.0    7e-04   Glycine soja [wild soybean]



>ref|XP_009597452.1| PREDICTED: uncharacterized protein LOC104093419 [Nicotiana tomentosiformis]
Length=162

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 6/100 (6%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAA-HSASPERRKAIPSSRARK  337
            MAAS+SYF R NYRFLS DR+  +  D++FE +ES+VWN++  S+SPE RK  PSSR  +
Sbjct  1    MAASKSYFARANYRFLSNDRDISVTSDTMFELDESDVWNSSGRSSSPEFRK--PSSRISR  58

Query  338  PSAVSGTRVVGA---APGSLPVNVPDWSKILKDEYRENRR  448
              +VS +    +   A  SLPVNVPDWSKILKDEYRENRR
Sbjct  59   KQSVSKSDRTSSGVTAAASLPVNVPDWSKILKDEYRENRR  98



>ref|XP_009787318.1| PREDICTED: uncharacterized protein LOC104235292 [Nicotiana sylvestris]
Length=168

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGG-DSVFEFEESEVWNAAHSASPERRKAIPSSRARK  337
            MAASRSYF   NYRFLS++R+ P+   DS FEF+ES++WN+A S SPE RK++ SS+  +
Sbjct  1    MAASRSYFAGANYRFLSSERDVPMMSPDSAFEFDESDLWNSAVSQSPEFRKSVQSSKFSR  60

Query  338  PSAVSGTR---VVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
                + +R    V +   SLPVNVPDWSKILKDEYRE  RR
Sbjct  61   KQCDTKSRRSGSVASVAASLPVNVPDWSKILKDEYREYGRR  101



>ref|XP_004241275.1| PREDICTED: uncharacterized protein LOC101262623 [Solanum lycopersicum]
Length=163

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAH-SASPERRKAIPSSR-AR  334
            MAASRSYF   NYRFLST+ +  +  DSVFEF+ES+VWN++  S SPE RK  PSSR +R
Sbjct  1    MAASRSYFATANYRFLSTEPDVAMTPDSVFEFDESDVWNSSTVSRSPEFRKKSPSSRISR  60

Query  335  KPSAVSGTR-VVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            K       R   GA   SLPVNVPDWSKILKDEYRE  RR
Sbjct  61   KQCETKSYRKCSGATAASLPVNVPDWSKILKDEYREYGRR  100



>ref|XP_009593461.1| PREDICTED: uncharacterized protein LOC104090119 [Nicotiana tomentosiformis]
Length=167

 Score =   104 bits (259),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGG-DSVFEFEESEVWNAAHSASPERRKAIPSSRARK  337
            MAAS+SYF   NYRFLS++R+ P+   +S FEF+ES++WN+A S SPE RK++ SS+  +
Sbjct  1    MAASKSYFAGANYRFLSSERDVPMMSPESAFEFDESDLWNSAVSQSPEFRKSVQSSKISR  60

Query  338  PSAVSGTRVVG--AAPGSLPVNVPDWSKILKDEYRENRRR  451
                + +R  G  A+  SLPVNVPDWSKILKDEYRE  RR
Sbjct  61   KQCDTKSRRSGSVASAASLPVNVPDWSKILKDEYREYGRR  100



>ref|XP_009767681.1| PREDICTED: uncharacterized protein LOC104218792 [Nicotiana sylvestris]
Length=162

 Score =   104 bits (259),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 6/98 (6%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAA-HSASPERRKAIPSSRARK  337
            MAAS+SYF R NYRFLS DR+  +  D++FE +ES+VWN++  S+SPE RK  PSSR  +
Sbjct  1    MAASKSYFARANYRFLSNDRDISVTSDTMFELDESDVWNSSGRSSSPEFRK--PSSRISR  58

Query  338  PSAVSGTRVVGAA---PGSLPVNVPDWSKILKDEYREN  442
              +VS +    A      SLPVNVPDWSKILKDEYREN
Sbjct  59   KQSVSKSDRTCAGVTTAASLPVNVPDWSKILKDEYREN  96



>gb|KDP44049.1| hypothetical protein JCGZ_05516 [Jatropha curcas]
Length=177

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 72/105 (69%), Gaps = 11/105 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDR--EAPIGGDS-VFEFEESEVWN---AAHSASPERRKAIPS  322
            MA S+SYF R NYRFLS+D+   AP+  DS  FE +ES+V+N      S SPE RKA+ S
Sbjct  1    MATSKSYFARQNYRFLSSDQSLHAPLTHDSSAFELDESDVYNNSVTTRSNSPEFRKAMAS  60

Query  323  SR-ARKPSAVSGTR----VVGAAPGSLPVNVPDWSKILKDEYREN  442
            SR  +K +AV+ T       GA P SLPVN+PDWSKILKDEYREN
Sbjct  61   SRLGKKSTAVAATTRRSDQAGATPSSLPVNIPDWSKILKDEYREN  105



>ref|XP_002285165.1| PREDICTED: uncharacterized protein LOC100253658 [Vitis vinifera]
Length=167

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 72/95 (76%), Gaps = 5/95 (5%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAP-IGGDSVFEFEESEVWNAAHSASPERRKAIPSSR-AR  334
            MA+ +SY+ R NYRFLS DR+AP I  ++V E +ES++W+++HSASPE R  +PSSR A+
Sbjct  1    MASGKSYYARPNYRFLSGDRDAPAITSEAVIELDESDIWSSSHSASPEFRNPVPSSRLAK  60

Query  335  KPS--AVSGTRVVGAAPGSLPVNVPDWSKILKDEY  433
            KPS    SG R   A  GSLPVN+PDWSKIL+++Y
Sbjct  61   KPSKRGESGDRST-ATVGSLPVNIPDWSKILREDY  94



>ref|XP_010253678.1| PREDICTED: uncharacterized protein LOC104594856 [Nelumbo nucifera]
Length=168

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 70/105 (67%), Gaps = 11/105 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKP  340
            MAA +SY  R +YRF+  D++  I  D++FEF+E+++WN  H+ASPE +K I + RA K 
Sbjct  1    MAARKSYLARPSYRFIGGDKDKTISSDTMFEFDEADLWNLNHAASPELKKPITNVRAAKK  60

Query  341  SAVSGTRVVGAAPG--------SLPVNVPDWSKILKDEYRENRRR  451
               SG RV  A  G        SLPVN+PDWSKIL+++YR+ RRR
Sbjct  61   ---SGKRVENADRGGGATATSTSLPVNIPDWSKILREDYRDTRRR  102



>ref|XP_007206026.1| hypothetical protein PRUPE_ppa012473mg [Prunus persica]
 gb|EMJ07225.1| hypothetical protein PRUPE_ppa012473mg [Prunus persica]
Length=168

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 67/103 (65%), Gaps = 7/103 (7%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAP-IGGDSVFEFEESEVWNAAHSASPERRKAIPSSRA--  331
            MA S+SY+ R NYR+LS+D   P +  DS FE +ES+++N A S SPE RK +PSSR   
Sbjct  1    MATSKSYYARPNYRYLSSDHHHPTLAPDSAFELDESDIYNFARSNSPEFRKPVPSSRVVS  60

Query  332  ----RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
                R+  A   +   G    SLPV +PDWSKIL+DEYRENR+
Sbjct  61   ASKNRRSEAADRSDRTGGTAASLPVGIPDWSKILRDEYRENRK  103



>emb|CAN61164.1| hypothetical protein VITISV_001394 [Vitis vinifera]
Length=167

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 72/95 (76%), Gaps = 5/95 (5%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAP-IGGDSVFEFEESEVWNAAHSASPERRKAIPSSR-AR  334
            MA+ +SY+ R NYRFLS DR+AP I  ++V E +E+++W+++HSASPE R  +PSSR A+
Sbjct  1    MASGKSYYARPNYRFLSGDRDAPAITSEAVIELDETDIWSSSHSASPEFRNPVPSSRLAK  60

Query  335  KPS--AVSGTRVVGAAPGSLPVNVPDWSKILKDEY  433
            KPS    SG R   A  GSLPVN+PDWSKIL+++Y
Sbjct  61   KPSKRGESGDRST-ATVGSLPVNIPDWSKILREDY  94



>ref|XP_006365734.1| PREDICTED: uncharacterized protein LOC102600128 [Solanum tuberosum]
Length=171

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 68/108 (63%), Gaps = 11/108 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAH-SASPERRKAIPSSRA--  331
            MAASRSYF   NY FLST+ +  +  DSVFEF+ES+VWN++  S SPE RK  PSSR   
Sbjct  1    MAASRSYFATANYHFLSTEPDLAMTPDSVFEFDESDVWNSSTVSQSPEFRKKSPSSRISR  60

Query  332  --------RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
                    RK S  + T        SLPVNVPDWSKILKDEYRE  RR
Sbjct  61   KQRETKSYRKCSGATATATATTTAASLPVNVPDWSKILKDEYREYGRR  108



>ref|XP_006340195.1| PREDICTED: uncharacterized protein LOC102589274 [Solanum tuberosum]
Length=170

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 66/100 (66%), Gaps = 9/100 (9%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNA---AHSASPERRKAIP----  319
            MAAS+SYF R+NYRFLS+DR   +  D++FE +ES+VWN+   A S+SPE RK       
Sbjct  1    MAASKSYFARSNYRFLSSDRNVSVTSDTMFELDESDVWNSPATARSSSPEFRKTSTRISR  60

Query  320  -SSRARKPSAVSGTRV-VGAAPGSLPVNVPDWSKILKDEY  433
              S AR     +G  V   AA  S+PVNVPDWSKILKDEY
Sbjct  61   KQSIARSDRNSTGVTVKAAAAASSMPVNVPDWSKILKDEY  100



>gb|EYU18831.1| hypothetical protein MIMGU_mgv1a015289mg [Erythranthe guttata]
Length=162

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 76/103 (74%), Gaps = 13/103 (13%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSV-FEFEESEVWNAA-HSASPERRKAIPSSR-A  331
            MAAS+SYF R+NYRFL TDR   +  DSV FE +ES++WN+   S SP+ RKA  S+R A
Sbjct  1    MAASKSYFARSNYRFLPTDR--AVAADSVIFELDESDIWNSVPRSQSPDFRKA--SARIA  56

Query  332  RKPSAVSGT----RVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
            RKPS+ +      RV GA  GSLPVNVPDWSKILK+EYRENRR
Sbjct  57   RKPSSAAAAAASGRVDGA--GSLPVNVPDWSKILKEEYRENRR  97



>ref|XP_010264683.1| PREDICTED: uncharacterized protein LOC104602622 [Nelumbo nucifera]
Length=168

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 5/101 (5%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKP  340
            MA  +SY  R +YRFL  D +  IG D++FEF+E+++WN+   ASPE +K IP++R  K 
Sbjct  1    MATGKSYLARPSYRFLGVDGDNTIGSDTMFEFDEADLWNSNQDASPEFKKFIPNARVSKK  60

Query  341  SA---VSGTRVVGAAPG--SLPVNVPDWSKILKDEYRENRR  448
             A   V+  R  G      SLPVN+PDWSKIL+++YR +RR
Sbjct  61   LAKRVVNADRSDGGTTTAMSLPVNIPDWSKILREDYRASRR  101



>ref|XP_004291575.1| PREDICTED: uncharacterized protein LOC101299444 [Fragaria vesca 
subsp. vesca]
Length=171

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 66/104 (63%), Gaps = 8/104 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDRE-APIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARK  337
            MA S+SY+ R NYR+L TD     +GGDS FE +ES+++N A S+SPE RK   SSR   
Sbjct  1    MATSKSYYARPNYRYLPTDHHHQTLGGDSAFELDESDIYNFARSSSPEYRKPAMSSRGAS  60

Query  338  PSAVSGTR-------VVGAAPGSLPVNVPDWSKILKDEYRENRR  448
              + S +        + G    SLPV +PDWSKIL+DEYRENRR
Sbjct  61   KKSSSASSKRSDAGDLSGGTAASLPVGIPDWSKILRDEYRENRR  104



>ref|XP_008225670.1| PREDICTED: uncharacterized protein LOC103325290 [Prunus mume]
Length=166

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 7/103 (7%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAP-IGGDSVFEFEESEVWNAAHSASPERRKAIPSSRA--  331
            MA S+SY+ R NYR+LS+D   P +  DS FE +ES+++N A S SPE  K +PSSR   
Sbjct  1    MATSKSYYARPNYRYLSSDHHHPTLAPDSAFELDESDIYNFARSNSPEFCKPVPSSRVVS  60

Query  332  ----RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
                R+  A   +   G    SLPV +PDWSKIL+DEYREN++
Sbjct  61   ASKNRRSEAADRSDRTGGTAASLPVGIPDWSKILRDEYRENQK  103



>gb|ACJ83912.1| unknown [Medicago truncatula]
Length=158

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIG-GDSVFEFEESEVWNAAHSASPERRKAIPSSR-AR  334
            MA ++ YF R N+ FLS DR++ +   D++FEFEES+++N+ H+ S E RK+I  SR A+
Sbjct  1    MANNKGYFARRNHLFLSGDRDSSLTDSDTMFEFEESDIYNSNHANSIEFRKSIHGSRLAK  60

Query  335  KPSAVSGTRV-VGAAPGSLPVNVPDWSKILKDEYREN  442
            KPS+    ++  G AP S+PV +PDWSKIL DEY+ N
Sbjct  61   KPSSPKQKQMDAGVAPASMPVKIPDWSKILGDEYKNN  97



>ref|XP_003606376.1| hypothetical protein MTR_4g059320 [Medicago truncatula]
 gb|AES88573.1| senescence regulator [Medicago truncatula]
 gb|AFK35484.1| unknown [Medicago truncatula]
Length=158

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIG-GDSVFEFEESEVWNAAHSASPERRKAIPSSR-AR  334
            MA ++ YF R N+ FLS DR++ +   D++FEFEES+++N+ H+ S E RK+I  SR A+
Sbjct  1    MANNKGYFARRNHLFLSGDRDSSLTDSDTMFEFEESDIYNSNHANSIEFRKSIHGSRLAK  60

Query  335  KPSAVSGTRV-VGAAPGSLPVNVPDWSKILKDEYREN  442
            KPS+    ++  G AP S+PV +PDWSKIL DEY+ N
Sbjct  61   KPSSPKQKQMDAGVAPASMPVKIPDWSKILGDEYKNN  97



>ref|XP_010098187.1| hypothetical protein L484_007649 [Morus notabilis]
 gb|EXB74643.1| hypothetical protein L484_007649 [Morus notabilis]
Length=181

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 67/111 (60%), Gaps = 14/111 (13%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDRE------APIGGDSV-FEFEESEVWNAAHSASPERRKAIP  319
            MA S+SYF R NYRFL  DR+        +  DS  FE +ES+++N+A S SPE RK I 
Sbjct  1    MATSKSYFARPNYRFLPGDRDYHHHHHTAVAADSAAFELDESDIYNSARSNSPEFRKPIS  60

Query  320  SSRARKPSAVS-------GTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            SSR     A S          + GA   SLPVN+PDWSKIL+DEYR+NR R
Sbjct  61   SSRLISKKASSKRSSGDPAVDLTGATAASLPVNIPDWSKILRDEYRDNRTR  111



>ref|XP_011089909.1| PREDICTED: uncharacterized protein LOC105170719 [Sesamum indicum]
Length=149

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 68/103 (66%), Gaps = 18/103 (17%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSV-FEFEESEVWNA-AHSASPERRKAIPSSRA-  331
            MAA RSY  R+NYRFL  D    +  DS+ FE EES+VWN+ A S SPE RK+  SSR  
Sbjct  3    MAAPRSYLGRSNYRFLPIDH--GLSNDSIIFELEESDVWNSGALSPSPELRKS--SSRVY  58

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDCD  460
            RK SA            SLPVNVPDWSKILK+EYRE+RRRD D
Sbjct  59   RKRSA-----------ASLPVNVPDWSKILKEEYRESRRRDLD  90



>ref|XP_002864697.1| hypothetical protein ARALYDRAFT_496217 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40956.1| hypothetical protein ARALYDRAFT_496217 [Arabidopsis lyrata subsp. 
lyrata]
Length=158

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 66/102 (65%), Gaps = 7/102 (7%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPI-GGDSVFEFEESEVWNAAHSASPERRKAIPSS--RA  331
            MA  +SY+ R +YRFL TD+ +     DS  EF+ES+++N  HS SP+ R+ I SS    
Sbjct  1    MATGKSYYARPSYRFLGTDQPSYFTASDSGLEFDESDLYNPIHSDSPDFRRIISSSARSG  60

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDC  457
            +KPS     R    A  SLP+NVPDWSKIL++EYR+NRRR  
Sbjct  61   KKPS----NRPSAVAASSLPINVPDWSKILREEYRDNRRRSI  98



>ref|XP_004251136.1| PREDICTED: uncharacterized protein LOC101259309 [Solanum lycopersicum]
Length=173

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 63/103 (61%), Gaps = 12/103 (12%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNA---AHSASPERRKAIPSSRA  331
            MAAS+SYF R+NYRFLS+DR   +  D++FE +ES+VWN+   A S+SPE RK       
Sbjct  1    MAASKSYFARSNYRFLSSDRNVSVTSDTMFELDESDVWNSPATARSSSPEFRKTNTRISR  60

Query  332  RKPSAVSGTRVVGAA---------PGSLPVNVPDWSKILKDEY  433
            ++  A S     G             S+PVNVPDWSKILKDEY
Sbjct  61   KQSIAKSDRNSTGVTVKSAAAVAAASSMPVNVPDWSKILKDEY  103



>ref|XP_009126590.1| PREDICTED: uncharacterized protein LOC103851491 [Brassica rapa]
Length=166

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 68/100 (68%), Gaps = 4/100 (4%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAA---HSASPERRKAIPSSRA  331
            MA  +SY+ R +YRFL TD+      DS  EF+ES+++++A   HSASP R+K   S R+
Sbjct  1    MATGKSYYARPSYRFLGTDQSYFAATDSGLEFDESDLYSSAGSVHSASP-RKKISASVRS  59

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
             K  +   +   GAA  SLP+NVPDWSKIL++E+R+NRRR
Sbjct  60   GKKPSNRPSSCAGAAATSLPINVPDWSKILREEHRDNRRR  99



>ref|XP_007150200.1| hypothetical protein PHAVU_005G134900g [Phaseolus vulgaris]
 gb|ESW22194.1| hypothetical protein PHAVU_005G134900g [Phaseolus vulgaris]
Length=153

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 3/91 (3%)
 Frame = +2

Query  188  RNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKPSAVSGTRVV  367
            R +YRFL      P+  DS FEF+ES+++N+A++ SPE  K+I +SR    S+ +  RV 
Sbjct  7    RASYRFLPAVDRDPLS-DSAFEFDESDLYNSANANSPEFCKSIRTSRFHSNSSSTVGRV-  64

Query  368  GAAPGSLPVNVPDWSKILKDEYRENRRRDCD  460
             AA GSLPVNVPDWSKIL +EY +NRRR+CD
Sbjct  65   -AASGSLPVNVPDWSKILGNEYGQNRRRNCD  94



>ref|XP_008385317.1| PREDICTED: uncharacterized protein LOC103447887 [Malus domestica]
 ref|XP_008349750.1| PREDICTED: uncharacterized protein LOC103413031 [Malus domestica]
Length=169

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 64/105 (61%), Gaps = 11/105 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDRE---APIGGDSVFEFEESEVWNAAHSASPERRKAIPSSR-  328
            MA S+SY+ R NYR+LS D       +  D  FE +ES+++N   S SPE RK IPSSR 
Sbjct  1    MATSKSYYARPNYRYLSGDHHHHHQTLASD--FELDESDIYNFGRSNSPEYRKPIPSSRG  58

Query  329  ---ARKPSAVSGTR--VVGAAPGSLPVNVPDWSKILKDEYRENRR  448
               A+     SG R  + G    SLPV +PDWSKIL+ EYRENRR
Sbjct  59   VSAAKNRRGDSGHRSDMTGGKAASLPVGIPDWSKILRGEYRENRR  103



>ref|XP_011044356.1| PREDICTED: uncharacterized protein LOC105139576 [Populus euphratica]
Length=179

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 64/105 (61%), Gaps = 14/105 (13%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTD--REAPIGGDSVFEFEESEVW--NAAHSASPERRKAIPSSR  328
            MA S+  F R NYRFLSTD     P+  +S FE +ESE++    A S SPE RK + SSR
Sbjct  1    MATSKGCFARQNYRFLSTDLTHHVPVTHNSPFELDESEIYYHTTARSNSPEFRKPVMSSR  60

Query  329  ARK---PSAVS------GTRVVGAAPGSLPVNVPDWSKILKDEYR  436
              K   P+A +      G R  G  P SLPVN+PDWSKILKDEYR
Sbjct  61   LTKKSTPAAAACRRTDPGGRACGT-PSSLPVNIPDWSKILKDEYR  104



>ref|XP_006281214.1| hypothetical protein CARUB_v10027254mg [Capsella rubella]
 gb|EOA14112.1| hypothetical protein CARUB_v10027254mg [Capsella rubella]
Length=168

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 11/106 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPI-------GGDSVFEFEESEVWNAAHSASPERRKAI-  316
            MA  +SY+ R +YRFL TD+ +           DS  EF+ES+++N  HS SP+ R+ I 
Sbjct  1    MATGKSYYARPSYRFLGTDQPSSYFTTTTTTATDSGLEFDESDLYNPIHSDSPDFRRKIS  60

Query  317  -PSSRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
             PS   +KPS    + V  A+  SLPVNVPDWSKIL+ EYR+NRRR
Sbjct  61   TPSRSGKKPSTHRPSAVTTAS--SLPVNVPDWSKILRGEYRDNRRR  104



>ref|XP_010483718.1| PREDICTED: uncharacterized protein LOC104762175 [Camelina sativa]
Length=163

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (61%), Gaps = 20/110 (18%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDR------EAPIGGDSVFEFEESEVWNAAHSASPERRKAI--  316
            MA  +SY+ R +YRFL TD+            DS  EF+ES+++N  H+ SP+ R+ I  
Sbjct  1    MATGKSYYARPSYRFLGTDQPSSYFATTTTTNDSGLEFDESDLYNQIHTDSPDFRRKISA  60

Query  317  -PSSRARKP----SAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
             PS  A+KP    SAV+       A  SLPVNVPDWSKIL+ EYR+NRRR
Sbjct  61   TPSRSAKKPTNRPSAVT-------AASSLPVNVPDWSKILRGEYRDNRRR  103



>ref|XP_010456667.1| PREDICTED: transcription initiation factor TFIID subunit 11 [Camelina 
sativa]
Length=170

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 14/110 (13%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPI--------GGDSVFEFEESEVWNAAHSASPERRKAI  316
            MA  +SY+ R +YRFL TD+ +            DS  EF+ES+++N  H+ SP+ R+ I
Sbjct  1    MATGKSYYARPSYRFLGTDQPSSYFTTTTTTTTNDSGLEFDESDLYNQIHTDSPDFRRKI  60

Query  317  ---PSSRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDC  457
               PS  A+KP+  S    V AA  SLPVNVPDWSKIL+ EYR+NRRR  
Sbjct  61   SATPSRSAKKPTNRSS--AVTAA-SSLPVNVPDWSKILRGEYRDNRRRSI  107



>ref|XP_002314267.1| hypothetical protein POPTR_0009s01960g [Populus trichocarpa]
 gb|EEE88222.1| hypothetical protein POPTR_0009s01960g [Populus trichocarpa]
Length=182

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 14/105 (13%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTD--REAPIGGDSVFEFEESEVW--NAAHSASPERRKAIPSSR  328
            MA S+  F R NYRFLSTD     P+  +S FE +ES+++    A S SPE RK + SSR
Sbjct  1    MATSKGCFARQNYRFLSTDLTHHVPLTHNSPFELDESDIYYHTTARSNSPEFRKPVLSSR  60

Query  329  ARK---PSAVS------GTRVVGAAPGSLPVNVPDWSKILKDEYR  436
              K   P+A +      G R  G  P SLPVN+PDWSKILKDEYR
Sbjct  61   LAKKSTPAAAACRRTDPGGRACGT-PSSLPVNIPDWSKILKDEYR  104



>ref|XP_011089296.1| PREDICTED: uncharacterized protein LOC105170296 [Sesamum indicum]
Length=162

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 61/93 (66%), Gaps = 5/93 (5%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNA-AHSASPERRKAIPSSR-AR  334
            MAAS+SYF R NYRFL  D +A      +FE +ES+VWN+ A S SPE RK   SSR   
Sbjct  1    MAASKSYFARANYRFLPGD-QALTNDSMIFELDESDVWNSSARSQSPEMRKT--SSRITM  57

Query  335  KPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEY  433
            KPS  +  R     P SLPVNVPDWSKILK+EY
Sbjct  58   KPSPAAAARGGVGGPASLPVNVPDWSKILKEEY  90



>ref|XP_010443870.1| PREDICTED: transcription initiation factor TFIID subunit 11-like 
[Camelina sativa]
Length=168

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPI------GGDSVFEFEESEVWNAAHSASPERRKAI--  316
            MA  +SY+ R +YRFL TD+ +          DS  EF+ES+++   H+ SP+ R+ I  
Sbjct  1    MATGKSYYARPSYRFLGTDQPSSYFTTTTTTNDSGLEFDESDLYTPIHTDSPDFRRKISA  60

Query  317  -PSSRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDC  457
             PS  A+KP+  S    V AA  SLPVNVPDWSKIL+ EYR+NRRR  
Sbjct  61   TPSRSAKKPTNRSS--AVTAA-SSLPVNVPDWSKILRGEYRDNRRRSI  105



>ref|XP_003543482.1| PREDICTED: uncharacterized protein LOC100814909 [Glycine max]
Length=154

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  188  RNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKPSAVSGTRVV  367
            R  YRFL    +     DS FEF ES+++N+A + SPE  K++ SSR    S+ S  RV 
Sbjct  7    RATYRFLPA-MDTDSFSDSTFEFHESDLYNSARANSPELAKSVRSSRFHNYSSSSAARV-  64

Query  368  GAAPGSLPVNVPDWSKILKDEYRENRRRDCD  460
              AP SLPVNVPDWSKIL DEY  N+RR+ D
Sbjct  65   -GAPASLPVNVPDWSKILGDEYGRNQRRNYD  94



>ref|XP_011089908.1| PREDICTED: uncharacterized protein LOC105170718 [Sesamum indicum]
Length=151

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 66/102 (65%), Gaps = 12/102 (12%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSV-FEFEESEVWNA-AHSASPERRKAIPSSRAR  334
            MAA RSY  R+NYRFLS D    +  DS+ FE +ESEVWN+ A S SPE RK+  S R  
Sbjct  3    MAAPRSYLGRSNYRFLSIDH--GLSNDSIIFELDESEVWNSGALSPSPEIRKS--SCRIH  58

Query  335  KPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDCD  460
            +  + +      A   SLPVNVPDW KILK+EYRENR R+ D
Sbjct  59   RKRSAA------ARAASLPVNVPDWPKILKEEYRENRSREGD  94



>ref|XP_010535607.1| PREDICTED: uncharacterized protein LOC104810859 [Tarenaya hassleriana]
Length=163

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 8/101 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSA---SPE-RRKAIPSSR  328
            MA  +SY+ R +YRFL+TD+   +G DS FEFEES+++++A SA   SPE RRK   S R
Sbjct  1    MATGKSYYARPSYRFLATDQPYHVG-DSGFEFEESDLYSSAGSALSESPEIRRKLSTSGR  59

Query  329  -ARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
              +KPSA   +    A+  SLPVNVPDWSKIL++EYR+NRR
Sbjct  60   IGKKPSARPASAAGAAS--SLPVNVPDWSKILREEYRDNRR  98



>gb|KJB20287.1| hypothetical protein B456_003G141800 [Gossypium raimondii]
Length=173

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 12/107 (11%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDRE--APIGGDSV--FEFEESEVWN---AAHSASPERRKAIP  319
            MA+SR Y+ R NYRFLS++++  +P+  DS   FE +ES+++N   +  S SPE R    
Sbjct  1    MASSRGYYSRPNYRFLSSEQQLQSPLSHDSASAFELDESDIYNNGVSTRSDSPEFRST--  58

Query  320  SSRARKPS---AVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            S  A+K S      G  VVG AP SLPVN+PDWSKIL++EYR+NRRR
Sbjct  59   SRVAKKQSNKRGGGGNSVVGGAPASLPVNIPDWSKILREEYRDNRRR  105



>ref|XP_011040881.1| PREDICTED: uncharacterized protein LOC105137020 [Populus euphratica]
Length=183

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 61/104 (59%), Gaps = 12/104 (12%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTD--REAPIGGDSVFEFEESEVWN--AAHSASPERRKAIPSSR  328
            MA S SYF R  YRFLSTD    A +  DS FE +ES++++     S SP+ RK + S R
Sbjct  1    MATSNSYFARQKYRFLSTDLNHHAQLSHDSPFELDESDIYHHTTTLSISPDFRKPVLSPR  60

Query  329  ARKPS--AVSGTR------VVGAAPGSLPVNVPDWSKILKDEYR  436
              K S  A +  R        G  P SLPVN+PDWS+ILK+EYR
Sbjct  61   LVKKSTPAAAACRPTDSREKTGGKPSSLPVNIPDWSRILKNEYR  104



>ref|XP_008359263.1| PREDICTED: uncharacterized protein LOC103422971 [Malus domestica]
Length=165

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (62%), Gaps = 10/102 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRA---  331
            MA ++SY+ R NYR+L++D +      S FE +ES+++    S+SPE RK +P+SR    
Sbjct  1    MATTKSYYARPNYRYLTSDHQHQTLS-SDFELDESDIYK---SSSPEFRKPVPNSRGISS  56

Query  332  ---RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
               R+  A   +      P SLPV +PDWSKIL+DEYRE RR
Sbjct  57   SKNRRGDAGDRSDRTCGTPSSLPVGIPDWSKILRDEYREKRR  98



>ref|NP_200876.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09841.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL36227.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14170.1| unknown protein [Arabidopsis thaliana]
 gb|AED97366.1| uncharacterized protein AT5G60680 [Arabidopsis thaliana]
Length=163

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 3/100 (3%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPI-GGDSVFEFEESEVWNAAHSASPERRKAIPSS--RA  331
            MA  +SY+ R +YRFL TD+ +     DS  EF+ES+++N  HS SP+  + I SS    
Sbjct  1    MATGKSYYARPSYRFLGTDQPSYFTASDSGLEFDESDLFNPIHSDSPDFCRKISSSVRSG  60

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            +K S         AA  SLPVNVPDWSKIL+ EYR+NRRR
Sbjct  61   KKSSNRPSAASSAAAASSLPVNVPDWSKILRGEYRDNRRR  100



>ref|XP_006424568.1| hypothetical protein CICLE_v10029410mg [Citrus clementina]
 ref|XP_006488088.1| PREDICTED: uncharacterized protein LOC102625771 [Citrus sinensis]
 gb|ESR37808.1| hypothetical protein CICLE_v10029410mg [Citrus clementina]
Length=167

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 24/110 (22%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTD--REAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRAR  334
            MA  +SY+ R +YRFL +D  RE P      FE +ES+ +N+    S E         +R
Sbjct  1    MATGKSYYARPSYRFLQSDTPREVP---SPTFELDESDFYNSNSDNSAEF--------SR  49

Query  335  KP-SAVSGTRV----------VGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            KP + VSG+R+          +G  P S+PVN+PDWSKILKDEYR++RRR
Sbjct  50   KPGTTVSGSRLGKKQMKRADSIGGTPASVPVNIPDWSKILKDEYRDSRRR  99



>ref|XP_008462513.1| PREDICTED: uncharacterized protein LOC103500846 [Cucumis melo]
Length=167

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFL-STDREAPIGGDSVFEFEESEVWNAAHSA-SPERRKAIPSSRAR  334
            MA  +SYF R+ +RFL + D       D+ F+F+ES+++N+ HS  SPE R+    SR  
Sbjct  1    MATGKSYFSRSKFRFLPAGDGPDHCRSDAAFDFDESDLFNSPHSGTSPEFRRPASKSRIS  60

Query  335  K---PSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
            K   P  V    V   +  SLPVN+PDWSKIL++EY ENRR
Sbjct  61   KRISPVDVGDRSVTTVSAASLPVNIPDWSKILRNEYIENRR  101



>ref|XP_004139450.1| PREDICTED: uncharacterized protein LOC101217269 [Cucumis sativus]
 ref|XP_004160905.1| PREDICTED: uncharacterized LOC101217269 [Cucumis sativus]
 gb|KGN64850.1| hypothetical protein Csa_1G132110 [Cucumis sativus]
Length=167

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLS-TDREAPIGGDSVFEFEESEVWNAAHSA-SPERRKAIPSSRAR  334
            MA  +SYF R+ +RFLS  D       D+ F+F+ES+++N+ HS  SPE R+    SR  
Sbjct  1    MATGKSYFSRSKFRFLSPGDGPDHHRNDAAFDFDESDLFNSPHSGTSPEFRRPASKSRIS  60

Query  335  K---PSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
            K   P  V    V   +  SLPVN+PDWSKIL++EY +NRR
Sbjct  61   KRISPVDVGDRSVTTVSAASLPVNIPDWSKILRNEYIDNRR  101



>gb|KDO73285.1| hypothetical protein CISIN_1g031000mg [Citrus sinensis]
Length=167

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 24/110 (22%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTD--REAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRAR  334
            MA  +SY+ R +YRFL +D  RE P      FE +ES+ +N+    S E         +R
Sbjct  1    MATGKSYYARPSYRFLQSDTPREVP---SPPFELDESDFYNSNSDNSAEF--------SR  49

Query  335  KP-SAVSGTRV----------VGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            KP + VSG+R+          VG  P S+PVN+PDWSKILKDEYR++RRR
Sbjct  50   KPGTTVSGSRLGKKQTKRADSVGGTPASVPVNIPDWSKILKDEYRDSRRR  99



>gb|KJB83835.1| hypothetical protein B456_013G266800 [Gossypium raimondii]
Length=168

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 17/106 (16%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDRE--APIGGDSV-FEFEESEVWN---AAHSASPERRKAIPS  322
            MA++RSY+ R    FLS+D++  A +  DSV FE +ES+++N    A S SPE R    S
Sbjct  1    MASNRSYYSR----FLSSDQQLQAMLSRDSVGFELDESDIYNHTVTARSDSPEFR----S  52

Query  323  SR-ARKPSAV--SGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            SR  +KPS +   G   VG  P SLPVNVPDWSKIL++EYR NR R
Sbjct  53   SRVTKKPSTMRGGGESRVGGTPASLPVNVPDWSKILREEYRGNRIR  98



>emb|CBI32733.3| unnamed protein product [Vitis vinifera]
Length=176

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 63/105 (60%), Gaps = 7/105 (7%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAP----IGGDSVFEFEESEVWNAAHSASPE-RRKAIPSS  325
            MA  RSY  R +Y +L+ ++ +     I  D   EF+ESEVWN+    S +  +K IPSS
Sbjct  1    MATRRSYLTRPSYVYLAGEKSSSNNEEITDDIGLEFDESEVWNSGQVPSSDPFKKPIPSS  60

Query  326  RARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDCD  460
            RA K         V A   SLPVN+PDWSKIL+D+YR ++R++ D
Sbjct  61   RASKKPVSKKMGSVTAT--SLPVNIPDWSKILRDDYRLSQRKESD  103



>emb|CAN66257.1| hypothetical protein VITISV_001236 [Vitis vinifera]
Length=163

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 62/102 (61%), Gaps = 7/102 (7%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAP----IGGDSVFEFEESEVWNAAHSASPE-RRKAIPSS  325
            MA  RSY  R +Y +L+ ++ +     I  D   EF+ESEVWN+    SP+  +K IPSS
Sbjct  1    MATRRSYLTRPSYVYLAGEKSSSNNEEITDDIGLEFDESEVWNSGQVPSPDPFKKPIPSS  60

Query  326  RARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            RA K         V A   SLPVN+PDWSKIL+D+YR ++R+
Sbjct  61   RASKKPVSKKMGSVTAT--SLPVNIPDWSKILRDDYRLSQRK  100



>ref|XP_006384902.1| hypothetical protein POPTR_0004s22060g [Populus trichocarpa]
 gb|ERP62699.1| hypothetical protein POPTR_0004s22060g [Populus trichocarpa]
Length=151

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 57/102 (56%), Gaps = 12/102 (12%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTD--REAPIGGDSVFEFEESEVWN--AAHSASPERRKAIPSSR  328
            MA S SYF R  YRFLSTD    A +  DS FE +ES++++     S SP+ RK + S R
Sbjct  1    MATSNSYFARQKYRFLSTDLNHHAQLSHDSPFELDESDIYHHTTTLSISPDFRKPVLSPR  60

Query  329  ARKPSAVSGTRV--------VGAAPGSLPVNVPDWSKILKDE  430
              K S  +             G  P SLPVN+PDWS+ILK+E
Sbjct  61   LVKKSTSAAAACRPTDSREKTGGTPSSLPVNIPDWSRILKNE  102



>ref|XP_003540175.1| PREDICTED: uncharacterized protein LOC100817341 [Glycine max]
Length=149

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 6/92 (7%)
 Frame = +2

Query  188  RNNYRFL-STDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKPSAVSGTRV  364
            R  YRFL + D ++    DS FEF+ES+++N+A + SPE RK++ +SR    S+ SG RV
Sbjct  6    RATYRFLPAMDTDSF--SDSNFEFQESDLYNSARANSPEFRKSVRASRFHNYSS-SGGRV  62

Query  365  VGAAPGSLPVNVPDWSKILKDEYRENRRRDCD  460
                P SLPVNVPDWSKIL DE+  N+RR+ D
Sbjct  63   --GTPVSLPVNVPDWSKILGDEFGRNQRRNYD  92



>ref|XP_008243937.1| PREDICTED: uncharacterized protein LOC103342133 [Prunus mume]
Length=169

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 64/109 (59%), Gaps = 15/109 (14%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKP  340
            MA+ ++ FP       S+  + PIG D +FEF+E+++W++++  + +++ AIPS R  K 
Sbjct  1    MASRKTIFP------TSSIGDNPIGSDGLFEFDEADIWSSSNPVAEQKKSAIPSYRELKK  54

Query  341  SAVSGTRVVGAA---------PGSLPVNVPDWSKILKDEYRENRRRDCD  460
                 T ++  A           SLPVN+PDWS ILK+ Y++ R+RD D
Sbjct  55   MGRKTTMLMSMADQKNSAEVTSASLPVNIPDWSNILKEAYKDQRQRDSD  103



>ref|XP_007207567.1| hypothetical protein PRUPE_ppa016754mg [Prunus persica]
 gb|EMJ08766.1| hypothetical protein PRUPE_ppa016754mg [Prunus persica]
Length=169

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 64/109 (59%), Gaps = 15/109 (14%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKP  340
            MA+ ++ FP       S+  + PIG D +FEF+E+++W++++  + +++ AIPS R  K 
Sbjct  1    MASRKAIFP------TSSIGDNPIGSDGLFEFDEADIWSSSNPVAEQKKNAIPSYRELKK  54

Query  341  SAVSGTRVVGAA---------PGSLPVNVPDWSKILKDEYRENRRRDCD  460
                 T ++  A           SLPVN+PDWS ILK+ Y++ R+RD D
Sbjct  55   MGRKTTMLMSMADQKNSAKVTSASLPVNIPDWSNILKEAYKDQRQRDSD  103



>gb|AAM62875.1| unknown [Arabidopsis thaliana]
Length=163

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 62/100 (62%), Gaps = 3/100 (3%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPI-GGDSVFEFEESEVWNAAHSASPERRKAIPSS--RA  331
            MA  +SY+ R +YRFL TD+ +     DS  EF+ES+++N  HS SP+  + I SS    
Sbjct  1    MATGKSYYARPSYRFLGTDQPSYFTASDSGLEFDESDLFNPIHSDSPDFCRKISSSVRSG  60

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            +K S         AA  SLPVNVPDWSK L+ EYR+NRRR
Sbjct  61   KKSSNRPSAASSAAAASSLPVNVPDWSKXLRGEYRDNRRR  100



>gb|EPS60592.1| hypothetical protein M569_14211 [Genlisea aurea]
Length=162

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 63/102 (62%), Gaps = 9/102 (9%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDS-VFEFEESEVWNAA-HSASPERRKAIPSSRAR  334
            MAA RS F  +N RFL  D    +  DS +FE +ES+VW+++  S SPE  K   S   R
Sbjct  1    MAAPRSCFYGSNRRFLPID--PGVAADSMIFELDESDVWSSSLRSMSPE--KTTRSRICR  56

Query  335  KPSAVS---GTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            KPS+ S      V    P SLP+NVPDWSKILKDEYRENR R
Sbjct  57   KPSSSSSSSAATVGKGRPASLPMNVPDWSKILKDEYRENRHR  98



>ref|XP_006400822.1| hypothetical protein EUTSA_v10015882mg [Eutrema salsugineum]
 gb|ESQ42275.1| hypothetical protein EUTSA_v10015882mg [Eutrema salsugineum]
Length=168

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVW---NAAHSASPE-RRKAIPSSR  328
            MA  +SY+ R +YRFL T++      DS  EF+ES+++    + HS SP+ RRK   S R
Sbjct  1    MATGKSYYARPSYRFLDTNQSYFAATDSGLEFDESDLYASSGSVHSDSPDFRRKISASGR  60

Query  329  ARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            + K  +   +     A  SLP+NVPDWSKIL++E+R+NRRR
Sbjct  61   SAKKPSNRPSASSTVAASSLPINVPDWSKILREEHRDNRRR  101



>gb|EYU36187.1| hypothetical protein MIMGU_mgv1a015493mg [Erythranthe guttata]
Length=156

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 13/91 (14%)
 Frame = +2

Query  167  ASRSYFPRNNYRFLSTDREAPIGGDS-VFEFEESEVWNAA--HSASPERRKAIPSSR-AR  334
             ++SYF R+NYRFL  D+   +  DS +FE +ES+VW++A   S SPE RK  PSSR +R
Sbjct  1    MAQSYFARSNYRFLQGDQ--ILNKDSMIFELDESDVWDSAAVRSQSPEMRK--PSSRISR  56

Query  335  KPSAVSGTRVVGAA-PGSLPVNVPDWSKILK  424
            KPS    +R VG   P SLPVNVPDWSKILK
Sbjct  57   KPS----SRGVGMDRPASLPVNVPDWSKILK  83



>gb|KFK33927.1| hypothetical protein AALP_AA5G079000 [Arabis alpina]
Length=152

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 60/97 (62%), Gaps = 6/97 (6%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKP  340
            MA +++Y  R ++RFL TDR   I  DS +EF+ES+++    S SP+ R+ + +    K 
Sbjct  1    MATAKTYHSRQSHRFLPTDRSYHIATDSGYEFDESDLY----SDSPDFRRKLRN--GIKQ  54

Query  341  SAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            S  S         GSLP+NVPDWSKIL++E R +RRR
Sbjct  55   SVRSSPVTTKKTIGSLPMNVPDWSKILREENRHSRRR  91



>ref|XP_009120602.1| PREDICTED: uncharacterized protein LOC103845482 [Brassica rapa]
Length=160

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 63/99 (64%), Gaps = 2/99 (2%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKP  340
            MA  +SY+ R ++RFL TD+      DS FEF+ES++++A+ S    R+ + P    +K 
Sbjct  1    MATGKSYYARPSHRFLGTDQPYYAATDSGFEFDESDLYSASDSPDFRRKISKPVRSVKKS  60

Query  341  SAVSGT--RVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            S    T      AA  SLPVNVPDWSKIL++E+R+NRRR
Sbjct  61   SNRPSTCGASSAAAASSLPVNVPDWSKILREEHRDNRRR  99



>emb|CDY65979.1| BnaCnng49210D [Brassica napus]
Length=159

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 7/101 (7%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAI--PSSRAR  334
            MA  +SY+ R +YRFL TD+      DS FEF+ES++++   S SP+ R+ I  P    +
Sbjct  1    MATGKSYYARPSYRFLGTDQSYYAANDSGFEFDESDLYS---SDSPDFRRKISKPVRSVK  57

Query  335  KPSAVSGT--RVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            K S    T      AA  SLPVNVPDWSKIL++E+R+NRRR
Sbjct  58   KSSNRPSTCGASSAAAASSLPVNVPDWSKILREEHRDNRRR  98



>ref|XP_002281329.1| PREDICTED: uncharacterized protein LOC100258555 [Vitis vinifera]
Length=163

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 61/102 (60%), Gaps = 7/102 (7%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAP----IGGDSVFEFEESEVWNAAHSASPE-RRKAIPSS  325
            MA  RSY  R +Y +L+ ++ +     I  D   EF+ESEVWN+    S +  +K IPSS
Sbjct  1    MATRRSYLTRPSYVYLAGEKSSSNNEEITDDIGLEFDESEVWNSGQVPSSDPFKKPIPSS  60

Query  326  RARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            RA K         V A   SLPVN+PDWSKIL+D+YR ++R+
Sbjct  61   RASKKPVSKKMGSVTAT--SLPVNIPDWSKILRDDYRLSQRK  100



>ref|XP_008463944.1| PREDICTED: uncharacterized protein LOC103501949 [Cucumis melo]
Length=162

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 56/102 (55%), Gaps = 15/102 (15%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTD-----REAPIGGDSVFEFEESEVWNAAHSASPER--RKAIP  319
            MA  +S + R+NYRFL+ D            D  FE  ES+++N+  + SP R  +K I 
Sbjct  1    MATGKSCYGRSNYRFLTGDISGHHHHHSFTSDFSFELNESDIYNSGTARSPTRIPKKKIS  60

Query  320  SSRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENR  445
            S R      V G    G    SLPVN+PDWSKILK+EYRE R
Sbjct  61   SKRVE----VQG----GGGASSLPVNIPDWSKILKEEYREKR  94



>ref|XP_003597242.1| hypothetical protein MTR_2g094410 [Medicago truncatula]
 gb|AES67493.1| senescence regulator [Medicago truncatula]
Length=156

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 64/102 (63%), Gaps = 9/102 (9%)
 Frame = +2

Query  161  MAASRS----YFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSR  328
            MAA+ +    +  +  Y FL +     +  DS+FEF+ESE++N  +S SPE RK+I +SR
Sbjct  1    MAATTTTKNHHVRKQTYHFLPSTNNNSVT-DSLFEFDESELYNT-NSNSPEFRKSIRASR  58

Query  329  ARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRD  454
             +  S+ S T        SLPVNVPDWSKIL ++YR NRRR+
Sbjct  59   FQGTSSSSTT---DGRVSSLPVNVPDWSKILGEDYRHNRRRN  97



>gb|AFK43089.1| unknown [Medicago truncatula]
Length=156

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 64/102 (63%), Gaps = 9/102 (9%)
 Frame = +2

Query  161  MAASRS----YFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSR  328
            MAA+ +    +  +  Y FL +     +  DS+FEF+ESE++N  +S SPE RK+I +SR
Sbjct  1    MAATTTTKNHHVRKQTYHFLPSTNNNSVT-DSLFEFDESELYNT-NSNSPEFRKSIRASR  58

Query  329  ARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRD  454
             +  S+ S T        SLPVNVPDWSKIL ++YR NRRR+
Sbjct  59   FQGTSSSSTT---DGRVSSLPVNVPDWSKILGEDYRHNRRRN  97



>ref|XP_009367072.1| PREDICTED: uncharacterized protein LOC103956768 [Pyrus x bretschneideri]
Length=166

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 60/103 (58%), Gaps = 10/103 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRA---  331
            MA ++S + R NYR+L++D +      S FE +ES+++N   S+SPE  K +P+SR    
Sbjct  1    MATTKSCYARPNYRYLTSDHQHQTLS-SDFELDESDIYNFGRSSSPEFHKPVPNSRGVSA  59

Query  332  ----RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
                R        R  G  P SLP  +PDWSKIL+DEYRE RR
Sbjct  60   SKNRRGDYGDRSDRTCGT-PSSLP-GIPDWSKILRDEYREKRR  100



>ref|XP_010107536.1| hypothetical protein L484_024389 [Morus notabilis]
 gb|EXC16218.1| hypothetical protein L484_024389 [Morus notabilis]
Length=165

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 63/104 (61%), Gaps = 10/104 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVW-----NAAHSASPERRKAIPSS  325
            MA+ +SY  + NY + ++     +  D++FEF+ESE+W     N    +S E +K IP++
Sbjct  1    MASRKSYHAKPNYIYQASSDS--MASDALFEFDESEIWSNTSSNQVAPSSLEAKKWIPAA  58

Query  326  RARKPSAVSGTRVVGAAP---GSLPVNVPDWSKILKDEYRENRR  448
            R  K   +       AAP    SLPVN+PDWSKILKD+Y+++R+
Sbjct  59   REPKKLGMMRKISTAAAPMASASLPVNIPDWSKILKDDYKDHRK  102



>ref|XP_007016742.1| Uncharacterized protein TCM_042056 [Theobroma cacao]
 gb|EOY34361.1| Uncharacterized protein TCM_042056 [Theobroma cacao]
Length=179

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 69/114 (61%), Gaps = 20/114 (18%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDRE--APIGGDSV--FEFEESEVWN---AAHSASPERRKAIP  319
            MA+S+SY+ R N RFLS D++  A    DS   FEFEES++++   +  S SPE R    
Sbjct  1    MASSKSYYSRPNCRFLSGDQQLQATRRHDSAAAFEFEESDIYSNSASTRSDSPELR---T  57

Query  320  SSRARKPSAV----------SGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
            SSR  K ++            G   VG  P SLPVN+PDWSKIL++EYR+NRRR
Sbjct  58   SSRVAKKTSTKRGGGGGGVVGGDSGVGGTPSSLPVNIPDWSKILREEYRDNRRR  111



>ref|XP_010520370.1| PREDICTED: uncharacterized protein LOC104799504 [Tarenaya hassleriana]
Length=160

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 61/100 (61%), Gaps = 7/100 (7%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAH--SASPE-RRKAIPSSRA  331
            MA  +SY+ R +YRFL+TD+      DS FEFEES+++ A    S SPE RRK   S + 
Sbjct  1    MATGKSYYARPSYRFLATDQPYH-AADSGFEFEESDLYFAGSDLSDSPELRRKLYTSGKI  59

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRR  451
                + S    V  +  SLPVNVPDWSKIL++   +NRRR
Sbjct  60   PSTRSSSAAVTVTGSASSLPVNVPDWSKILRE---DNRRR  96



>gb|KJB21560.1| hypothetical protein B456_004G001300 [Gossypium raimondii]
Length=168

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 64/102 (63%), Gaps = 10/102 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDRE--APIGGDSV-FEFEESEVWNAAHSASPERRKAIPSSRA  331
            MA S++ + R NYRFLS+D++  A +  DS  FE +ES++++ + S+        P  R 
Sbjct  1    MACSKTDYSRPNYRFLSSDQQLQATLNHDSAAFELDESDLYSNSVSSC----SGSPEFRD  56

Query  332  RKPSAVSGTRV---VGAAPGSLPVNVPDWSKILKDEYRENRR  448
               S ++ T+    VG  P SLPVN+PDWSKIL++EYR NRR
Sbjct  57   SGVSKMTSTKRRGRVGGTPASLPVNIPDWSKILREEYRNNRR  98



>ref|XP_010425944.1| PREDICTED: uncharacterized protein LOC104710977 isoform X3 [Camelina 
sativa]
Length=146

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 12/106 (11%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARK-  337
            MA  +SY+ R ++RFL TDR +    DS FEF+ES+++ +  S SP+ R+ + SS  R+ 
Sbjct  1    MATRKSYYQRPSHRFLPTDRSS--HNDSEFEFDESDLY-STRSDSPDFRRKLFSSLNRRS  57

Query  338  ---PSAVSGTRVVGAAPGSLPVNVPDWSKILKDE--YRENRRRDCD  460
               P+ V  T VV +   SLPVNVPDWSKIL  E   R  RRR  +
Sbjct  58   SPSPATVKTTMVVAS---SLPVNVPDWSKILGKENHNRHVRRRSIE  100



>ref|XP_010425942.1| PREDICTED: uncharacterized protein LOC104710977 isoform X1 [Camelina 
sativa]
Length=155

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 12/106 (11%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARK-  337
            MA  +SY+ R ++RFL TDR +    DS FEF+ES+++ +  S SP+ R+ + SS  R+ 
Sbjct  1    MATRKSYYQRPSHRFLPTDRSS--HNDSEFEFDESDLY-STRSDSPDFRRKLFSSLNRRS  57

Query  338  ---PSAVSGTRVVGAAPGSLPVNVPDWSKILKDE--YRENRRRDCD  460
               P+ V  T VV +   SLPVNVPDWSKIL  E   R  RRR  +
Sbjct  58   SPSPATVKTTMVVAS---SLPVNVPDWSKILGKENHNRHVRRRSIE  100



>ref|XP_010425943.1| PREDICTED: uncharacterized protein LOC104710977 isoform X2 [Camelina 
sativa]
Length=147

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 12/106 (11%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARK-  337
            MA  +SY+ R ++RFL TDR +    DS FEF+ES+++ +  S SP+ R+ + SS  R+ 
Sbjct  1    MATRKSYYQRPSHRFLPTDRSS--HNDSEFEFDESDLY-STRSDSPDFRRKLFSSLNRRS  57

Query  338  ---PSAVSGTRVVGAAPGSLPVNVPDWSKILKDE--YRENRRRDCD  460
               P+ V  T VV +   SLPVNVPDWSKIL  E   R  RRR  +
Sbjct  58   SPSPATVKTTMVVAS---SLPVNVPDWSKILGKENHNRHVRRRSIE  100



>ref|XP_010031997.1| PREDICTED: uncharacterized protein LOC104421661 [Eucalyptus grandis]
Length=185

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 64/108 (59%), Gaps = 9/108 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIG---GDSVFEFEESEV-WNAAHSASPE-RRKAIPSS  325
            MA +R+Y  R +YRFL  D  A +      S FE +ES++ +N+  S SP+ R ++ P+S
Sbjct  1    MATARNYIFRPSYRFLDADLAASMSRGPSPSSFELDESDLFYNSPRSRSPDPRDRSAPTS  60

Query  326  RARKP----SAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDC  457
              R P    +A         A  SLPVNVPDWSKIL +EYREN+RRD 
Sbjct  61   TTRIPKKPAAARRPGGAGAGAASSLPVNVPDWSKILPEEYRENQRRDS  108



>gb|KCW51389.1| hypothetical protein EUGRSUZ_J00928, partial [Eucalyptus grandis]
Length=213

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 64/107 (60%), Gaps = 9/107 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIG---GDSVFEFEESEV-WNAAHSASPE-RRKAIPSS  325
            MA +R+Y  R +YRFL  D  A +      S FE +ES++ +N+  S SP+ R ++ P+S
Sbjct  42   MATARNYIFRPSYRFLDADLAASMSRGPSPSSFELDESDLFYNSPRSRSPDPRDRSAPTS  101

Query  326  RARKP----SAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRD  454
              R P    +A         A  SLPVNVPDWSKIL +EYREN+RRD
Sbjct  102  TTRIPKKPAAARRPGGAGAGAASSLPVNVPDWSKILPEEYRENQRRD  148



>emb|CAN74756.1| hypothetical protein VITISV_021482 [Vitis vinifera]
Length=281

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = +2

Query  203  FLSTDREAP-IGGDSVFEFEESEVWNAAHSASPERRKAIPSSR-ARKPS--AVSGTRVVG  370
             L  +R+AP I  + V E +E ++W+++HSA P+ RK + SSR A+KPS    SG R   
Sbjct  18   LLLANRDAPVIASEVVIEVDEFDIWSSSHSALPKFRKPVSSSRLAKKPSKRGESGDRRT-  76

Query  371  AAPGSLPVNVPDWSKILKDEYRENRRRD  454
                SLPVN+PDWSKIL+++YR+  R++
Sbjct  77   VMVSSLPVNIPDWSKILREDYRDKNRKE  104



>ref|XP_009796302.1| PREDICTED: uncharacterized protein LOC104242882 [Nicotiana sylvestris]
Length=158

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = +2

Query  188  RNNYRFLS-TDREAPI---GGDSVFEFEESEVWNAAHSASPER-RKAIPSSRARKPSAV-  349
            R +Y FL   +R +P+        FEF+ES++WN  +S+     +K+IP+SR  K SA  
Sbjct  4    RKSYLFLGGKERVSPMPSSASSLQFEFDESDIWNNTNSSDEVLPQKSIPNSRFLKKSAKK  63

Query  350  SGTRVVGAAPGSLPVNVPDWSKILKDEYREN  442
            SG R + AA  SLPVN+PDWSKIL ++Y+ N
Sbjct  64   SGGRAISAAATSLPVNIPDWSKILGNDYKNN  94



>ref|XP_010274752.1| PREDICTED: uncharacterized protein LOC104609997 [Nelumbo nucifera]
Length=87

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 51/90 (57%), Gaps = 11/90 (12%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKP  340
            MAA +SY  R NYRF+  D++  I  D++FEF E+ +WN  H+A PE +K + +  A K 
Sbjct  1    MAARKSYLARPNYRFIGGDKDKTISSDTMFEFNEANLWNLNHAALPELKKPMNNVCATKK  60

Query  341  SAVSGTRVVGAAPG--------SLPVNVPD  406
               SG RV  A  G        SL VN+PD
Sbjct  61   ---SGKRVENADWGGGATAILTSLLVNMPD  87



>ref|XP_002877392.1| hypothetical protein ARALYDRAFT_484911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53651.1| hypothetical protein ARALYDRAFT_484911 [Arabidopsis lyrata subsp. 
lyrata]
Length=148

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 57/95 (60%), Gaps = 4/95 (4%)
 Frame = +2

Query  158  AMAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARK  337
            A    +SY+ R + RFL TDR   I GDS FEF+ES++++    +   RRK I S+R   
Sbjct  2    ATTTRKSYYQRPSQRFLPTDRTYHITGDSEFEFDESDLYSTRSDSPDFRRKLITSNRRSS  61

Query  338  PSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYREN  442
            P+ V+ T        SLP+NVPDWSKIL  E R++
Sbjct  62   PATVTTT----TVASSLPMNVPDWSKILGKENRKS  92



>ref|NP_180407.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD20686.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL49884.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67487.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08116.1| uncharacterized protein AT2G28400 [Arabidopsis thaliana]
Length=162

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 52/99 (53%), Gaps = 5/99 (5%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRK---AIPSSRA  331
            MA S+ Y+PR ++RF +TD+      D  FE +E +++N    +S         I S R 
Sbjct  1    MATSKCYYPRPSHRFFTTDQHVTATSD--FELDEWDLFNTGSDSSSSFSFSDLTITSGRT  58

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
                 + G    G A  SLPVNVPDWSKIL DE R  R+
Sbjct  59   GTNRQIHGGSDSGKAASSLPVNVPDWSKILGDESRRQRK  97



>ref|NP_190107.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL06540.1|AF412087_1 AT3g45210/T14D3_150 [Arabidopsis thaliana]
 emb|CAB72159.1| putative protein [Arabidopsis thaliana]
 gb|AAM16233.1| AT3g45210/T14D3_150 [Arabidopsis thaliana]
 gb|AEE78004.1| uncharacterized protein AT3G45210 [Arabidopsis thaliana]
Length=148

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 63/102 (62%), Gaps = 6/102 (6%)
 Frame = +2

Query  158  AMAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPE-RRKAIPSSRAR  334
            A A  +SY+ R ++RFL TDR   + GDS FEF+ES+++ +  S SPE RRK I S+R  
Sbjct  2    ATATRKSYYQRPSHRFLPTDRTYNVTGDSEFEFDESDLY-SNRSDSPEFRRKLITSNRKS  60

Query  335  KPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDCD  460
             P+ V+ T        SLP+NV +WSKIL  E R++   D D
Sbjct  61   SPATVTTT----TVASSLPMNVQNWSKILGKENRKSIENDDD  98



>ref|XP_004487109.1| PREDICTED: uncharacterized protein LOC101512341 [Cicer arietinum]
Length=166

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 62/92 (67%), Gaps = 8/92 (9%)
 Frame = +2

Query  188  RNNYRFL-STDREAPIGGDSVFEFEESEVWNAAHSAS----PERRKAIPSSRARKPSAVS  352
            +  YRFL STDR++    +S+FEF+ESE++N+  S S    PE R ++ +SR +  S+ S
Sbjct  17   KQTYRFLPSTDRDSV--SESLFEFDESELYNSTRSNSNSNSPEFRNSVRASRFQPNSSSS  74

Query  353  GTRVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
                VG  P SLPVNVPDWSKIL +EYR+N R
Sbjct  75   AVGRVGD-PSSLPVNVPDWSKILGEEYRQNLR  105



>ref|XP_010261646.1| PREDICTED: uncharacterized protein LOC104600417 [Nelumbo nucifera]
Length=186

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 11/85 (13%)
 Frame = +2

Query  230  IGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKPSAVSGTRVVGAAPG--------S  385
            I  D++FEF++S++WN  H+  PE +K + + R  K     G RV  A  G        S
Sbjct  2    ISSDTMFEFDKSDLWNLNHATLPELKKPMTNVRVAKKF---GKRVENAHWGGGAIATSTS  58

Query  386  LPVNVPDWSKILKDEYRENRRRDCD  460
            L VN+PDWS ILK++Y++ RRR+ D
Sbjct  59   LSVNIPDWSNILKEDYKDARRREND  83



>ref|XP_008391399.1| PREDICTED: uncharacterized protein LOC103453622 [Malus domestica]
 ref|XP_008344939.1| PREDICTED: uncharacterized protein LOC103407844 [Malus domestica]
Length=178

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 65/115 (57%), Gaps = 17/115 (15%)
 Frame = +2

Query  161  MAASRSYF---PRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRA  331
            MA+ +S F   P + +   S D  A +G D +FEF+E+++ NA+ S   E +K+   S +
Sbjct  1    MASRKSAFYGKPSSIFPASSMDDSA-VGSDGLFEFDEADICNASSSTVTESKKSTILSHS  59

Query  332  RKPSAVSGTRVV--------GAA----PGSLPVNVPDWSKILKDEYRENRRRDCD  460
             +P  +    +V        GAA    P SLPVN+PDWSKILKD Y+E R+ D D
Sbjct  60   -EPKKMGRRMMVKNMSMAEKGAADKVMPSSLPVNIPDWSKILKDGYKEQRKLDSD  113



>ref|XP_009122724.1| PREDICTED: uncharacterized protein LOC103847398 [Brassica rapa]
Length=206

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 63/113 (56%), Gaps = 8/113 (7%)
 Frame = +2

Query  128  VYKNRLACDSAMAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASP---  298
            + K R+A  S+MA+ + +F +  + +   +        +VFEFEES++ N      P   
Sbjct  20   ITKPRIALFSSMASMKHFFAKPKHTYPQPEPVMSENDKNVFEFEESDIHNLGDHQKPSSF  79

Query  299  ERRKAIPSSRAR-KPSAVSGTRVV----GAAPGSLPVNVPDWSKILKDEYREN  442
            E +++I  SR R KP+ V+ +        A  GS+PVN+PDWSKILK EYR +
Sbjct  80   EAKRSISISRLRRKPAKVADSSGFDNRKTAKTGSVPVNIPDWSKILKSEYRSH  132



>ref|XP_010689547.1| PREDICTED: uncharacterized protein LOC104903237 [Beta vulgaris 
subsp. vulgaris]
Length=163

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 56/98 (57%), Gaps = 6/98 (6%)
 Frame = +2

Query  146  ACDSAMAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAA-HSASPERRKAIPS  322
               S M A R+    +NYRFL++D   P       EF+ES++W  +  S SPE R    S
Sbjct  4    TTKSYMMARRA----SNYRFLTSDPIQPPKSTPELEFDESDIWGGSTRSDSPETRSWRQS  59

Query  323  SRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYR  436
            +R R  +A +  R  G    SLPVN+PDWSKIL+DEY+
Sbjct  60   TR-RAIAAPTPVRRRGDTAASLPVNIPDWSKILRDEYK  96



>emb|CDX80857.1| BnaC03g01110D [Brassica napus]
Length=179

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 60/102 (59%), Gaps = 8/102 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSSRA  331
            MA+ + +F + NY +   + E     ++VFEF+ES++ N      P   E +++I  SR 
Sbjct  1    MASRKHFFGKPNYIYPQPEPEMSENDENVFEFDESDIHNLGDHRLPSSFEAKRSISISRL  60

Query  332  R-KPSAV--SGTRVVGAAP--GSLPVNVPDWSKILKDEYREN  442
            R KP+ V  S   V   AP  GSLPVN+PDWSKILK EYR +
Sbjct  61   RRKPAKVGDSSVSVNRKAPKTGSLPVNIPDWSKILKSEYRSH  102



>gb|KFK27594.1| hypothetical protein AALP_AA8G404000 [Arabis alpina]
Length=165

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (59%), Gaps = 11/109 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGG-DSVFEFEESEVWNAA----HSASPERRKAIPSS  325
            MA  +SY+ R +YRFL TD+ +     +S  EF+ES+++ ++    HS SPE R+   S+
Sbjct  1    MATEKSYYARPSYRFLGTDQSSYFTATESGLEFDESDLYASSGVSIHSDSPEFRRK--ST  58

Query  326  RARKPSA----VSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDCD  460
            R+ K S+             A  SLP+NVPDWSKIL  E+R +RRR  +
Sbjct  59   RSGKKSSNRPSSCAVASSAVAASSLPINVPDWSKILGQEHRNSRRRSIE  107



>ref|XP_007145215.1| hypothetical protein PHAVU_007G220200g [Phaseolus vulgaris]
 gb|ESW17209.1| hypothetical protein PHAVU_007G220200g [Phaseolus vulgaris]
Length=180

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 63/108 (58%), Gaps = 12/108 (11%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGG--DSVFEFEESEVWNAAHSASPERRKAIPSSRAR  334
            MA+ +S+  + +     T  +  +G   + +FEF+E+E+WN   SA+   +K +PSS +R
Sbjct  1    MASRKSFLSKTSRYIFPTTSDTHLGQTQEGMFEFDEAELWNHHSSAADHSKKGLPSSGSR  60

Query  335  ----KPSAVSGTRVVGA------APGSLPVNVPDWSKILKDEYRENRR  448
                + S  +  +V G       +  SLPVN+PDWSKILK++Y+++ R
Sbjct  61   SVPKRASRNNSNKVDGGGRDRVPSASSLPVNIPDWSKILKEDYKDHPR  108



>ref|XP_010510626.1| PREDICTED: uncharacterized protein LOC104786871 [Camelina sativa]
Length=155

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPE---RRKAIPSSRA  331
            MA S+ Y+ R ++RF +TD+   + G S FE +E +++N    ++P        I S R 
Sbjct  1    MATSKCYYQRPSHRFFTTDQH--VTGASDFELDEWDLYNTGSDSAPSFSFSDLTITSGRT  58

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDE  430
            R     S   V GAA  SLPVNVPDWSKIL +E
Sbjct  59   RTNRKDS---VSGAAASSLPVNVPDWSKILGEE  88



>ref|XP_010274532.1| PREDICTED: uncharacterized protein LOC104609834 [Nelumbo nucifera]
Length=148

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 11/78 (14%)
 Frame = +2

Query  245  VFEFEESEVWNAAHSASPERRKAIPSSRARKPSAVSGTRVVGAAPG--------SLPVNV  400
            +FEF E ++WN  H  SP+ +K + + RA K     G RV  A  G        SLPVN+
Sbjct  1    MFEFGEVDLWNLNHDTSPKLKKPMTNVRATKKL---GKRVENADRGGGAVATSTSLPVNI  57

Query  401  PDWSKILKDEYRENRRRD  454
            P+WSKILK++Y + RRR+
Sbjct  58   PNWSKILKEDYEDTRRRE  75



>gb|KCW85739.1| hypothetical protein EUGRSUZ_B02501, partial [Eucalyptus grandis]
Length=236

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 61/118 (52%), Gaps = 22/118 (19%)
 Frame = +2

Query  158  AMAASRSYFP-RNNYRFLSTD----REAPIGGDSVFEFEESEVWNAAHSASPERRK----  310
            +MAAS+SYF  R NYRF S +      A       FE +ES+V    +S+ PE R+    
Sbjct  51   SMAASKSYFANRANYRFFSNEPAASAAAAAHDTGAFELDESDV---IYSSPPEVRRPAWG  107

Query  311  ----------AIPSSRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRD  454
                         S+ +       G    G+ P SLPVN+PDWSKIL+ EYRENRRRD
Sbjct  108  SSDSSSRASAKKSSASSAAARRADGGDRRGSTPSSLPVNIPDWSKILRGEYRENRRRD  165



>ref|XP_009342883.1| PREDICTED: uncharacterized protein LOC103934848 [Pyrus x bretschneideri]
 ref|XP_009345756.1| PREDICTED: uncharacterized protein LOC103937534 [Pyrus x bretschneideri]
 ref|XP_009345768.1| PREDICTED: uncharacterized protein LOC103937544 [Pyrus x bretschneideri]
Length=179

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 67/111 (60%), Gaps = 16/111 (14%)
 Frame = +2

Query  161  MAASRSYF---PRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRK-AIPSSR  328
            MA+  S F   P + +   STD ++PIG D +F+F+E+++WN++ S   E +K ++PS R
Sbjct  1    MASRNSSFYGKPSSIFPATSTD-DSPIGSDGLFDFDEADIWNSSSSPVAESKKSSVPSRR  59

Query  329  -----ARKPSAVS-GTRVVGAAP-----GSLPVNVPDWSKILKDEYRENRR  448
                  RK   +S G   +G A       SLPVN+PD SKILK+ Y+E+R+
Sbjct  60   EPKKTGRKVMVMSMGVAEMGGAAKVVTSSSLPVNIPDCSKILKEGYKEHRK  110



>ref|XP_010043750.1| PREDICTED: uncharacterized protein LOC104432877 [Eucalyptus grandis]
Length=185

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 60/117 (51%), Gaps = 22/117 (19%)
 Frame = +2

Query  161  MAASRSYFP-RNNYRFLSTD----REAPIGGDSVFEFEESEVWNAAHSASPERRK-----  310
            MAAS+SYF  R NYRF S +      A       FE +ES+V    +S+ PE R+     
Sbjct  1    MAASKSYFANRANYRFFSNEPAASAAAAAHDTGAFELDESDV---IYSSPPEVRRPAWGS  57

Query  311  ---------AIPSSRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRD  454
                        S+ +       G    G+ P SLPVN+PDWSKIL+ EYRENRRRD
Sbjct  58   SDSSSRASAKKSSASSAAARRADGGDRRGSTPSSLPVNIPDWSKILRGEYRENRRRD  114



>ref|XP_009786538.1| PREDICTED: uncharacterized protein LOC104234640 [Nicotiana sylvestris]
Length=162

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  188  RNNYRFLS-TDREAPIGGDSV-FEFEESEVW--------NAAHSASPERRKAIPSSRARK  337
            R N+ FL   DR  P+   S+ FEF+E+E+W        N  H++  E + +IP+SR  K
Sbjct  4    RKNFLFLERKDRITPLPSSSLQFEFDEAEIWCNNTSSNENVVHNS--EAKISIPNSRFLK  61

Query  338  PSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYR  436
                   R    +  SLPVN+PDWSKIL DEYR
Sbjct  62   KPGKKSERSRAISSTSLPVNIPDWSKILGDEYR  94



>ref|XP_010514861.1| PREDICTED: uncharacterized protein LOC104790774 [Camelina sativa]
Length=152

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKP  340
            MA  +SY+ R ++RFL TDR +    DS FEFEES+++ +  S SP+ R  + +S  R+ 
Sbjct  1    MATRKSYYQRPSHRFLQTDRSSY--NDSEFEFEESDLY-STRSDSPDFRHKLFASSNRRS  57

Query  341  SAVSGTRVVGAAPGSLPVNVPDWSKILKDE  430
            S    T  V     SLP+NVPDWSKIL  E
Sbjct  58   SPSPAT--VKTTTSSLPMNVPDWSKILGKE  85



>ref|XP_002322879.1| hypothetical protein POPTR_0016s09110g [Populus trichocarpa]
 gb|EEF04640.1| hypothetical protein POPTR_0016s09110g [Populus trichocarpa]
Length=167

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = +2

Query  161  MAASRSYFPRNNYRF--LSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRAR  334
            MA+ + +  R NY +  L +        D VFE +E +V+N++  +S E RK IPSSR+ 
Sbjct  1    MASKKFFNARANYIYPTLGSGNNTITAHDKVFELDEDDVYNSSVVSSLESRKTIPSSRSS  60

Query  335  KPSAVSGTRVVGAAP---GSLPVNVPDWSKILKDEYRE  439
            K +          AP    SLPVN+PDWSKI  D  R+
Sbjct  61   KKAPRKVEMAKDLAPVTCASLPVNIPDWSKIYSDHQRK  98



>ref|XP_009610044.1| PREDICTED: uncharacterized protein LOC104103814 [Nicotiana tomentosiformis]
Length=159

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  188  RNNYRFLS-TDREAPIGGDSV-FEFEESEVW--------NAAHSASPERRKAIPSSRARK  337
            R N+ FL   DR  P+   S+ FEF+E+E+W        N  H++  E + +IP+SR  K
Sbjct  4    RKNFLFLGGKDRITPLPSSSLQFEFDEAEIWCNNTSSNENVVHNS--EAKISIPNSRFLK  61

Query  338  PSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYR  436
                   R    +  SLPVN+PDWSKIL DEYR
Sbjct  62   KPGKKSERSRTISSTSLPVNIPDWSKILGDEYR  94



>ref|XP_006292450.1| hypothetical protein CARUB_v10018671mg [Capsella rubella]
 gb|EOA25348.1| hypothetical protein CARUB_v10018671mg [Capsella rubella]
Length=168

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 63/108 (58%), Gaps = 9/108 (8%)
 Frame = +2

Query  155  SAMAASRSYFPRNNYRFLST-DR-EAPIGGDSVFEFEESEVWNAA--HSASPERRKAIPS  322
            +  A  +SY+ R ++R+L T DR    I  DS FEF+ES++++      +S  RRK   S
Sbjct  2    ATTATRKSYYQRPSHRYLPTSDRSHNTITNDSEFEFDESDLYSTTTRSDSSDLRRKLFAS  61

Query  323  SRARK-PSAVSGTRVVGAAPGSLPVNVPDWSKIL-KDEYRENRRRDCD  460
            S  R  P+A   T VV +   SLPVNVPDWSKIL K+  R  RR+  +
Sbjct  62   SNRRSSPAAAKTTTVVSS---SLPVNVPDWSKILGKENNRHVRRKSIE  106



>emb|CDY11244.1| BnaA03g00800D [Brassica napus]
Length=178

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (59%), Gaps = 8/102 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSSRA  331
            MA+ + +F + NY +   + +     ++VFEF+ES++ N      P   E +++I  SR 
Sbjct  1    MASRKHFFGKPNYIYPQPEPDMSENDENVFEFDESDIHNLGDHRLPSSFEAKRSISISRL  60

Query  332  R-KPSAV--SGTRVVGAAP--GSLPVNVPDWSKILKDEYREN  442
            R KP+ V  S   V   AP  GSLPVN+PDWSKILK EY+ +
Sbjct  61   RRKPAKVGDSSVSVNRKAPKTGSLPVNIPDWSKILKSEYKSH  102



>ref|XP_010553009.1| PREDICTED: uncharacterized protein LOC104823238 [Tarenaya hassleriana]
Length=169

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHS--ASPERRKAIPSSRA-  331
            MA+ + ++ + +Y +   + E      ++F+F+ES+++N  +    S + +K IP  R+ 
Sbjct  1    MASRKLFYGKPSYIYPYPETETSQNDHNLFDFDESDLYNHDNQFPTSFDAKKPIPILRSS  60

Query  332  RKPS----AVSGTRVVGAAPGSLPVNVPDWSKILKDEYR  436
            RKP+    + SG R      GSLPVNVPDWSKILK EYR
Sbjct  61   RKPAKTADSASGNRKTKPTSGSLPVNVPDWSKILKSEYR  99



>ref|XP_010470084.1| PREDICTED: uncharacterized protein LOC104750056 [Camelina sativa]
Length=156

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 55/95 (58%), Gaps = 12/95 (13%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPE---RRKAIPSSRA  331
            MA S+ Y+ R ++RF +TD+   + G S FE +E +++N    ++P        I S R 
Sbjct  1    MATSKCYYQRPSHRFFTTDQH--VTGASDFELDEWDLYNTGSDSAPSFSFSDLTITSGRN  58

Query  332  R--KPSAVSGTRVVGAAPGSLPVNVPDWSKILKDE  430
            R  +  +VSGT     A  SLPVNVPDWSKIL +E
Sbjct  59   RTNRKDSVSGT-----AASSLPVNVPDWSKILGEE  88



>ref|XP_006428783.1| hypothetical protein CICLE_v10012912mg [Citrus clementina]
 gb|ESR42023.1| hypothetical protein CICLE_v10012912mg [Citrus clementina]
Length=175

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +2

Query  161  MAASRSYF-PRNNYRFLSTDREAPIGG--DSVFEFEESEVWNAAHSASPE-----RRKAI  316
            MA+SR +F  + +Y + +   E  I    +++FEF+E +++    S +        +K I
Sbjct  1    MASSRKFFHAKPSYIYPTPVAETAITATDNNLFEFDEDDMYRPNESVNVNVHVEAAKKPI  60

Query  317  PSSRARKPSA--VSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDC  457
            PSSR+ +  A  +   +++     SLPVN+PDWSKILKDEYRE+ +R+ 
Sbjct  61   PSSRSSRKLAKKIEDRKIMPVTAASLPVNIPDWSKILKDEYREHSKRES  109



>gb|KDO45145.1| hypothetical protein CISIN_1g030317mg [Citrus sinensis]
Length=179

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +2

Query  161  MAASRSYF-PRNNYRFLSTDREAPIGG--DSVFEFEESEVWNAAHSASPE-----RRKAI  316
            MA+SR +F  + +Y + +   E  I    +++FEF+E +++    S +        +K I
Sbjct  1    MASSRKFFHAKPSYIYPTPVAETAITATDNNLFEFDEDDMYRPNESVNVNVHVEAAKKPI  60

Query  317  PSSRARKPSA--VSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDC  457
            PSSR+ +  A  +   +++     SLPVN+PDWSKILKDEYRE+ +R+ 
Sbjct  61   PSSRSSRKLAKKIEDRKIMPVTAASLPVNIPDWSKILKDEYREHSKRES  109



>ref|XP_008387660.1| PREDICTED: uncharacterized protein LOC103450120 [Malus domestica]
Length=179

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 66/111 (59%), Gaps = 16/111 (14%)
 Frame = +2

Query  161  MAASRSYF---PRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKA-IPSSR  328
            MA+ +S F   P + +   STD ++PIG D +FEF+E+++ N++ S   E +K+ +PS R
Sbjct  1    MASRKSSFYGKPSSIFPAPSTD-DSPIGSDGLFEFDEADIGNSSSSPVAESKKSSVPSRR  59

Query  329  ARKPSA-------VSGTRVVGAAP----GSLPVNVPDWSKILKDEYRENRR  448
              K          +S   + GAA      SLPVN+PDWS+ILK+ Y+E R+
Sbjct  60   EPKKMGRKMMVMSMSVAEMGGAAKVVTSSSLPVNIPDWSEILKEGYKEQRK  110



>ref|XP_009612829.1| PREDICTED: uncharacterized protein LOC104106054 [Nicotiana tomentosiformis]
Length=157

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 61/99 (62%), Gaps = 12/99 (12%)
 Frame = +2

Query  188  RNNYRFLS-TDREAPI---GGDSVFEFEESEVWNAAHSASPER---RKAIPSSRARKPSA  346
            R +Y FL   +R +P+        FEF+ES++W   +S +P+    +K+IP+SR  K SA
Sbjct  4    RKSYLFLGGKERISPMPCSASTLQFEFDESDIW--CNSNNPDEILPQKSIPNSRFLKKSA  61

Query  347  V-SGTRVV--GAAPGSLPVNVPDWSKILKDEYRENRRRD  454
              SG R +   AA  SLPVN+PDWSKIL ++Y+ N  R+
Sbjct  62   KKSGGRAISSAAATTSLPVNIPDWSKILGNDYKNNCLRE  100



>ref|XP_006481461.1| PREDICTED: uncharacterized protein LOC102610402 [Citrus sinensis]
Length=176

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +2

Query  161  MAASRSYF-PRNNYRFLSTDREAPIGG--DSVFEFEESEVWNAAHSASPE-----RRKAI  316
            MA+SR +F  + +Y + +   E  I    +++FEF+E +++    S +        +K I
Sbjct  1    MASSRKFFHAKPSYIYPTPVAETAITATDNNLFEFDEDDMYRPNESVNVNVHVEAAKKPI  60

Query  317  PSSRARKPSA--VSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDC  457
            PSSR+ +  A  +   +++     SLPVN+PDWSKILKDEYRE+ +R+ 
Sbjct  61   PSSRSSRKLAKKIEDRKIMPLTSASLPVNIPDWSKILKDEYREHSKRES  109



>ref|XP_006288791.1| hypothetical protein CARUB_v10002114mg [Capsella rubella]
 gb|EOA21689.1| hypothetical protein CARUB_v10002114mg [Capsella rubella]
Length=169

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 10/100 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSSRA  331
            MA+ + +F +  Y  +  + E  +  ++VFEF+ES++ N      P   E +++I  SR 
Sbjct  1    MASRKLFFAKPKY--IYPEPEPVMSDENVFEFDESDIHNLGDHQLPNSFEAKRSISISRL  58

Query  332  RKPSAVSGTRVVGA-----APGSLPVNVPDWSKILKDEYR  436
            R+  A SG  V          GSLPVN+PDWSKILK EYR
Sbjct  59   RRKPAKSGDSVGSGNRNITKTGSLPVNIPDWSKILKSEYR  98



>ref|XP_003542516.1| PREDICTED: uncharacterized protein LOC100790091 [Glycine max]
Length=180

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 58/105 (55%), Gaps = 11/105 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIG----GDSVFEFEESEVWNAAHSA--SPERRKAIPS  322
            MA+ RS+    N     T  +  +     G  +FE +E+E+WN  HS+  + + +K +PS
Sbjct  1    MASRRSFLSNPNRYIFPTTSDTHLSPSQEGKGMFELDEAELWNNNHSSATTDQSKKGLPS  60

Query  323  ----SRARKPSAVSGTRVVG-AAPGSLPVNVPDWSKILKDEYREN  442
                S  +K S  +     G   P SLPVN+PDWSKILK++Y+E+
Sbjct  61   PGSRSVLKKASRNNNNGWRGRITPASLPVNIPDWSKILKEDYKEH  105



>ref|XP_006398768.1| hypothetical protein EUTSA_v10014814mg [Eutrema salsugineum]
 gb|ESQ40221.1| hypothetical protein EUTSA_v10014814mg [Eutrema salsugineum]
Length=178

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 60/103 (58%), Gaps = 10/103 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSSRA  331
            MA+ + +F +  Y + + + E     ++VFEF+ES++ N      P   + +++I  SR 
Sbjct  1    MASRKLFFVKPKYIYPTPEPEMSENDENVFEFDESDIHNLGDHQLPNSFDAKRSISISRL  60

Query  332  R-KP-----SAVSGTRVVGAAPGSLPVNVPDWSKILKDEYREN  442
            R KP     SA SG+R      GSLPVN+PDWSKILK EYR +
Sbjct  61   RRKPAKTGDSAGSGSRKT-PKTGSLPVNIPDWSKILKSEYRSH  102



>ref|XP_010414527.1| PREDICTED: uncharacterized protein LOC104700687 [Camelina sativa]
Length=155

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 10/94 (11%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKP  340
            MA S+ Y+ R ++RF +TD+      D  FE +E +++N    ++P    +   S     
Sbjct  1    MATSKCYYQRPSHRFFTTDQHVTAASD--FELDEWDLYNTGSDSAP----SFSFSDLTIT  54

Query  341  SAVSGTR----VVGAAPGSLPVNVPDWSKILKDE  430
            S  +GT     V G A  SLPVNVPDWSKIL +E
Sbjct  55   SGRTGTNRKDSVSGTAASSLPVNVPDWSKILGEE  88



>ref|XP_010543396.1| PREDICTED: uncharacterized protein LOC104816337 [Tarenaya hassleriana]
Length=162

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 7/99 (7%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHS--ASPERRKAIPSSR-A  331
            MA+ + ++ R  Y +   + E       +FEF+ES++++       S + + +IP SR +
Sbjct  1    MASRKLFYGRPGYIYPYPETETSQNDQDLFEFDESDIYDQDERLPTSFDAKNSIPISRLS  60

Query  332  RKPSAVSGT----RVVGAAPGSLPVNVPDWSKILKDEYR  436
            RKP+  S +    R    A GSLPVNVPDWSKILK EY+
Sbjct  61   RKPAKTSDSAASHRKTKPAAGSLPVNVPDWSKILKSEYK  99



>ref|XP_010934341.1| PREDICTED: uncharacterized protein LOC105054512 [Elaeis guineensis]
Length=156

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 3/63 (5%)
 Frame = +2

Query  251  EFEESEVWNAAHSASP-ERRKAIPSSRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKD  427
            EF+E++VW       P E+RK +P++R+ +  A +  R+ G  P SLPVN+PDWSKIL++
Sbjct  27   EFDEADVWGCGLEPRPAEQRKPVPAARSGRNKAENCDRITG--PSSLPVNIPDWSKILRE  84

Query  428  EYR  436
            EYR
Sbjct  85   EYR  87



>ref|XP_003537294.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 34-like [Glycine 
max]
Length=188

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 60/107 (56%), Gaps = 13/107 (12%)
 Frame = +2

Query  161  MAASRSYFPR-NNYRFLST-DREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSS  325
            MA+ +S+    N Y F +T D       + +FE +E+E+WN  + +S    + +K +PSS
Sbjct  1    MASRKSFLSNPNRYIFPTTSDTHLSQTQEGMFELDEAELWNNHNHSSTTTDQGKKGLPSS  60

Query  326  --------RARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYREN  442
                     +R  +  +G R     P SLPVN+PDWSKILK++Y+E+
Sbjct  61   GSRSVLKRASRNHNNNNGGRDRITTPASLPVNIPDWSKILKEDYKEH  107



>gb|KHN39078.1| hypothetical protein glysoja_017372 [Glycine soja]
Length=189

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 60/107 (56%), Gaps = 13/107 (12%)
 Frame = +2

Query  161  MAASRSYFPR-NNYRFLST-DREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSS  325
            MA+ +S+    N Y F +T D       + +FE +E+E+WN  + +S    + +K +PSS
Sbjct  1    MASRKSFLSNPNRYIFPTTSDTHLSQTQEGMFELDEAELWNNHNHSSTTTDQGKKGLPSS  60

Query  326  --------RARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYREN  442
                     +R  +  +G R     P SLPVN+PDWSKILK++Y+E+
Sbjct  61   GSRSVLKRASRNHNNNNGGRDRITTPASLPVNIPDWSKILKEDYKEH  107



>ref|XP_009130722.1| PREDICTED: uncharacterized protein LOC103855485 [Brassica rapa]
Length=178

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSSRA  331
            MA+ + +F +  Y +   + +     ++VFEF+ES++ N      P   E +++I  SR 
Sbjct  1    MASRKHFFGKPKYIYPQPEPDMSENDENVFEFDESDIHNLGDHRLPSSFEAKRSISISRL  60

Query  332  R-KPSAV--SGTRVVGAAP--GSLPVNVPDWSKILKDEYREN  442
            R KP+ V  S   V   AP  GSLPVN+PDWSKILK EY+ +
Sbjct  61   RRKPAKVGDSSVSVNRKAPKTGSLPVNIPDWSKILKSEYKSH  102



>ref|XP_002871018.1| hypothetical protein ARALYDRAFT_908188 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47277.1| hypothetical protein ARALYDRAFT_908188 [Arabidopsis lyrata subsp. 
lyrata]
Length=169

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 10/100 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSSRA  331
            MA+ + +F +  Y  +  + E  +  ++VFEF+ES++ N      P   + +++I  SR 
Sbjct  1    MASRKLFFVKPKY--IYPEPEPEMSDENVFEFDESDIHNLGDHQLPNSFDAKRSISISRL  58

Query  332  RKPSAVSGTRVVGA-----APGSLPVNVPDWSKILKDEYR  436
            R+  A +G  V          GSLPVN+PDWSKILK EYR
Sbjct  59   RRKPAKTGDSVGSGNREITKTGSLPVNIPDWSKILKSEYR  98



>ref|XP_006419060.1| hypothetical protein EUTSA_v10002696mg [Eutrema salsugineum]
 gb|ESQ37496.1| hypothetical protein EUTSA_v10002696mg [Eutrema salsugineum]
Length=157

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 51/88 (58%), Gaps = 6/88 (7%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIG-GDSVFEFEESEVWNAAHSASPERRKAIPSSR--A  331
            MA  ++Y+PR ++RFL TDR   +   DS FEF+ES++++ +H     R K   S R   
Sbjct  1    MATGKTYYPRPSHRFLPTDRSHQVAVTDSGFEFDESDLYSDSHDF---RSKLFKSGRIGI  57

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSK  415
            ++    S   V  A  GSLP+NVPD SK
Sbjct  58   KQCGRSSLVTVTTAKVGSLPMNVPDQSK  85



>ref|XP_003538194.2| PREDICTED: uncharacterized protein LOC100782946 [Glycine max]
 gb|KHN38764.1| hypothetical protein glysoja_008313 [Glycine soja]
Length=171

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 59/100 (59%), Gaps = 6/100 (6%)
 Frame = +2

Query  155  SAMAASRSYFPRNNYRFL----STDREAPIGGDS--VFEFEESEVWNAAHSASPERRKAI  316
            + M++ +++F   ++RFL      D  A +  DS   FEF+ESE++N+  + S E ++++
Sbjct  3    TIMSSRKNHFSSRSHRFLPVASDIDDSASLTMDSESAFEFDESELYNSVQANSFEFQRSL  62

Query  317  PSSRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYR  436
             S  +   SA         AP S+PVN+PDWSKIL DEYR
Sbjct  63   HSRGSNNSSAKKKPSSSSGAPASMPVNIPDWSKILGDEYR  102



>emb|CDX77180.1| BnaC04g39750D [Brassica napus]
Length=165

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 9/97 (9%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPE---RRKAIPSSRA  331
            MA S+ Y+PR ++RF STD+   +   S FE +E +++N    ++         I S R 
Sbjct  1    MATSKCYYPRPSHRFFSTDQH--VSSPSDFELDEWDLFNTGSDSASGFTFSDLTITSDRT  58

Query  332  ---RKPSAVS-GTRVVGAAPGSLPVNVPDWSKILKDE  430
               RKP   S   +  G+A  SLPVNVPDWSKIL +E
Sbjct  59   GANRKPRGGSVSEKFAGSAASSLPVNVPDWSKILGEE  95



>ref|XP_006409865.1| hypothetical protein EUTSA_v10017334mg [Eutrema salsugineum]
 gb|ESQ51318.1| hypothetical protein EUTSA_v10017334mg [Eutrema salsugineum]
Length=165

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 55/99 (56%), Gaps = 9/99 (9%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPE---RRKAIPSSRA  331
            MA S+ Y+PR ++RF ST++      D  FE +E +++N    ++P        I SSR 
Sbjct  1    MATSKCYYPRVSHRFFSTEQNVTSASD--FELDEWDLYNTGSDSAPGFSFSDLTINSSRT  58

Query  332  ---RKPSAVSGTRVV-GAAPGSLPVNVPDWSKILKDEYR  436
               RK    S +    G+A  S+PVNVPDWSKIL +E R
Sbjct  59   GVNRKSLGGSVSETFSGSAASSVPVNVPDWSKILGEESR  97



>ref|XP_011007679.1| PREDICTED: uncharacterized protein LOC105113274 [Populus euphratica]
Length=168

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 51/97 (53%), Gaps = 5/97 (5%)
 Frame = +2

Query  161  MAASRSYFPRNNYRF--LSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRAR  334
            MA+ + +  R NY +  L +        D VFEF+E +V+N+   +S E +K IPSSR+ 
Sbjct  1    MASKKFFNARANYIYPTLESGNNTITAHDKVFEFDEDDVYNSNVVSSLESKKTIPSSRSS  60

Query  335  KPSAVSGTRVVGAAP---GSLPVNVPDWSKILKDEYR  436
            K +           P    SLPVN+PDWSKI  D  R
Sbjct  61   KKAPRKIEMAKDRPPVTCASLPVNIPDWSKIYSDHQR  97



>ref|XP_004145741.1| PREDICTED: uncharacterized protein LOC101215539 [Cucumis sativus]
 ref|XP_004165435.1| PREDICTED: uncharacterized protein LOC101231271 [Cucumis sativus]
 gb|KGN46838.1| hypothetical protein Csa_6G141350 [Cucumis sativus]
Length=165

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 54/98 (55%), Gaps = 4/98 (4%)
 Frame = +2

Query  161  MAASRS-YFPRNNYRFLSTDREA--PIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRA  331
            MA  +S Y  R++YRFL  D         D  FE  ES+++N+  +A    R A     +
Sbjct  1    MATGKSCYGRRSSYRFLPGDISGHHSFTSDFSFELNESDIYNSGSTARSPTRIAKKKVSS  60

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENR  445
            ++   V G    G A  SLPVN+PDWSKILK+EYRE R
Sbjct  61   KRSVEVGGGGGGGGA-SSLPVNIPDWSKILKEEYREKR  97



>ref|XP_007027332.1| Uncharacterized protein TCM_022158 [Theobroma cacao]
 gb|EOY07834.1| Uncharacterized protein TCM_022158 [Theobroma cacao]
Length=173

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 6/71 (8%)
 Frame = +2

Query  248  FEFEESEVWNAAHSASP--ERRKAIPSSRARKPSAVSGTRVVG----AAPGSLPVNVPDW  409
             EF+E++VWN+  S +   + +K +P+SR      +    V       A  SLPVN+PDW
Sbjct  37   LEFDEADVWNSNESTTTTLDAKKPLPTSRTSSKKLLRKMEVSDRRSQMASASLPVNIPDW  96

Query  410  SKILKDEYREN  442
            SKILKDEYRE+
Sbjct  97   SKILKDEYREH  107



>gb|KDP29113.1| hypothetical protein JCGZ_16502 [Jatropha curcas]
Length=176

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 64/115 (56%), Gaps = 16/115 (14%)
 Frame = +2

Query  143  LACDSAMAASRSYFPRNNYRFLS--TDREAPIGGD-SVFEFEESEVW--NAAHSASPERR  307
            +A      A R+    NNY F++  TD    I  D ++FEF+ES++W  N++  +  E +
Sbjct  1    MASKKIFQAKRTV---NNYIFVNPETDINQVISSDHNLFEFDESDIWSNNSSSVSQFESK  57

Query  308  KAIPSSRARKPSAVSGTRVVGAAP----GSLPVNVPDWSKILK-DEY-RENRRRD  454
            K +P+SR  K     G   +G  P     S+PVN+PDWSKI K D+Y R N+ +D
Sbjct  58   KILPTSRQSKKGG--GRNSLGRLPVSCSSSVPVNIPDWSKIYKEDQYTRHNKDQD  110



>ref|XP_010503169.1| PREDICTED: uncharacterized protein LOC104780370 [Camelina sativa]
Length=157

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (57%), Gaps = 6/104 (6%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAI--PSSRAR  334
            MA  +SY+ R ++RFL TDR +    DS FEF+ES++++   S  P+ R+ +   S+R  
Sbjct  1    MATRKSYYQRPSHRFLQTDRSSH--NDSEFEFDESDLYSTRSSDPPDFRRKLFSSSNRRS  58

Query  335  KPSAVSGTRVVGAAPGSLPVNVPDWSKILKDE--YRENRRRDCD  460
             PS  +          SLPVNVPDWSKIL  E   R  RRR  +
Sbjct  59   SPSPATVKTTTTVVASSLPVNVPDWSKILGKENHNRHVRRRSIE  102



>ref|XP_006381452.1| hypothetical protein POPTR_0006s12970g [Populus trichocarpa]
 gb|ERP59249.1| hypothetical protein POPTR_0006s12970g [Populus trichocarpa]
Length=174

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 53/101 (52%), Gaps = 13/101 (13%)
 Frame = +2

Query  167  ASRSYF---PRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARK  337
            ASR+ F     NNY    +      G D VFE +E++VW++  +   E +K IPSSR  K
Sbjct  2    ASRNLFNARANNNYPTPGSGNNPITGHDDVFELDEADVWDSNVAPLLESKKTIPSSRCSK  61

Query  338  PS-------AVSGTRVVGAAPGSLPVNVPDWSKILKDEYRE  439
             +       A  GT V  A   SLPVN+PDWSKI  D  ++
Sbjct  62   RAPRKFDHMAKDGTPVTCA---SLPVNIPDWSKIYNDHQKK  99



>gb|KJB62453.1| hypothetical protein B456_009G417700 [Gossypium raimondii]
Length=183

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 62/109 (57%), Gaps = 15/109 (14%)
 Frame = +2

Query  155  SAMAASRSYF-PRNNYRFLSTD-REAPIGGDSVFEFEESEVWNAAHSASP-----ERRKA  313
            S+MA+ +  F  + +Y + + D  +  I  + VFEF+E++VWN  +S  P     E +K 
Sbjct  18   SSMASRKLLFGSKPSYIYPADDGNDVIINQNDVFEFDEADVWNNNNSNEPTTNIQEGKKP  77

Query  314  IPSSRA------RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYREN  442
            +PS RA      RK  +    ++  A P SLP+N PDWSKILK E RE+
Sbjct  78   LPSLRAWSKKLSRKVESHKTPKM--AVPASLPINTPDWSKILKAEDREH  124



>ref|NP_195943.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK44090.1|AF370275_1 unknown protein [Arabidopsis thaliana]
 emb|CAB86090.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08383.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN13121.1| unknown protein [Arabidopsis thaliana]
 gb|AED90573.1| uncharacterized protein AT5G03230 [Arabidopsis thaliana]
Length=166

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 9/98 (9%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSSRA  331
            MA+ + +F +  Y +     E  +  ++VFEF+ES++ N      P   + +++I  SR 
Sbjct  1    MASRKLFFVKPKYIYPEPKPE--MSDENVFEFDESDIHNLGDHQLPNSFDAKRSISISRL  58

Query  332  R-KPSAV--SGTRVVGAAPGSLPVNVPDWSKILKDEYR  436
            R KP+    SG R +    GSLPVN+PDWSKILK EYR
Sbjct  59   RRKPTKTGDSGNREI-TKTGSLPVNIPDWSKILKSEYR  95



>ref|XP_006354325.1| PREDICTED: uncharacterized protein LOC102591579 [Solanum tuberosum]
Length=160

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 53/95 (56%), Gaps = 6/95 (6%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLS-TDREAPIGGDS---VFEFEESEVW-NAAHSASPERRKAIPSS  325
            MA + +     N+ FL   DR  P+   +    FEF+E+E+W N+    S E + +IPSS
Sbjct  1    MATTTTTRKNKNFLFLGGKDRITPLPSSTNTLQFEFDEAEMWSNSEEINSFEPKLSIPSS  60

Query  326  RARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDE  430
            R  K +   G R    A  SLPVN+PDWSKIL DE
Sbjct  61   RFSKKTTKKGERKASNAT-SLPVNIPDWSKILGDE  94



>ref|XP_010490791.1| PREDICTED: uncharacterized protein LOC104768490 [Camelina sativa]
Length=170

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 58/101 (57%), Gaps = 12/101 (12%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSA---SPERRKAIPSSRA  331
            MA+ + +F +  Y  +  + E  +  ++VFEF+ES++ N        S E +++I  SR 
Sbjct  1    MASRKLFFVKPKY--IYPEPEPVMSDENVFEFDESDIHNLGDHQLQNSFEAKRSISISRL  58

Query  332  RKPSAVSGTRVVGA------APGSLPVNVPDWSKILKDEYR  436
            R+  A +G   +G+        GSLPVN+PDWSKILK EYR
Sbjct  59   RRKPAKTGD-FIGSDNRNITKTGSLPVNIPDWSKILKSEYR  98



>gb|AFK48660.1| unknown [Lotus japonicus]
Length=167

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 60/107 (56%), Gaps = 13/107 (12%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLST---DREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRA  331
            MA+ +SY  + +Y F  T   ++++P     V E +E+++W  + S SP   +A+     
Sbjct  1    MASRKSYLSKPSYIFAETHFNNQKSPPQEGGVLELDEADLW-ISWSQSPAT-EALKKGSP  58

Query  332  RKPSAVSGTRVVGAA--------PGSLPVNVPDWSKILKDEYRENRR  448
            R     SG R V  A        PGSLPV++PDWSKILK +Y+E+R+
Sbjct  59   RSGLKRSGARKVVDAGNTGGRPGPGSLPVSIPDWSKILKQDYKEHRK  105



>ref|XP_006363694.1| PREDICTED: uncharacterized protein LOC102595296 [Solanum tuberosum]
Length=147

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 50/92 (54%), Gaps = 5/92 (5%)
 Frame = +2

Query  188  RNNYRFLSTDREAPIGGDSVFEFEESEVWNAAH---SASPERRKAIPSSRARKPSAVSGT  358
            R N++FL +  +     D +FEF+ES++W       S   E ++ IP+SR  K S     
Sbjct  4    RKNFQFLGSMDKKTSSDDLLFEFDESDIWENTTNIISHHSESKRLIPTSRISKRSPSPPP  63

Query  359  RVVGAAPGSLPVNVPDWSKILKDEYRENRRRD  454
                A   SLP+N+PDWSKIL D+ + +  RD
Sbjct  64   SPPPAR--SLPINIPDWSKILGDKKKNDDIRD  93



>dbj|BAJ92790.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05208.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 8/101 (8%)
 Frame = +2

Query  161  MAAS-RSYFPRNNYRFLSTDREAP-IG--GDSVFEFEESEVWNA-AHSASPE--RRKAIP  319
            MA S RS   ++ YR  +  R A  +G  G +  EF+ES+VW +   S  PE  R + IP
Sbjct  1    MAGSARSAAAKHAYRMFTPSRSAAALGSPGSAADEFDESDVWGSFGDSMPPELARARPIP  60

Query  320  SSRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYREN  442
            SS AR           GA PGSLP+++PDW KIL  EYR++
Sbjct  61   SS-ARAGGRKKPLDHAGAVPGSLPMSIPDWQKILGGEYRDH  100



>ref|XP_003539761.1| PREDICTED: uncharacterized protein LOC100812183 [Glycine max]
Length=170

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 8/101 (8%)
 Frame = +2

Query  155  SAMAASRSYFPRNNYRFLSTDRE------APIGGDSVFEFEESEVWNAAHSA-SPERRKA  313
            + MA+ +++F   ++RFL    +        +  +S FEF+ESE++N+A +  S E R++
Sbjct  3    TIMASRKNHFTSRSHRFLPVASDIHDSVSLTMDLESAFEFDESEIYNSARANNSFEFRRS  62

Query  314  IPSSRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYR  436
            +   R    SA          P S+PVN+PDWSKIL DEYR
Sbjct  63   L-HGRGSNSSAKKKPSSSSGDPASVPVNIPDWSKILGDEYR  102



>ref|XP_009140901.1| PREDICTED: uncharacterized protein LOC103864886 [Brassica rapa]
Length=155

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 51/96 (53%), Gaps = 14/96 (15%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAH---SASPERRKAIPSSRA  331
            MA S+ Y+PR ++RF STD +  +   S FE +E +++N      S        I S R 
Sbjct  1    MATSKCYYPRPSHRFFSTDHQH-VSSPSDFELDEWDLFNTGSDSASGFTFSDLTITSDRT  59

Query  332  ---RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDE  430
               RKP         G+A  SLPVNVPDWSKIL +E
Sbjct  60   GANRKPRG-------GSAASSLPVNVPDWSKILGEE  88



>gb|EPS70245.1| hypothetical protein M569_04515 [Genlisea aurea]
Length=159

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 53/98 (54%), Gaps = 10/98 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAP---IGGDS-VFEFEESEVWNAAHSASPERRKAIPSSR  328
            MAA RS+F R N   L  D+      +  +S +FE +ES+VW+ +   S        +SR
Sbjct  1    MAAPRSFFARPNRLSLPIDQGGGGGGVAAESMIFELDESDVWSTSVVVSQSPESRPRTSR  60

Query  329  ARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYREN  442
                SA  G       P SLPVNVPDWSKILK EYR++
Sbjct  61   KSSSSASRGL------PASLPVNVPDWSKILKQEYRDH  92



>emb|CDY62461.1| BnaA04g28420D [Brassica napus]
Length=158

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 52/96 (54%), Gaps = 14/96 (15%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPE---RRKAIPSSRA  331
            MA S+ Y+PR ++RF STD +  +   S FE +E +++N    ++         I S R 
Sbjct  1    MATSKCYYPRPSHRFFSTDHQH-VSSPSDFELDEWDLFNTGSDSASGFTFSDLTITSDRT  59

Query  332  ---RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDE  430
               RKP         G+A  SLPVNVPDWSKIL +E
Sbjct  60   GANRKPRG-------GSAASSLPVNVPDWSKILGEE  88



>ref|NP_001053333.1| Os04g0520700 [Oryza sativa Japonica Group]
 emb|CAD41447.1| OSJNBa0019D11.12 [Oryza sativa Japonica Group]
 dbj|BAF15247.1| Os04g0520700 [Oryza sativa Japonica Group]
 emb|CAH67522.1| OSIGBa0131L05.3 [Oryza sativa Indica Group]
 gb|EAZ13689.1| hypothetical protein OsJ_03611 [Oryza sativa Japonica Group]
 dbj|BAG89696.1| unnamed protein product [Oryza sativa Japonica Group]
Length=174

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 56/101 (55%), Gaps = 6/101 (6%)
 Frame = +2

Query  161  MAAS-RSYFPRNNYRFLSTDREAPI---GGDSVFEFEESEVWNAAHSASPERRKAIPSSR  328
            MA S RS   ++ YR  +  R A     G     EF+ES+VW +  +A  E   A   +R
Sbjct  1    MAGSARSAAAKHAYRMFAPSRGAAARCPGSPGADEFDESDVWGSYGAAGVESSPAELGAR  60

Query  329  ARK-PSAVSGTRV-VGAAPGSLPVNVPDWSKILKDEYRENR  445
             R  PSA +G +  +  A GSLPVN+PDW KIL  EYR+++
Sbjct  61   GRAIPSARAGRKAPLDRAAGSLPVNIPDWQKILGVEYRDHQ  101



>gb|EYU38536.1| hypothetical protein MIMGU_mgv1a018290mg [Erythranthe guttata]
Length=158

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 39/76 (51%), Gaps = 6/76 (8%)
 Frame = +2

Query  224  APIGGDSVFEFEESEVW-----NAAHSASPERRKAIPSSRARKPSAVSGTRVVGAAPGSL  388
             P   D  FE +ESE+W     N A    PER+K +      K S     R VG    SL
Sbjct  21   TPATSDDQFELDESEIWGTNCSNDADGVGPERKKQVDLPPVGK-SGNGDHRRVGEGANSL  79

Query  389  PVNVPDWSKILKDEYR  436
            PVNVPDWSKIL  EY+
Sbjct  80   PVNVPDWSKILGSEYK  95



>gb|EPS62644.1| hypothetical protein M569_12146, partial [Genlisea aurea]
Length=150

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 52/96 (54%), Gaps = 8/96 (8%)
 Frame = +2

Query  164  AASRSYFPRNNYRFLSTDREAPIGGDSV-FEFEESEVWNAAHSASPERRKAIPSSRARKP  340
            AA R+Y+   ++RFL +D       +S+ FE +ESEVWN+          + P +     
Sbjct  1    AAPRTYYAPPSHRFLPSDPS--FATESMDFELDESEVWNSDEPGLVNSTDSDPCA-----  53

Query  341  SAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
            S +       A+  SLPVNVPDWSKILK+EY   +R
Sbjct  54   SIIGSLMKPPASAASLPVNVPDWSKILKEEYYTEKR  89



>ref|XP_008785283.1| PREDICTED: uncharacterized protein LOC103703964 [Phoenix dactylifera]
Length=157

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = +2

Query  188  RNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSA-SPERRKAIPSSRARKPSAVSGTRV  364
            +N YR  +        G +  + +E++VW  A    S E RK +P++R+ +  A    RV
Sbjct  6    QNAYRLFTPVTGPEPTGLASDDLDEADVWGCALEPRSAEHRKPVPAARSGRKKAEIRDRV  65

Query  365  VGAAPGSLPVNVPDWSKILKDEYREN  442
               AP SLPVN+PDWSKIL++E+R N
Sbjct  66   T--APASLPVNIPDWSKILREEHRGN  89



>gb|KHN48294.1| hypothetical protein glysoja_007963 [Glycine soja]
Length=149

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 7/73 (10%)
 Frame = +2

Query  245  VFEFEESEVWNAAHSA--SPERRKAIPS----SRARKPSAVSGTRVVG-AAPGSLPVNVP  403
            +FE +E+E+WN  HS+  + + +K +PS    S  +K S  +     G   P SLPVN+P
Sbjct  1    MFELDEAELWNNNHSSATTDQSKKGLPSPGSRSVLKKASRNNNNGWRGRITPASLPVNIP  60

Query  404  DWSKILKDEYREN  442
            DWSKILK++Y+E+
Sbjct  61   DWSKILKEDYKEH  73



>ref|XP_010452194.1| PREDICTED: uncharacterized protein LOC104734339 [Camelina sativa]
Length=170

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 58/101 (57%), Gaps = 12/101 (12%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSA---SPERRKAIPSSRA  331
            MA+ + +F +  Y  +  + E  +  ++VFEF+ES++ N        S + +++I  SR 
Sbjct  1    MASRKLFFVKPKY--IYPEPEPVMSDENVFEFDESDIHNLGDHQLQNSFDAKRSISISRL  58

Query  332  R-KPSAV-----SGTRVVGAAPGSLPVNVPDWSKILKDEYR  436
            R KP+       SG R +    GSLPVN+PDWSKILK EYR
Sbjct  59   RRKPTKTGDSVNSGNRNI-TKTGSLPVNIPDWSKILKSEYR  98



>ref|XP_011048547.1| PREDICTED: uncharacterized protein LOC105142559 [Populus euphratica]
 ref|XP_011048548.1| PREDICTED: uncharacterized protein LOC105142559 [Populus euphratica]
Length=173

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 12/102 (12%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLS--TDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRA-  331
            MA+   +  R NY + +     +   G D VFE +E++VW++  +   E +K IPSSR  
Sbjct  1    MASRNLFNARANYNYPTPGIGNDPITGHDDVFELDEADVWDSNVAPLLESKKTIPSSRCS  60

Query  332  -RKPSAV-----SGTRVVGAAPGSLPVNVPDWSKILKDEYRE  439
             R P  +      GT V  A   SLPVN+PDWSKI  D  ++
Sbjct  61   RRAPRKIDHMAKDGTPVTCA---SLPVNIPDWSKIYSDHQKK  99



>ref|XP_010423745.1| PREDICTED: uncharacterized protein LOC104708816 [Camelina sativa]
Length=170

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 10/100 (10%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSA---SPERRKAIPSSRA  331
            MA+ + +F +  Y  +  + E  +  ++VFEF+ES++ N        S + +++I  SR 
Sbjct  1    MASRKLFFVKPKY--IYPEPEPVMSDENVFEFDESDIHNLGDHQLQNSFDAKRSISISRL  58

Query  332  RKPSAVSGTRVVG-----AAPGSLPVNVPDWSKILKDEYR  436
            R+    +G  +          GSLPVN+PDWSKILK EYR
Sbjct  59   RRKPTKTGDSIGSDNRNITKTGSLPVNIPDWSKILKSEYR  98



>gb|KJB36601.1| hypothetical protein B456_006G166600 [Gossypium raimondii]
 gb|KJB36602.1| hypothetical protein B456_006G166600 [Gossypium raimondii]
 gb|KJB36603.1| hypothetical protein B456_006G166600 [Gossypium raimondii]
Length=184

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 60/126 (48%), Gaps = 26/126 (21%)
 Frame = +2

Query  161  MAASRSYF---PRNNYRFLSTDREAPIGGDS--------VFEFEESEVWNAAH---SASP  298
            MA SR +F   PR  Y  +  D    I   S        + EF+E +VWN ++   + + 
Sbjct  1    MATSRIFFGSKPRYIYPTMEFDDGNLINNPSFDHHHHHHLLEFDEVDVWNNSNDQATTNL  60

Query  299  ERRKAIPSSRARKPSAVSGTRV------------VGAAPGSLPVNVPDWSKILKDEYREN  442
            E +K +PS RA    A                  + AA  SLPVN+PDWSKILK EYRE+
Sbjct  61   EAKKPLPSYRASSKKAFKKKEFQISDNNNHRSAQMTAASASLPVNIPDWSKILKAEYREH  120

Query  443  RRRDCD  460
             + D D
Sbjct  121  GKTDED  126



>emb|CDY10396.1| BnaCnng02970D [Brassica napus]
Length=176

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (56%), Gaps = 8/102 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSSRA  331
            MA+ + +F +  + +   +        +VFEF+ES++ +      P   E +++I  SR 
Sbjct  1    MASMKHFFAKPKHIYPQPEPVMSENDKNVFEFDESDIHSLGDHQKPSSFEAKRSISISRL  60

Query  332  R-KPSAVSGTRVV----GAAPGSLPVNVPDWSKILKDEYREN  442
            R KP+ V+ +  +     A  GS+PVN+PDWSKILK EYR +
Sbjct  61   RRKPAKVADSSGLDNRKTAKTGSVPVNIPDWSKILKSEYRSH  102



>ref|XP_002879098.1| hypothetical protein ARALYDRAFT_481665 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55357.1| hypothetical protein ARALYDRAFT_481665 [Arabidopsis lyrata subsp. 
lyrata]
Length=164

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 52/102 (51%), Gaps = 9/102 (9%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASPERRK----AIPSSR  328
            MA S+ Y+PR ++RF +TD+      D  FE +E +++N   S SP         I S R
Sbjct  1    MATSKCYYPRPSHRFFTTDQHVTAASD--FELDEWDLYNTG-SDSPSNFSFSDLTITSGR  57

Query  329  ARKPSAV--SGTRVVGAAPGSLPVNVPDWSKILKDEYRENRR  448
                  +        G A  SLPVNVPDWSKIL DE R  R+
Sbjct  58   TGTNRKIHGGSGSGSGTAASSLPVNVPDWSKILGDESRRQRQ  99



>ref|XP_003575409.1| PREDICTED: uncharacterized protein LOC100843189 [Brachypodium 
distachyon]
Length=171

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 43/77 (56%), Gaps = 14/77 (18%)
 Frame = +2

Query  221  EAPIGGDSVFEFEESEVWNAAHSAS-----PERRKAIPSSRARKPSAVSGTRVVGAAPGS  385
            EA  G D   EF+ES++W +  SA+     P     IP    RK      T+   AA GS
Sbjct  33   EAAAGAD---EFDESDIWGSFDSAAEAEQRPRAGAEIPRRPGRK------TKPAAAAHGS  83

Query  386  LPVNVPDWSKILKDEYR  436
            LPVN+PDWSKIL DEYR
Sbjct  84   LPVNIPDWSKILGDEYR  100



>emb|CDX70321.1| BnaA10g26700D [Brassica napus]
Length=176

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 8/102 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSSRA  331
            MA+ + +F +    +   +        +VFEF+ES++ N      P   E +++I  SR 
Sbjct  1    MASMKHFFAKPKSTYPKPEPVMSENDKNVFEFDESDIHNLGDHQKPSSFEAKRSISISRL  60

Query  332  R-KPSAVSGTRVV----GAAPGSLPVNVPDWSKILKDEYREN  442
            R KP+ V+ +        A  GS+PVN+PDWSKILK EYR +
Sbjct  61   RRKPAKVADSSGFDNRKTAKTGSVPVNIPDWSKILKSEYRSH  102



>ref|XP_004493973.1| PREDICTED: uncharacterized protein LOC101494881 [Cicer arietinum]
Length=162

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 9/100 (9%)
 Frame = +2

Query  161  MAASR-SYFPRNNYRF-----LSTDREAPIGGDSVFEFEESEVWNAAHSASP--ERRKAI  316
            MA+SR S+  R++Y F       TD        + FEF+E++VWN + +++   E++K +
Sbjct  1    MASSRKSFLSRSSYIFPTNSETETDFNQTSSDGTEFEFDEADVWNYSSNSNTVTEQKKGV  60

Query  317  PSSRARKPSAVSGTRVV-GAAPGSLPVNVPDWSKILKDEY  433
            P  +       + +RV   A+  SLP+N+PDWSK LK++Y
Sbjct  61   PGLKRVSKKVEANSRVNPIASSSSLPMNIPDWSKNLKEDY  100



>ref|XP_004246659.1| PREDICTED: uncharacterized protein LOC101246954 [Solanum lycopersicum]
Length=158

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (55%), Gaps = 9/97 (9%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLS-TDREAPIGGDS---VFEFEESEVW-NAAHSASPERRKAIPSS  325
            MA +R      N+ FL   D+  P+   +    FEF+E+E+W N+    + E + +IPSS
Sbjct  1    MATTRKT---KNFLFLGGKDKITPLPSSTNTLQFEFDEAEMWSNSEEINNVEPKLSIPSS  57

Query  326  RARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYR  436
            R  K     G R    A  SLPVN+PDWSKIL D+ +
Sbjct  58   RLSKKMTKKGERKAINAT-SLPVNIPDWSKILGDDEK  93



>ref|XP_003625632.1| hypothetical protein MTR_7g101250 [Medicago truncatula]
 gb|ABD32800.1| Protein of unknown function DUF584 [Medicago truncatula]
 gb|AES81850.1| senescence regulator [Medicago truncatula]
 gb|AFK45848.1| unknown [Medicago truncatula]
Length=160

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 4/91 (4%)
 Frame = +2

Query  161  MAASR-SYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSSR  328
            MA+SR S+  R +Y F  T+           EF+E++VWN ++S S    E +K +P  +
Sbjct  1    MASSRKSFLSRTSYIFPETNFNQKSSQGKELEFDEADVWNMSYSNSNTNIEPKKGVPGLK  60

Query  329  ARKPSAVSGTRVVGAAPGSLPVNVPDWSKIL  421
                   +  +V   A  SLP+N+PDWSKIL
Sbjct  61   RVSRKMEANNKVNPLASSSLPMNIPDWSKIL  91



>ref|XP_011468685.1| PREDICTED: uncharacterized protein LOC101312271 [Fragaria vesca 
subsp. vesca]
Length=162

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 13/103 (13%)
 Frame = +2

Query  176  SYFPRNNYRFLSTDREAPI-GGDSVFEFEESEVWNAAHSAS---PERRK---AIPSSRAR  334
            S+  + NY F S +   PI   D VFEF++SE+W    + S   PE +K    IP    R
Sbjct  7    SFHSKPNYLFPSHN---PIRNSDGVFEFDDSELWVNPSNGSNHPPESKKLMSTIPREPRR  63

Query  335  KPSA-VSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDCD  460
            K +A   GT  V ++  S+PVN+PDWSKILK++ ++    D D
Sbjct  64   KTTADQKGTTAVTSS--SVPVNIPDWSKILKEQRQQRDTSDED  104



>gb|EMT20885.1| hypothetical protein F775_09195 [Aegilops tauschii]
Length=173

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 15/82 (18%)
 Frame = +2

Query  251  EFEESEVWN-----------AAHSASPERRKAIPSSR-ARKPSAVSGTRVVGAAPGSLPV  394
            EF+ES+VW            A   A   R +A+P++R  RK   + G    GAA GSLPV
Sbjct  40   EFDESDVWGSFNPAEEAEQPARSGAELPRVRAVPAARPGRKTKPMGGG---GAAHGSLPV  96

Query  395  NVPDWSKILKDEYRENRRRDCD  460
             +PDWSKIL DEY+ ++  D +
Sbjct  97   AIPDWSKILGDEYQGHQAGDWE  118



>ref|XP_006647550.1| PREDICTED: uncharacterized protein LOC102719835 [Oryza brachyantha]
Length=168

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 46/88 (52%), Gaps = 12/88 (14%)
 Frame = +2

Query  200  RFLSTDREAPIGGDSVFEFEESEVWNA---------AHSASPERRKAIPSSRARKPSAVS  352
            RF         GG+ V EF+ES++W +           +A   R + +P++R   P    
Sbjct  16   RFAPPASRGGAGGNGVDEFDESDIWGSFEPAADVVEPRAAGSPRGRHVPTAR---PGRKP  72

Query  353  GTRVVGAAPGSLPVNVPDWSKILKDEYR  436
              +   AA GSLPVN+PDWSKIL DEYR
Sbjct  73   APKKKPAAHGSLPVNIPDWSKILGDEYR  100



>gb|AFK35468.1| unknown [Lotus japonicus]
Length=166

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 53/109 (49%), Gaps = 12/109 (11%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLST-DREAPIGGDSV----FEFEESEVWNAAHSASPERRKAIPSS  325
            MA+ +S+  R N+ F  T D E      S      E +E+E+WN + +A   + K +P+ 
Sbjct  1    MASRKSFLSRKNFIFPETHDLEIHSNPKSSEGEELELDEAEMWNLSLTAETAK-KVVPAG  59

Query  326  ------RARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRD  454
                  R  +     G         SLPVN+PDWSKILK  ++ENR  D
Sbjct  60   SRSALKRGSRKVDSGGKSNPAVVSSSLPVNIPDWSKILKQGHKENRGID  108



>ref|XP_008442681.1| PREDICTED: uncharacterized protein LOC103486480 [Cucumis melo]
Length=178

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 8/78 (10%)
 Frame = +2

Query  239  DSVFEFEESEVWNAAHSASP----ERRKAIPSSRA---RKPSAVSGTRVVGAAPGSLPVN  397
            + +FEF+ES++W +A + +P    E RK  P S+    R  SA +       A  SLPVN
Sbjct  37   NGLFEFDESDIWTSATTTTPTPPMESRKIFPISKKLPKRSGSAATAVEKAVKASSSLPVN  96

Query  398  VPDWSKIL-KDEYRENRR  448
            +PDWSKIL KD+ +  RR
Sbjct  97   IPDWSKILQKDQNKHGRR  114



>ref|NP_001144115.1| uncharacterized protein LOC100276955 [Zea mays]
 gb|ACG38011.1| hypothetical protein [Zea mays]
Length=182

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 13/76 (17%)
 Frame = +2

Query  251  EFEESEVWNA----AHSASPERR------KAIPSSRARKPSAVSGTRVVGAAPGSLPVNV  400
            EF+ES+VW +    +  +SP         + IP S AR+   V G    G A GSLP+N+
Sbjct  37   EFDESDVWGSFGADSQYSSPGAELGAGWARPIPGSGARRKKPVDGG---GGAAGSLPMNI  93

Query  401  PDWSKILKDEYRENRR  448
            PDW KIL  EYR++ R
Sbjct  94   PDWQKILGVEYRDHHR  109



>gb|KFK24774.1| hypothetical protein AALP_AA8G023000 [Arabis alpina]
Length=169

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDRE-APIGGDSVFEFEESEVWNAAHSASP---ERRKAIPSSR  328
            MA+ + +  +  Y +  T++E      D+VFEF+ES++ +     S    + ++++  SR
Sbjct  1    MASRKLFSVKPKYIYPVTEQEIMSENDDNVFEFDESDIHHIGDHQSLNSFDAKRSVSISR  60

Query  329  ARKPSAVSGTRVVGAAP--GSLPVNVPDWSKILKDEYREN  442
             R+     G       P  GSLPVN+PDWSKIL+ EYR +
Sbjct  61   LRRKPVKIGDSDNRKTPKTGSLPVNIPDWSKILRGEYRSH  100



>ref|XP_011094663.1| PREDICTED: uncharacterized protein LOC105174308 [Sesamum indicum]
Length=160

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 12/100 (12%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSAS-PERRKAIPSSR---  328
            MAA RS+     +  LS+   A +G     EF+E+EV  A  + +  E +K + + R   
Sbjct  1    MAARRSHCYLGGHDRLSS---AALGDQFDLEFDEAEVLCAEDAINIAETKKPVSNPRPLR  57

Query  329  --ARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYREN  442
               RK   V   RV    P SLPVN+PDWS+IL+ EYR++
Sbjct  58   KPVRKSVNVDHLRV---GPRSLPVNIPDWSQILRGEYRKH  94



>gb|ACU21467.1| unknown [Glycine max]
Length=152

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIG---GDSVFEFEESEVWNAAHSASPERRKAIPSSRA  331
            MA+ + +  + +  F+S+  +  +    GD   E +E+E++N   S    +   +  S+ 
Sbjct  1    MASGKGFLSKVSSMFVSSSTDLELKSTEGD--LELDEAEMFNWNMSNDNNKNNTVTESKK  58

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRD  454
            R P +    +V   A  S+PV +PDWSKILK++++E+++R+
Sbjct  59   R-PRSGKKKKVNPVASSSMPVAIPDWSKILKEDFKEHKKRE  98



>ref|XP_010920416.1| PREDICTED: uncharacterized protein LOC105044291 [Elaeis guineensis]
Length=152

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 49/92 (53%), Gaps = 6/92 (7%)
 Frame = +2

Query  197  YRFLS--TDREAPIGGDSVFEFEESEVWNAAHSASP-ERRKAIPSSRARKPSAVSGTRVV  367
            YR  +  T RE+ +      EF+E++VW  A  + P E  K +P+              V
Sbjct  9    YRLFTPVTGRESKVLASD--EFDEADVWECALESRPAEHHKPVPAVARTGRKKTEKRDRV  66

Query  368  GAAPGSLPVNVPDWSKILKDEY-RENRRRDCD  460
             AAP S+P+N+P+WSKIL++EY   N  RD D
Sbjct  67   PAAPASIPMNIPEWSKILREEYIGNNSWRDLD  98



>ref|XP_004137823.1| PREDICTED: uncharacterized protein LOC101217342 [Cucumis sativus]
 ref|XP_004164382.1| PREDICTED: uncharacterized protein LOC101230143 [Cucumis sativus]
 gb|KGN58959.1| hypothetical protein Csa_3G739050 [Cucumis sativus]
Length=179

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 8/78 (10%)
 Frame = +2

Query  239  DSVFEFEESEVWNAAHSASP----ERRKAIPSSRA---RKPSAVSGTRVVGAAPGSLPVN  397
            +++FEF+ES++W +A + +P    E RK  P S+    R  SA +       A  SLPVN
Sbjct  37   NNLFEFDESDIWTSATTTAPTPPMESRKIFPISKKLPKRSGSAATAVEKAVKASSSLPVN  96

Query  398  VPDWSKIL-KDEYRENRR  448
            +PDWSKIL KD+ +  RR
Sbjct  97   IPDWSKILQKDQNKHGRR  114



>ref|XP_003554378.1| PREDICTED: uncharacterized protein LOC100808952 [Glycine max]
Length=152

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIG---GDSVFEFEESEVWNAAHSASPERRKAIPSSRA  331
            MA+ + +  + +  F+S+  +  +    GD   E +E+E++N   S    +   +  S+ 
Sbjct  1    MASRKGFLSKVSSMFVSSSTDLELKSTEGD--LELDEAEMFNWNMSNDNNKNNTVTESKK  58

Query  332  RKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRD  454
            R P +    +V   A  S+PV +PDWSKILK++++E+++R+
Sbjct  59   R-PRSGKKKKVNPVASSSMPVAIPDWSKILKEDFKEHKKRE  98



>ref|XP_006295161.1| hypothetical protein CARUB_v10024237mg [Capsella rubella]
 gb|EOA28059.1| hypothetical protein CARUB_v10024237mg [Capsella rubella]
Length=155

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 46/93 (49%), Gaps = 8/93 (9%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREA-PIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARK  337
            MA S+ Y+ R ++RF + D+        S FE +E +++N    +        PS     
Sbjct  1    MATSKCYYQRPSHRFFTNDQHVITTTAPSDFELDEWDLYNTTTGSDSS-----PSFTFSD  55

Query  338  PSAVSGTRVVG--AAPGSLPVNVPDWSKILKDE  430
             +  SG       AA  SLPVNVPDWSKIL +E
Sbjct  56   LTITSGRTKTNRKAAASSLPVNVPDWSKILGEE  88



>ref|XP_004249833.1| PREDICTED: uncharacterized protein LOC101261979 [Solanum lycopersicum]
Length=158

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 51/94 (54%), Gaps = 8/94 (9%)
 Frame = +2

Query  188  RNNYRFLSTDREAPIGGDSVFEFEESEVWN-----AAHSASPERRKAIPSSRARKPSAVS  352
            R N++FL++        D +FEF+ES++W+      +H + P+R   IP+ R+ + S   
Sbjct  4    RKNFQFLASMELKTSSDDLIFEFDESDIWDNTTNVVSHHSEPKR--LIPTPRSSRKSPSP  61

Query  353  GTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRD  454
                   A  SLPVN+PDWSK+  D+ +    +D
Sbjct  62   SPPSPSLAR-SLPVNIPDWSKVQGDKNKNEAIQD  94



>ref|XP_004497503.1| PREDICTED: uncharacterized protein LOC101503850 [Cicer arietinum]
Length=157

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (54%), Gaps = 7/93 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLST-DREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARK  337
            M + +S+  + N  F +T +       + VFEF+E+E+WN     SP +R A   S  ++
Sbjct  1    MTSRKSFLTKQNLIFPATSNTHFDKKEEGVFEFDEAELWNPC---SPTKRGANSISGLKR  57

Query  338  PSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYR  436
             S     RV    P SLPVN+P   KILK+E++
Sbjct  58   ASRKVDGRVGPMGPASLPVNIP---KILKEEHK  87



>ref|XP_007162749.1| hypothetical protein PHAVU_001G177200g [Phaseolus vulgaris]
 gb|ESW34743.1| hypothetical protein PHAVU_001G177200g [Phaseolus vulgaris]
Length=162

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 56/106 (53%), Gaps = 9/106 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRF--LSTDREAP-IGGDSVFEFEESEVWNAAHS----ASPERRKAIP  319
            MA+ + +  + +  F   STD EA    GD   E +E++VWN   S     + E +K   
Sbjct  1    MASRKGFLSKVSSMFGSSSTDLEAKATEGD--MELDEADVWNWNLSNSNNTATESKKWSR  58

Query  320  SSRARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRENRRRDC  457
            S +        G RV   A  S+PVN+PDWSKILK+ Y E+ +R+C
Sbjct  59   SGKKGFKKVEGGGRVNPVASSSMPVNIPDWSKILKENYEEHDKRNC  104



>ref|XP_010557316.1| PREDICTED: uncharacterized protein LOC104826363 [Tarenaya hassleriana]
Length=162

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 55/99 (56%), Gaps = 8/99 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLSTDREAPIGGDSVFEFEESEVWNAAHSAS--PERRKA-IPSSRA  331
            MA S+ Y+ R ++RF+S  + +  G  S FE +E ++++    +S  P+     I S+  
Sbjct  1    MATSKCYYRRPSHRFISGQQTSTTG--SEFELDEWDIYSQGRPSSEPPDLGLTDIISTVG  58

Query  332  RKPSAVSGTRV-VGAAPGSLPVNVPDWSKILKDEYRENR  445
            R  + V+G R    A  G+ PVNVPDWS IL +E R  R
Sbjct  59   R--TGVNGNRFPSDAIVGTAPVNVPDWSTILGEESRRRR  95



>ref|XP_002454206.1| hypothetical protein SORBIDRAFT_04g026640 [Sorghum bicolor]
 gb|EES07182.1| hypothetical protein SORBIDRAFT_04g026640 [Sorghum bicolor]
Length=167

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 35/64 (55%), Gaps = 2/64 (3%)
 Frame = +2

Query  251  EFEESEVWNAAHSASPERRKAIPSSRARKPSAVSGTRVVG--AAPGSLPVNVPDWSKILK  424
            EF+ES++W A   A P R     ++R    +  +        AA GSLPV +PDWSKIL 
Sbjct  38   EFDESDIWGAFAPAEPVRASQFLATRKASSAKAAPALAPDGRAAHGSLPVKIPDWSKILG  97

Query  425  DEYR  436
             EYR
Sbjct  98   SEYR  101



>ref|XP_008791539.1| PREDICTED: uncharacterized protein LOC103708409 [Phoenix dactylifera]
Length=162

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 7/84 (8%)
 Frame = +2

Query  197  YRFLS--TDREAP-IGGDSVFEFEESEVWNAAHSASP-ERRKAIPSSRARKPSAVSGTRV  364
            YRF +  T  E+  +G D   EF+E++VW  A    P E  K + ++   +         
Sbjct  9    YRFFTPVTGPESTWLGSD---EFDEADVWGCALEPRPAEHHKPVTAATWSERKKTVKRDR  65

Query  365  VGAAPGSLPVNVPDWSKILKDEYR  436
            V A P SLP+ +PDWSKIL++EYR
Sbjct  66   VTAEPASLPMGIPDWSKILREEYR  89



>ref|XP_007132259.1| hypothetical protein PHAVU_011G079500g [Phaseolus vulgaris]
 gb|ESW04253.1| hypothetical protein PHAVU_011G079500g [Phaseolus vulgaris]
Length=168

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 57/98 (58%), Gaps = 8/98 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFL--STDREA---PIGGDSVFEFEESEVWNAAHSASPERRKAIPSS  325
            MA+ ++YF    +RFL  +++R++    +  +S FEF+ESE++N+  + S E  +++   
Sbjct  1    MASRKNYFTSRRHRFLPVASNRDSLALTMDSESAFEFDESEIYNSGQANSFEFSRSL---  57

Query  326  RARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRE  439
              R  +    +     A  S+PVN+PDWSKIL  EY +
Sbjct  58   HGRGSAKKKPSSSAAPASASVPVNIPDWSKILGHEYTQ  95



>ref|XP_002519536.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42950.1| conserved hypothetical protein [Ricinus communis]
Length=176

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 57/108 (53%), Gaps = 13/108 (12%)
 Frame = +2

Query  143  LACDSAMAASRSYFPRNNYRFLSTDREA--PIGGDSVFEFEESEVWNAAHSASPERRKAI  316
            +A    + A R+    N+Y F++ + E    +   ++FEF+E++VW++  + +    +A+
Sbjct  1    MASKKLLHAKRA---TNSYIFVNPEAEINPVVSHGNLFEFDEADVWSSNSNNNNNNSRAV  57

Query  317  PSSRARKPSAVSG----TRVVGAAP----GSLPVNVPDWSKILKDEYR  436
              S A+K     G      VV   P     SLPVN+PDWSKI + ++R
Sbjct  58   SQSEAKKMLPRKGGGRNNMVVTKTPVTCASSLPVNIPDWSKIYRVDHR  105



>gb|EYU34447.1| hypothetical protein MIMGU_mgv1a023553mg [Erythranthe guttata]
Length=152

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 50/98 (51%), Gaps = 12/98 (12%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLS-TDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSR---  328
            MAAS   +  +++R+L   DR +     +  EF+E E+W + ++ S    K  P      
Sbjct  1    MAAS---WKSHHHRYLGGADRLST----AEIEFDEDEIWGSNNNNSVPEAKTFPVYSNPR  53

Query  329  -ARKPSAVSGTRVVGAAPGSLPVNVPDWSKILKDEYRE  439
              RKP        +   P S+PVNVPDWSKIL  EY++
Sbjct  54   PLRKPLRKGHVDHLTVGPRSVPVNVPDWSKILGGEYKK  91



>gb|KHN02339.1| hypothetical protein glysoja_002363 [Glycine soja]
Length=139

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = +2

Query  209  STDREAP-IGGDSVFEFEESEVWNAAHSASPERRKAIPSSRARKPSAVSGTRVVGAAPGS  385
            STD E     GD   E +E+E++N   S    +   +  S+ R P +    +V   A  S
Sbjct  6    STDLELKSTEGD--LELDEAEMFNWNMSNDNNKNNTVTESKKR-PRSGKKKKVNPVASSS  62

Query  386  LPVNVPDWSKILKDEYRENRRRD  454
            +PV +PDWSKILK++++E+++R+
Sbjct  63   MPVAIPDWSKILKEDFKEHKKRE  85



>gb|KHN09502.1| hypothetical protein glysoja_016601 [Glycine soja]
Length=166

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 9/106 (8%)
 Frame = +2

Query  161  MAASRSYFPRNNYRFLS--TDREAPIGGDSVFEFEESEVWNAAHSASPERRKAIPSSRAR  334
            MA+ + +  + +  F S  TD E P   D   E +E++V+N   S     +  +  S+ R
Sbjct  1    MASRKGFLSKVSSMFASSSTDLE-PKSTDGDLELDEADVFNWNMSNDYNNKNTVTESKKR  59

Query  335  KPSAVSGTRVVG------AAPGSLPVNVPDWSKILKDEYRENRRRD  454
              S        G       A  S+PV +PDWSKILK++++E+ +RD
Sbjct  60   PRSGKKKKVEGGGGKVNPVASSSMPVAIPDWSKILKEDFKEHEKRD  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561614547535