BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G03

Length=562
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006350379.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    234   1e-72   Solanum tuberosum [potatoes]
ref|XP_009623368.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    231   1e-71   Nicotiana tomentosiformis
ref|NP_001234574.1|  succinyl-CoA ligase [ADP-forming] subunit al...    230   6e-71   Solanum lycopersicum
ref|XP_006348504.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    228   3e-70   Solanum tuberosum [potatoes]
gb|AIS71903.1|  mitochondrial succinyl-CoA ligase ADP-forming sub...    228   5e-70   Nicotiana tabacum [American tobacco]
ref|XP_009775900.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    224   6e-70   Nicotiana sylvestris
ref|XP_009781531.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    224   1e-68   Nicotiana sylvestris
emb|CDP14400.1|  unnamed protein product                                223   2e-68   Coffea canephora [robusta coffee]
ref|XP_011091459.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    220   2e-67   Sesamum indicum [beniseed]
ref|NP_001234277.1|  succinyl-CoA ligase [ADP-forming] subunit al...    218   2e-66   
gb|AFL48180.1|  succinyl-CoA synthetase                                 217   3e-66   Capsicum annuum
gb|KJB79847.1|  hypothetical protein B456_013G069200                    215   4e-66   Gossypium raimondii
gb|KJB79846.1|  hypothetical protein B456_013G069200                    216   2e-65   Gossypium raimondii
gb|EYU19899.1|  hypothetical protein MIMGU_mgv1a009825mg                214   4e-65   Erythranthe guttata [common monkey flower]
gb|EPS68438.1|  hypothetical protein M569_06331                         214   5e-65   Genlisea aurea
ref|XP_010934473.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    213   3e-64   Elaeis guineensis
gb|KDO52721.1|  hypothetical protein CISIN_1g0195001mg                  209   3e-64   Citrus sinensis [apfelsine]
ref|XP_002271746.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    211   6e-64   Vitis vinifera
gb|KHG06820.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-2...    211   2e-63   Gossypium arboreum [tree cotton]
gb|KHG04322.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    211   2e-63   Gossypium arboreum [tree cotton]
ref|XP_009355925.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    209   4e-63   Pyrus x bretschneideri [bai li]
ref|XP_006441424.1|  hypothetical protein CICLE_v10020931mg             207   6e-63   
ref|XP_006493424.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    209   6e-63   Citrus sinensis [apfelsine]
ref|XP_006394592.1|  hypothetical protein EUTSA_v10004347mg             211   8e-63   
ref|XP_007152547.1|  hypothetical protein PHAVU_004G139300g             208   1e-62   Phaseolus vulgaris [French bean]
ref|XP_008375061.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    208   1e-62   Malus domestica [apple tree]
ref|XP_006441425.1|  hypothetical protein CICLE_v10020931mg             208   2e-62   Citrus clementina [clementine]
ref|XP_008467310.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    208   2e-62   Cucumis melo [Oriental melon]
ref|XP_002514510.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    208   2e-62   Ricinus communis
ref|XP_007043270.1|  Succinyl-CoA ligase, alpha subunit                 208   2e-62   
ref|XP_010423114.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    208   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_008240339.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    207   3e-62   Prunus mume [ume]
ref|XP_006374278.1|  hypothetical protein POPTR_0015s056201g            202   3e-62   
ref|NP_001241205.1|  uncharacterized protein LOC100782001               207   3e-62   Glycine max [soybeans]
ref|XP_006437603.1|  hypothetical protein CICLE_v10032075mg             207   3e-62   Citrus clementina [clementine]
ref|XP_010547709.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    207   4e-62   Tarenaya hassleriana [spider flower]
ref|XP_007209332.1|  hypothetical protein PRUPE_ppa008341mg             207   4e-62   Prunus persica
ref|XP_009136375.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    207   4e-62   Brassica rapa
emb|CDY61908.1|  BnaC07g49680D                                          207   6e-62   Brassica napus [oilseed rape]
ref|XP_009413310.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    206   7e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010491456.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    207   8e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010452813.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    206   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_002514509.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    206   1e-61   Ricinus communis
ref|XP_006288079.1|  hypothetical protein CARUB_v10001317mg             206   1e-61   Capsella rubella
ref|XP_006484523.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    206   1e-61   Citrus sinensis [apfelsine]
ref|XP_004137529.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    206   1e-61   Cucumis sativus [cucumbers]
emb|CDX81092.1|  BnaC03g03460D                                          206   2e-61   
ref|NP_196447.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha-1     206   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548295.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    205   2e-61   Glycine max [soybeans]
ref|XP_008393504.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    205   2e-61   Malus domestica [apple tree]
ref|XP_002871316.1|  hypothetical protein ARALYDRAFT_487662             206   2e-61   
gb|KJB31856.1|  hypothetical protein B456_005G211200                    204   2e-61   Gossypium raimondii
gb|KJB31854.1|  hypothetical protein B456_005G211200                    203   2e-61   Gossypium raimondii
ref|XP_002460917.1|  hypothetical protein SORBIDRAFT_02g037420          205   2e-61   Sorghum bicolor [broomcorn]
gb|AFK38534.1|  unknown                                                 201   4e-61   Medicago truncatula
ref|XP_006288023.1|  hypothetical protein CARUB_v10001256mg             205   4e-61   
ref|XP_003620150.1|  Succinyl-CoA ligase                                204   5e-61   Medicago truncatula
gb|KJB31855.1|  hypothetical protein B456_005G211200                    202   5e-61   Gossypium raimondii
ref|XP_003562832.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    204   7e-61   Brachypodium distachyon [annual false brome]
gb|KJB31853.1|  hypothetical protein B456_005G211200                    204   7e-61   Gossypium raimondii
emb|CDY02216.1|  BnaA03g39510D                                          204   8e-61   
emb|CDX69957.1|  BnaA10g23060D                                          204   1e-60   
ref|XP_010421123.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    204   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006399319.1|  hypothetical protein EUTSA_v10013993mg             204   1e-60   Eutrema salsugineum [saltwater cress]
ref|XP_009125723.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    203   1e-60   Brassica rapa
ref|XP_010493442.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    203   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008788992.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    203   1e-60   Phoenix dactylifera
ref|XP_010087141.1|  Succinyl-CoA ligase [ADP-forming] subunit al...    201   1e-60   
ref|XP_004958125.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    203   2e-60   Setaria italica
emb|CDX78333.1|  BnaA03g02450D                                          203   2e-60   
gb|KDP45810.1|  hypothetical protein JCGZ_17417                         203   2e-60   Jatropha curcas
ref|NP_001136494.1|  succinyl-CoA ligase alpha-chain 2                  202   2e-60   Zea mays [maize]
sp|Q6ZL94.1|SUCA_ORYSJ  RecName: Full=Probable succinyl-CoA ligas...    202   2e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011022031.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    202   3e-60   Populus euphratica
ref|XP_011003681.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    203   3e-60   Populus euphratica
gb|KFK27646.1|  hypothetical protein AALP_AA8G410300                    202   3e-60   Arabis alpina [alpine rockcress]
ref|XP_011047755.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    202   3e-60   Populus euphratica
ref|XP_002268479.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    202   3e-60   Vitis vinifera
ref|XP_010454606.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    202   3e-60   Camelina sativa [gold-of-pleasure]
emb|CDY21531.1|  BnaC09g47610D                                          202   4e-60   Brassica napus [oilseed rape]
ref|XP_002872045.1|  hypothetical protein ARALYDRAFT_489184             202   4e-60   
emb|CBI35274.3|  unnamed protein product                                202   4e-60   Vitis vinifera
ref|NP_001119263.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    200   5e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131054.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    202   6e-60   Brassica rapa
gb|KCW57893.1|  hypothetical protein EUGRSUZ_H00643                     199   7e-60   Eucalyptus grandis [rose gum]
gb|AAM65450.1|  succinyl-CoA synthetase, alpha subunit                  201   8e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197716.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha-2     201   8e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KDP45811.1|  hypothetical protein JCGZ_17418                         201   9e-60   Jatropha curcas
ref|XP_010069514.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    201   1e-59   Eucalyptus grandis [rose gum]
ref|XP_002307162.2|  hypothetical protein POPTR_0005s09370g             201   1e-59   
gb|ABK95068.1|  unknown                                                 201   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_004515280.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    200   1e-59   Cicer arietinum [garbanzo]
ref|XP_009389047.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    201   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO46157.1|  hypothetical protein CISIN_1g030169mg                   195   2e-59   Citrus sinensis [apfelsine]
ref|XP_010688675.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    201   2e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009122444.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    201   2e-59   Brassica rapa
dbj|BAJ94034.1|  predicted protein                                      200   2e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03449.1|  predicted protein                                      199   3e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT17065.1|  Putative succinyl-CoA ligase (GDP-forming) subuni...    200   3e-59   
ref|XP_004172973.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    194   3e-59   
gb|ACG31861.1|  succinyl-CoA ligase alpha-chain 2                       199   3e-59   Zea mays [maize]
ref|XP_008796686.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    199   4e-59   Phoenix dactylifera
ref|NP_001149702.1|  succinyl-CoA ligase alpha-chain 2                  199   4e-59   Zea mays [maize]
gb|AGT16123.1|  succinyl-CoA ligase                                     202   7e-59   Saccharum hybrid cultivar R570
ref|XP_002964011.1|  hypothetical protein SELMODRAFT_405593             192   7e-59   
ref|XP_004299462.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    199   7e-59   Fragaria vesca subsp. vesca
ref|XP_010546242.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    199   9e-59   Tarenaya hassleriana [spider flower]
ref|XP_006394390.1|  hypothetical protein EUTSA_v10003962mg             203   2e-58   Eutrema salsugineum [saltwater cress]
ref|XP_002967911.1|  hypothetical protein SELMODRAFT_408824             191   2e-58   
ref|XP_010241497.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    197   2e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010031908.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    197   4e-58   Eucalyptus grandis [rose gum]
gb|ABK94372.1|  unknown                                                 196   6e-58   Populus trichocarpa [western balsam poplar]
emb|CAA48891.1|  succinate--CoA ligase (GDP-forming)                    196   6e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658733.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    194   1e-57   Oryza brachyantha
gb|KDO46156.1|  hypothetical protein CISIN_1g030169mg                   191   1e-57   Citrus sinensis [apfelsine]
gb|KHN23614.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    195   3e-57   Glycine soja [wild soybean]
ref|XP_006376608.1|  hypothetical protein POPTR_0012s00920g             192   4e-57   
ref|XP_001765853.1|  predicted protein                                  192   1e-56   
tpg|DAA41209.1|  TPA: hypothetical protein ZEAMMB73_389921              186   2e-56   
emb|CAN73796.1|  hypothetical protein VITISV_018824                     194   8e-56   Vitis vinifera
ref|XP_001762925.1|  predicted protein                                  189   2e-55   
ref|XP_010923343.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    186   4e-54   Elaeis guineensis
gb|KDD74604.1|  hypothetical protein H632_c1190p0                       184   2e-53   Helicosporidium sp. ATCC 50920
gb|KHN24503.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    183   9e-53   Glycine soja [wild soybean]
ref|XP_002507022.1|  succinate-coa ligase                               182   1e-52   Micromonas commoda
ref|XP_001693108.1|  succinyl-coa ligase alpha chain                    182   2e-52   Chlamydomonas reinhardtii
ref|XP_002957241.1|  succinate-coa ligase alpha chain, succinyl-C...    181   3e-52   Volvox carteri f. nagariensis
emb|CDY44764.1|  BnaC02g01230D                                          181   4e-52   Brassica napus [oilseed rape]
ref|XP_003078495.1|  putative succinyl-CoA ligase alpha subunit (...    181   4e-52   Ostreococcus tauri
gb|KIY97057.1|  succinyl-CoA synthetase alpha subunit                   174   5e-51   Monoraphidium neglectum
ref|XP_003054766.1|  predicted protein                                  173   3e-49   Micromonas pusilla CCMP1545
ref|XP_001416813.1|  predicted protein                                  173   4e-49   Ostreococcus lucimarinus CCE9901
ref|XP_005643816.1|  succinyl-CoA ligase alpha chain                    171   2e-48   Coccomyxa subellipsoidea C-169
ref|XP_007512066.1|  predicted protein                                  171   1e-47   Bathycoccus prasinos
ref|XP_001780609.1|  predicted protein                                  164   1e-45   
ref|XP_006376690.1|  hypothetical protein POPTR_0012s033102g            158   1e-45   
ref|WP_022728556.1|  succinyl-CoA synthetase subsunit alpha             162   2e-45   Fodinicurvata sediminis
ref|WP_026988416.1|  succinate--CoA ligase                              162   2e-45   Fodinicurvata fenggangensis
gb|KDO21510.1|  succinyl-CoA ligase subunit alpha                       163   3e-45   Saprolegnia parasitica CBS 223.65
gb|EDK99001.1|  succinate-CoA ligase, GDP-forming, alpha subunit,...    157   3e-45   Mus musculus [mouse]
dbj|GAM28077.1|  hypothetical protein SAMD00019534_112530               162   5e-45   Acytostelium subglobosum LB1
ref|XP_009524111.1|  hypothetical protein PHYSODRAFT_557468             162   5e-45   Phytophthora sojae
ref|XP_004920729.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   5e-45   
ref|WP_015466944.1|  Succinyl-CoA ligase [ADP-forming] alpha chain      161   8e-45   Micavibrio aeruginosavorus
ref|XP_004351803.1|  succinate-CoA ligase                               161   1e-44   Cavenderia fasciculata
ref|XP_008608930.1|  succinyl-CoA ligase [GDP-forming] subunit al...    161   2e-44   Saprolegnia diclina VS20
ref|WP_035251770.1|  succinate--CoA ligase                              160   2e-44   Actibacterium atlanticum
dbj|BAC40634.1|  unnamed protein product                                161   2e-44   Mus musculus [mouse]
dbj|BAB22331.1|  unnamed protein product                                161   2e-44   Mus musculus [mouse]
dbj|BAB23804.1|  unnamed protein product                                161   2e-44   Mus musculus [mouse]
gb|AAD33927.2|AF144101_1  succinyl-CoA synthetase                       161   2e-44   Mus musculus [mouse]
emb|CEN55653.1|  succinyl-CoA synthetase alpha chain                    160   2e-44   Candidatus Methylopumilus turicensis
ref|WP_043744920.1|  succinate--CoA ligase                              160   2e-44   Pseudooceanicola atlanticus
ref|NP_063932.2|  succinyl-CoA ligase [ADP/GDP-forming] subunit a...    161   3e-44   Mus musculus [mouse]
ref|WP_038463120.1|  succinate--CoA ligase                              160   3e-44   Candidatus Paracaedibacter acanthamoebae
ref|XP_008905429.1|  succinyl-CoA ligase [GDP-forming] subunit al...    160   4e-44   Phytophthora parasitica INRA-310
ref|WP_023386589.1|  succinyl-CoA synthetase subsunit alpha             159   4e-44   Anaplasma marginale
ref|WP_014102208.1|  succinyl-CoA synthetase subsunit alpha             159   4e-44   Micavibrio aeruginosavorus
ref|WP_010137369.1|  succinyl-CoA synthetase subsunit alpha             159   4e-44   Oceanicola sp. S124
ref|WP_009540580.1|  Succinyl-CoA ligase [ADP-forming] alpha chain      159   5e-44   Caenispirillum salinarum
ref|WP_022731741.1|  succinyl-CoA synthetase subsunit alpha             159   5e-44   Thalassospira
ref|XP_002908607.1|  succinyl-CoA ligase subunit alpha, mitochond...    160   6e-44   Phytophthora infestans T30-4
ref|WP_036634769.1|  succinate--CoA ligase                              159   6e-44   Paenirhodobacter enshiensis
ref|WP_010263012.1|  succinyl-CoA ligase chain A (sucD)                 159   7e-44   Anaplasma marginale
gb|ACO52022.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    159   8e-44   Rana catesbeiana [bullfrog]
ref|WP_002721254.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    158   9e-44   Rhodobacter
ref|XP_004415607.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   1e-43   Odobenus rosmarus divergens
ref|XP_009182789.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   1e-43   Papio anubis [baboon]
ref|NP_001270301.1|  uncharacterized protein LOC101867049               159   1e-43   Macaca fascicularis [crab eating macaque]
gb|ETP44985.1|  succinyl-CoA ligase [GDP-forming] subunit alpha, ...    159   1e-43   Phytophthora parasitica P10297
ref|XP_003282290.2|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   1e-43   Nomascus leucogenys [White-cheeked Gibbon]
gb|EGV93208.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    159   1e-43   Cricetulus griseus [Chinese hamsters]
emb|CCA20859.1|  unnamed protein product                                159   1e-43   Albugo laibachii Nc14
ref|NP_001025589.1|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    159   1e-43   Xenopus tropicalis [western clawed frog]
ref|WP_038066282.1|  succinate--CoA ligase                              157   2e-43   Thioclava dalianensis
ref|WP_028287755.1|  succinate--CoA ligase                              157   2e-43   Pseudooceanicola nanhaiensis
ref|XP_003294260.1|  succinyl coenzyme A synthetase alpha subunit       158   2e-43   Dictyostelium purpureum
ref|WP_011907146.1|  succinyl-CoA synthetase subsunit alpha             157   2e-43   Rhodobacter
ref|XP_007625515.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   2e-43   
ref|XP_003505683.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   2e-43   Cricetulus griseus [Chinese hamsters]
ref|WP_010267151.1|  succinyl-CoA synthetase subsunit alpha             157   2e-43   Anaplasma
gb|ABW76150.1|  succinyl-CoA synthetase alpha subunit                   158   2e-43   Blastocystis sp. ATCC 50177/Nand II
ref|WP_012880976.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    157   3e-43   Anaplasma
gb|KIX19593.1|  succinate--CoA ligase                                   157   3e-43   Paracoccus sp. 228
ref|WP_042245435.1|  succinate--CoA ligase                              157   3e-43   Paracoccus sp. PAMC 22219
ref|WP_033444427.1|  succinate--CoA ligase                              157   3e-43   
ref|WP_009605554.1|  succinyl-CoA synthetase subsunit alpha             157   3e-43   SAR116 cluster alpha proteobacterium HIMB100
dbj|BAH12424.1|  unnamed protein product                                155   3e-43   Homo sapiens [man]
emb|CCI47059.1|  unnamed protein product                                157   3e-43   Albugo candida
emb|CCI47060.1|  unnamed protein product                                157   3e-43   Albugo candida
ref|XP_010077723.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   3e-43   Pterocles gutturalis
gb|KFP25909.1|  hypothetical protein N325_08777                         153   4e-43   Colius striatus
gb|EAQ24007.1|  succinyl-CoA synthase, alpha subunit                    152   5e-43   Roseovarius sp. 217
ref|WP_035260183.1|  succinate--CoA ligase                              156   5e-43   Actibacterium mucosum
ref|XP_004660591.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    157   5e-43   Jaculus jaculus
ref|XP_007536491.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    156   6e-43   Erinaceus europaeus [common hedgehog]
ref|WP_038144207.1|  succinate--CoA ligase                              156   6e-43   Thioclava atlantica
ref|XP_010201069.1|  PREDICTED: LOW QUALITY PROTEIN: succinyl-CoA...    152   6e-43   Colius striatus
ref|WP_009507065.1|  succinyl-CoA synthetase subsunit alpha             156   6e-43   Rhodobacteraceae
ref|XP_011398589.1|  Succinyl-CoA ligase [ADP-forming] subunit al...    157   6e-43   Auxenochlorella protothecoides
ref|XP_004742358.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    157   6e-43   Mustela putorius furo [black ferret]
ref|XP_010366218.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    157   7e-43   Rhinopithecus roxellana
ref|XP_011227722.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    159   7e-43   
gb|ERE66319.1|  succinyl-CoA ligase [GDP-forming] subunit alpha         157   7e-43   Cricetulus griseus [Chinese hamsters]
ref|XP_008698280.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    157   8e-43   Ursus maritimus [white bear]
ref|XP_003420463.2|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    157   9e-43   
ref|WP_041873600.1|  succinate--CoA ligase                              155   9e-43   
ref|WP_018985877.1|  hypothetical protein                               155   1e-42   Methylophilus methylotrophus
ref|WP_044152630.1|  succinate--CoA ligase                              155   1e-42   Anaplasma phagocytophilum [agent of human granulocytic ehrlichiosis]
ref|WP_015092761.1|  succinyl-CoA synthetase subunit alpha              155   1e-42   Bdellovibrio bacteriovorus
ref|XP_002289446.1|  precursor of synthetase                            155   1e-42   Thalassiosira pseudonana CCMP1335
ref|XP_005843440.1|  hypothetical protein CHLNCDRAFT_141133             156   1e-42   Chlorella variabilis
ref|XP_007968242.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    158   1e-42   Chlorocebus sabaeus
ref|WP_014241630.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   Azospirillum brasilense
ref|WP_038528120.1|  succinate--CoA ligase                              155   1e-42   Azospirillum brasilense
ref|WP_021693117.1|  succinyl-CoA ligase [ADP-forming] alpha chain      155   1e-42   Limimaricola cinnabarinus
ref|WP_021799836.1|  succinyl-CoA synthetase, alpha subunit             155   1e-42   Anaplasma phagocytophilum [agent of human granulocytic ehrlichiosis]
ref|WP_020849415.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   Anaplasma phagocytophilum [agent of human granulocytic ehrlichiosis]
ref|WP_011451122.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   Anaplasma phagocytophilum [agent of human granulocytic ehrlichiosis]
ref|WP_011166112.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   Bdellovibrio bacteriovorus
ref|WP_036561342.1|  succinate--CoA ligase                              155   1e-42   Oceanicola sp. MCTG156(1a)
gb|AAA85724.1|  succinyl coenzyme A synthetase alpha subunit            155   1e-42   Dictyostelium discoideum AX2
ref|WP_006035775.1|  succinyl-CoA synthetase subunit alpha              155   1e-42   Rickettsiella grylli
ref|WP_020401362.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   Kordiimonas gwangyangensis
ref|WP_020038867.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   Salipiger mucosus
ref|XP_005837665.1|  hypothetical protein GUITHDRAFT_157241             155   1e-42   Guillardia theta CCMP2712
ref|WP_044105250.1|  succinate--CoA ligase                              155   1e-42   Anaplasma phagocytophilum [agent of human granulocytic ehrlichiosis]
ref|WP_014415904.1|  succinyl-CoA synthetase subsunit alpha             155   1e-42   Pararhodospirillum photometricum
ref|XP_001082705.2|  PREDICTED: succinyl-CoA ligase [GDP-forming]...    157   1e-42   
ref|WP_038450336.1|  succinate--CoA ligase                              155   2e-42   Bdellovibrio bacteriovorus
ref|XP_008167941.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   2e-42   Chrysemys picta bellii
gb|KDB02198.1|  succinyl-CoA synthetase subsunit alpha                  155   2e-42   Defluviimonas sp. 20V17
ref|WP_043870886.1|  succinate--CoA ligase                              155   2e-42   Celeribacter indicus
ref|WP_039523079.1|  succinate--CoA ligase                              155   2e-42   Ruegeria sp. ANG-S4
ref|XP_004742357.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    156   2e-42   
ref|WP_008756783.1|  succinyl-CoA synthetase subsunit alpha             155   2e-42   Rhodobacteraceae bacterium KLH11
ref|XP_007470656.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    156   2e-42   Lipotes vexillifer [baiji]
ref|WP_027256408.1|  succinate--CoA ligase                              155   2e-42   Leisingera aquimarina
ref|WP_037260544.1|  succinate--CoA ligase                              155   2e-42   Roseivivax halodurans
ref|XP_636263.1|  succinate-CoA ligase                                  155   2e-42   Dictyostelium discoideum AX4
gb|KFP67749.1|  hypothetical protein N322_02167                         151   2e-42   Cariama cristata
ref|WP_020951286.1|  succinyl-CoA synthetase, subunit alpha             155   2e-42   Paracoccus aminophilus
ref|XP_005292517.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   2e-42   Chrysemys picta bellii
ref|WP_025311911.1|  succinate--CoA ligase                              155   2e-42   Roseibacterium elongatum
ref|WP_028718094.1|  succinate--CoA ligase                              155   2e-42   Paracoccus yeei
ref|WP_012567360.1|  succinyl-CoA synthetase subsunit alpha             154   2e-42   Rhodospirillum centenum
ref|XP_002757610.3|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    156   2e-42   Callithrix jacchus [common marmoset]
ref|WP_029148401.1|  succinyl-CoA synthetase subunit alpha              155   2e-42   Methylophilus sp. 5
ref|NP_001126825.1|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    156   2e-42   Pongo abelii [orang utan]
ref|XP_005292518.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   2e-42   Chrysemys picta bellii
ref|XP_001164971.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    156   2e-42   
ref|WP_028879580.1|  succinate--CoA ligase                              154   3e-42   Terasakiella pusilla
ref|XP_007118275.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   3e-42   Physeter catodon
ref|XP_003816644.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   3e-42   Pan paniscus [bonobo]
gb|AAH00504.1|  SUCLG1 protein                                          155   3e-42   Homo sapiens [man]
ref|WP_028093273.1|  succinate--CoA ligase                              154   3e-42   Pseudodonghicola xiamenensis
dbj|BAG36098.1|  unnamed protein product                                155   3e-42   Homo sapiens [man]
ref|XP_004995026.1|  succinyl-CoA ligase subunit alpha                  155   3e-42   Salpingoeca rosetta
gb|EFB17847.1|  hypothetical protein PANDA_011931                       155   3e-42   Ailuropoda melanoleuca
dbj|BAF83771.1|  unnamed protein product                                155   3e-42   Homo sapiens [man]
ref|XP_005292516.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   3e-42   
ref|WP_007793465.1|  succinyl-CoA synthetase subsunit alpha             154   3e-42   Salipiger bermudensis
ref|WP_011046107.1|  succinyl-CoA synthetase subsunit alpha             154   3e-42   Ruegeria pomeroyi
ref|WP_040963597.1|  succinate--CoA ligase                              154   3e-42   Erythrobacter vulgaris
ref|XP_009580012.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    151   3e-42   Fulmarus glacialis
ref|NP_003840.2|  succinyl-CoA ligase [ADP/GDP-forming] subunit a...    155   3e-42   Homo sapiens [man]
ref|WP_029007879.1|  succinate--CoA ligase                              154   3e-42   Azospirillum halopraeferens
ref|XP_002180696.1|  ligase succinate-coa ligase                        154   4e-42   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_008943061.1|  succinyl-CoA synthetase subsunit alpha             154   4e-42   Oceanibaculum indicum
gb|KFV94110.1|  hypothetical protein N327_08715                         151   4e-42   Fulmarus glacialis
ref|WP_037245140.1|  succinate--CoA ligase                              154   4e-42   Roseovarius sp. MCTG156(2b)
ref|XP_008698282.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    154   4e-42   Ursus maritimus [white bear]
ref|WP_024088967.1|  succinyl-CoA synthetase subsunit alpha             154   4e-42   Leisingera methylohalidivorans
ref|WP_014955396.1|  succinyl-CoA synthetase subsunit alpha             154   4e-42   alpha proteobacterium HIMB59
ref|XP_009703991.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    151   4e-42   Cariama cristata
ref|XP_004469843.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   5e-42   Dasypus novemcinctus
ref|WP_017929237.1|  succinyl-CoA synthetase subsunit alpha             154   5e-42   Limimaricola hongkongensis
ref|WP_037241186.1|  succinate--CoA ligase                              154   5e-42   Roseovarius sp. MCTG156(2b)
ref|XP_007666525.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    154   5e-42   
ref|WP_026757102.1|  succinate--CoA ligase                              154   5e-42   
ref|WP_038559016.1|  succinate--CoA ligase                              154   5e-42   
ref|WP_043842830.1|  succinate--CoA ligase                              154   5e-42   
gb|EJY75338.1|  Succinyl-CoA ligase                                     155   5e-42   
ref|WP_015816124.1|  succinyl-CoA synthetase subsunit alpha             154   6e-42   
ref|WP_028099766.1|  succinate--CoA ligase                              154   6e-42   
ref|WP_038603019.1|  succinate--CoA ligase                              153   6e-42   
ref|WP_019954638.1|  succinyl-CoA synthetase subsunit alpha             154   6e-42   
gb|KFQ48697.1|  hypothetical protein N333_04199                         154   6e-42   
emb|CBK25395.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               154   6e-42   
ref|WP_028368926.1|  succinate--CoA ligase                              153   6e-42   
ref|WP_044143234.1|  succinate--CoA ligase                              154   6e-42   
dbj|GAA49470.1|  succinyl-CoA synthetase alpha subunit                  155   6e-42   
ref|WP_029012089.1|  succinate--CoA ligase                              153   7e-42   
emb|CCQ75435.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha        153   7e-42   
gb|KFQ29616.1|  hypothetical protein N332_09956                         154   7e-42   
ref|WP_005623893.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    153   7e-42   
ref|WP_006831917.1|  succinyl-CoA synthetase subsunit alpha             153   7e-42   
dbj|GAK44301.1|  succinyl-CoA synthetase subunit alpha                  153   7e-42   
ref|WP_028028426.1|  succinate--CoA ligase                              153   8e-42   
ref|XP_008978670.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   8e-42   
ref|WP_020044584.1|  succinyl-CoA synthetase subsunit alpha             153   8e-42   
ref|WP_011386313.1|  succinyl-CoA synthetase subsunit alpha             153   8e-42   
ref|XP_010011949.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    154   8e-42   
ref|WP_009816307.1|  succinyl-CoA synthetase subsunit alpha             153   8e-42   
emb|CBK19683.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               154   8e-42   
ref|WP_008279485.1|  succinyl-CoA synthetase subsunit alpha             153   8e-42   
ref|XP_002188424.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    154   8e-42   
ref|WP_008621975.1|  succinyl-CoA synthetase subunit alpha              153   8e-42   
ref|XP_009867186.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    155   8e-42   
ref|XP_011264080.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    154   9e-42   
ref|WP_015927829.1|  succinyl-CoA synthetase subsunit alpha             153   9e-42   
ref|XP_003703951.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    154   9e-42   
ref|WP_042704211.1|  succinate--CoA ligase                              153   1e-41   
ref|WP_020184029.1|  succinyl-CoA synthetase subunit alpha              153   1e-41   
ref|WP_008333914.1|  succinyl-CoA synthetase subsunit alpha             153   1e-41   
ref|WP_022702490.1|  succinyl-CoA synthetase subsunit alpha             153   1e-41   
ref|WP_009868831.1|  COG0074: Succinyl-CoA synthetase, alpha subunit    153   1e-41   
gb|KFV41379.1|  hypothetical protein N341_08030                         153   1e-41   
ref|WP_025223907.1|  succinyl-CoA synthetase subunit alpha              153   1e-41   
ref|WP_025046607.1|  succinate--CoA ligase                              153   1e-41   
ref|XP_009441016.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    154   1e-41   
ref|WP_024929657.1|  succinyl-CoA synthetase subunit alpha              153   1e-41   
ref|WP_043767739.1|  succinate--CoA ligase                              153   1e-41   
ref|WP_012110353.1|  succinyl-CoA synthetase subsunit alpha             152   1e-41   
ref|WP_019881664.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    153   1e-41   
gb|KFV11936.1|  hypothetical protein N339_07129                         150   1e-41   
ref|XP_009973222.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    153   1e-41   
ref|WP_005858958.1|  succinyl-CoA synthetase subsunit alpha             152   1e-41   
ref|XP_010400527.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    154   1e-41   
emb|CBK23557.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               153   1e-41   
gb|AAR10196.1|  similar to Drosophila melanogaster Scsalpha             149   1e-41   
ref|WP_011451650.1|  succinyl-CoA synthetase subsunit alpha             152   1e-41   
gb|KFP86029.1|  hypothetical protein N310_03661                         153   1e-41   
gb|KFQ26276.1|  hypothetical protein N331_02825                         153   1e-41   
ref|WP_007668230.1|  succinyl-CoA synthetase subsunit alpha             152   1e-41   
ref|WP_011444840.1|  succinyl-CoA synthetase subsunit alpha             152   2e-41   
gb|ACR08641.1|  succinyl coenzyme A synthetase alpha subunit            150   2e-41   
ref|WP_037316727.1|  succinate--CoA ligase                              152   2e-41   
ref|WP_019078601.1|  succinyl-CoA synthetase subsunit alpha             150   2e-41   
gb|KFV12475.1|  hypothetical protein N340_07169                         152   2e-41   
ref|WP_020167923.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    152   2e-41   
ref|WP_035845955.1|  succinate--CoA ligase                              152   2e-41   
gb|AAD17940.2|  succinyl-CoA synthetase alpha subunit                   153   2e-41   
ref|WP_026738980.1|  succinyl-CoA synthetase subunit alpha              152   2e-41   
ref|WP_043136337.1|  succinate--CoA ligase                              152   2e-41   
ref|WP_043971047.1|  succinate--CoA ligase                              152   2e-41   
ref|WP_035707938.1|  succinate--CoA ligase                              152   2e-41   
ref|WP_007089205.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    152   2e-41   
ref|WP_013147499.1|  succinyl-CoA synthetase subunit alpha              152   2e-41   
ref|WP_012453497.1|  succinyl-CoA synthetase subsunit alpha             152   2e-41   
gb|KFP54334.1|  hypothetical protein N323_03013                         152   2e-41   
ref|XP_010193104.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    153   2e-41   
ref|XP_008934823.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   2e-41   
ref|WP_020593000.1|  succinyl-CoA synthetase subsunit alpha             152   2e-41   
ref|WP_017485063.1|  succinyl-CoA synthetase subsunit alpha             152   2e-41   
ref|WP_038035751.1|  hypothetical protein                               152   2e-41   
ref|WP_019645135.1|  succinyl-CoA synthetase subsunit alpha             152   2e-41   
ref|WP_008107768.1|  succinyl-CoA synthetase subunit alpha              152   2e-41   
ref|WP_014188059.1|  succinyl-CoA synthetase subsunit alpha             152   2e-41   
ref|WP_012520721.1|  succinyl-CoA synthetase subsunit alpha             152   2e-41   
ref|WP_025061191.1|  succinate--CoA ligase                              152   2e-41   
gb|KFO72513.1|  hypothetical protein N303_09556                         152   2e-41   
ref|WP_009573389.1|  succinyl-CoA synthetase subsunit alpha             152   2e-41   
dbj|BAQ15578.1|  succinyl-CoA ligase [ADP-forming] alpha chain          152   2e-41   
ref|WP_027287415.1|  succinate--CoA ligase                              152   2e-41   
ref|WP_008031582.1|  succinyl-CoA synthetase subsunit alpha             152   2e-41   
gb|KGL77224.1|  hypothetical protein N309_04286                         150   2e-41   
ref|WP_010443702.1|  succinyl-CoA synthetase subsunit alpha             152   2e-41   
ref|XP_008871215.1|  succinyl-CoA ligase [GDP-forming] subunit al...    152   3e-41   
ref|XP_002610474.1|  hypothetical protein BRAFLDRAFT_124275             152   3e-41   
ref|WP_033068019.1|  succinate--CoA ligase                              152   3e-41   
ref|WP_025527854.1|  succinate--CoA ligase                              152   3e-41   
ref|XP_009469990.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    154   3e-41   
ref|XP_009979329.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   3e-41   
ref|WP_036299997.1|  succinyl-CoA synthetase subunit alpha              152   3e-41   
ref|XP_009078515.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   3e-41   
ref|WP_010597146.1|  succinyl-CoA synthetase subunit alpha              152   3e-41   
ref|WP_041861374.1|  succinate--CoA ligase                              152   3e-41   
ref|WP_011542514.1|  succinyl-CoA synthetase subsunit alpha             152   3e-41   
ref|WP_043354951.1|  MULTISPECIES: succinate--CoA ligase                152   3e-41   
ref|WP_044827266.1|  succinate--CoA ligase                              152   3e-41   
ref|WP_018304231.1|  succinyl-CoA synthetase subsunit alpha             152   3e-41   
ref|WP_009829525.1|  succinyl-CoA synthetase subsunit alpha             152   3e-41   
ref|WP_037270069.1|  succinate--CoA ligase                              152   3e-41   
ref|WP_018631937.1|  succinyl-CoA synthetase subsunit alpha             151   3e-41   
ref|WP_042484035.1|  succinate--CoA ligase                              152   3e-41   
emb|CBJ28950.1|  Succinate--CoA ligase (GDP-forming), alpha subunit     152   3e-41   
ref|WP_008383363.1|  succinyl-CoA synthetase subsunit alpha             152   3e-41   
ref|WP_025422936.1|  succinyl-CoA synthetase subunit alpha              151   3e-41   
ref|XP_009495173.1|  succinyl-CoA synthetase alpha subunit              153   3e-41   
ref|WP_007206844.1|  succinyl-CoA synthetase subsunit alpha             151   3e-41   
ref|WP_035744638.1|  succinate--CoA ligase                              152   3e-41   
gb|ADE40076.1|  succinyl-CoA synthetase, alpha subunit                  152   3e-41   
gb|KFQ16420.1|  hypothetical protein N330_09883                         152   3e-41   
ref|WP_039159816.1|  succinate--CoA ligase                              151   3e-41   
ref|XP_002068543.1|  GK20526                                            152   4e-41   
ref|WP_012975782.1|  succinyl-CoA synthetase subsunit alpha             151   4e-41   
gb|KFP07084.1|  hypothetical protein N300_01855                         152   4e-41   
ref|WP_008889739.1|  succinyl-CoA synthetase subsunit alpha             151   4e-41   
gb|KFH68483.1|  succinyl-CoA synthetase alpha subunit                   152   4e-41   
ref|XP_009162469.1|  hypothetical protein T265_00432                    152   4e-41   
ref|WP_016845087.1|  hypothetical protein                               146   4e-41   
ref|WP_012975136.1|  succinyl-CoA synthetase subsunit alpha             151   4e-41   
ref|WP_017978730.1|  succinyl-CoA synthetase subsunit alpha             151   4e-41   
ref|WP_008233149.1|  succinyl-CoA synthetase subsunit alpha             151   4e-41   
ref|WP_002716246.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    151   4e-41   
ref|XP_010328278.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    154   4e-41   
ref|WP_028796070.1|  succinate--CoA ligase                              151   4e-41   
ref|XP_003799266.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   4e-41   
ref|WP_035931250.1|  succinate--CoA ligase                              151   4e-41   
ref|XP_005089238.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   4e-41   
ref|XP_004691641.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   4e-41   
ref|WP_019402728.1|  succinyl-CoA synthetase subsunit alpha             151   4e-41   
ref|WP_010393091.1|  succinyl-CoA synthetase subsunit alpha             151   4e-41   
ref|XP_005089236.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   5e-41   
ref|WP_009339098.1|  succinyl-CoA synthetase subsunit alpha             151   5e-41   
gb|KFZ46882.1|  hypothetical protein N321_00974                         152   5e-41   
ref|XP_006629220.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   5e-41   
ref|WP_008283776.1|  succinyl-CoA synthetase subunit alpha              151   5e-41   
ref|XP_003942174.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    153   5e-41   
ref|XP_010897979.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   5e-41   
gb|KFV45961.1|  hypothetical protein N328_11490                         152   5e-41   
ref|XP_008500129.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   5e-41   
ref|WP_003599893.1|  succinyl-CoA synthetase subsunit alpha             151   5e-41   
gb|EPB83091.1|  succinyl-CoA synthetase alpha subunit                   152   5e-41   
ref|WP_011537127.1|  succinyl-CoA synthetase subsunit alpha             151   5e-41   
emb|CEP12540.1|  hypothetical protein                                   152   5e-41   
ref|WP_012253228.1|  succinyl-CoA synthetase subsunit alpha             151   5e-41   
ref|WP_005978934.1|  succinyl-CoA synthetase subsunit alpha             151   5e-41   
ref|XP_008643339.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   5e-41   
ref|XP_010156265.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   5e-41   
ref|WP_010543934.1|  succinyl-CoA synthetase subsunit alpha             151   5e-41   
ref|XP_001984386.1|  GH16428                                            152   6e-41   
gb|EOA98554.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    151   6e-41   
ref|XP_002738240.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    148   6e-41   
ref|WP_037908640.1|  succinate--CoA ligase                              151   6e-41   
ref|WP_033073970.1|  succinate--CoA ligase                              151   6e-41   
ref|XP_002046562.1|  GJ12416                                            152   6e-41   
gb|KFM01765.1|  hypothetical protein AS27_01907                         151   6e-41   
ref|WP_027241512.1|  succinate--CoA ligase                              151   6e-41   
ref|WP_004274388.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    151   6e-41   
ref|WP_008993483.1|  succinyl-CoA synthetase subsunit alpha             151   6e-41   
ref|NP_001012910.1|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    152   6e-41   
ref|XP_009817926.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    151   6e-41   
ref|XP_005023343.1|  PREDICTED: LOW QUALITY PROTEIN: succinyl-CoA...    152   6e-41   
ref|XP_010164933.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    151   6e-41   
ref|XP_006128463.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    153   6e-41   
ref|WP_007255152.1|  succinyl-CoA synthetase subsunit alpha             151   7e-41   
gb|KFP16611.1|  hypothetical protein Z169_00989                         151   7e-41   
ref|WP_015822220.1|  succinyl-CoA synthetase subsunit alpha             151   7e-41   
ref|WP_025056069.1|  succinate--CoA ligase                              151   7e-41   
ref|WP_011567858.1|  succinyl-CoA synthetase subsunit alpha             151   7e-41   
ref|WP_037455602.1|  succinate--CoA ligase                              150   7e-41   
gb|KFR04514.1|  hypothetical protein Y956_09972                         151   7e-41   
ref|WP_013962963.1|  succinyl-CoA synthetase subsunit alpha             151   7e-41   
ref|WP_014873464.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    150   7e-41   
ref|WP_015493901.1|  succinyl-CoA synthetase subsunit alpha             150   7e-41   
ref|WP_026608126.1|  succinate--CoA ligase                              150   7e-41   
gb|KFQ59202.1|  hypothetical protein N334_08347                         151   7e-41   
ref|WP_011370796.1|  succinyl-CoA synthetase subunit alpha              150   7e-41   
ref|WP_008559701.1|  succinyl-CoA synthetase subsunit alpha             150   7e-41   
gb|KFW72632.1|  hypothetical protein AS28_04873                         151   7e-41   
ref|WP_009806146.1|  succinyl-CoA synthetase subsunit alpha             150   7e-41   
ref|WP_035244086.1|  succinyl-CoA synthetase subunit alpha              150   7e-41   
ref|WP_007560100.1|  succinyl-CoA synthetase subsunit alpha             150   8e-41   
gb|KFO09272.1|  hypothetical protein N312_04840                         151   8e-41   
emb|CDH53782.1|  probable succinyl-coa synthetase alpha gdp-forming     151   8e-41   
ref|WP_022708406.1|  succinyl-CoA synthetase subsunit alpha             150   8e-41   
ref|WP_007733326.1|  succinyl-CoA synthetase subsunit alpha             150   8e-41   
ref|WP_009770390.1|  succinyl-CoA synthetase subsunit alpha             150   9e-41   
ref|WP_036722309.1|  succinate--CoA ligase                              150   9e-41   
ref|WP_003041131.1|  succinyl-CoA synthetase subunit alpha              150   9e-41   
ref|WP_007812200.1|  succinyl-CoA synthetase subsunit alpha             150   9e-41   
ref|WP_042087115.1|  succinate--CoA ligase                              150   9e-41   
ref|WP_002424426.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    147   9e-41   
ref|WP_009148937.1|  succinyl-CoA synthetase subunit alpha              150   9e-41   
ref|WP_038132614.1|  succinate--CoA ligase                              150   9e-41   
ref|WP_024920207.1|  MULTISPECIES: succinate--CoA ligase                150   9e-41   
ref|WP_038077491.1|  succinate--CoA ligase                              150   9e-41   
ref|WP_039095501.1|  succinate--CoA ligase                              150   9e-41   
gb|EMC83070.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    151   9e-41   
ref|XP_005428398.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    152   9e-41   
ref|WP_006577242.1|  succinyl-CoA synthetase, alpha subunit             150   9e-41   
gb|KFP44839.1|  hypothetical protein N324_09193                         151   1e-40   
emb|CDS02808.1|  Putative Succinyl-CoA ligase                           151   1e-40   
ref|WP_013441737.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    150   1e-40   
ref|XP_009476923.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    151   1e-40   
ref|XP_003395160.1|  PREDICTED: succinyl-CoA ligase [GDP-forming]...    151   1e-40   
ref|WP_037517798.1|  succinate--CoA ligase                              150   1e-40   
ref|WP_011746903.1|  succinyl-CoA synthetase subsunit alpha             150   1e-40   
ref|WP_012317924.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    150   1e-40   
ref|WP_024081748.1|  succinyl-CoA synthetase, alpha subunit, NAD(...    150   1e-40   
ref|WP_027263300.1|  succinate--CoA ligase                              150   1e-40   
ref|WP_022571837.1|  succinyl-CoA synthetase (ADP-forming) alpha ...    150   1e-40   
ref|WP_010685286.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    150   1e-40   
ref|XP_003395161.1|  PREDICTED: succinyl-CoA ligase [GDP-forming]...    151   1e-40   
gb|KFQ01862.1|  hypothetical protein N329_10861                         150   1e-40   
ref|WP_019369769.1|  succinyl-CoA synthetase subsunit alpha             150   1e-40   
ref|WP_042671903.1|  succinate--CoA ligase                              150   1e-40   
ref|WP_007302348.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    150   1e-40   



>ref|XP_006350379.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Solanum tuberosum]
Length=337

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 141/161 (88%), Gaps = 8/161 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP----ITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGIT  247
            MA Q  RLI+N+S K+ P    I+ SPLW Q  +R FGSP P   VFVDKNTRVICQGIT
Sbjct  1    MARQATRLISNLSTKLNPSSPTISASPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQGIT  58

Query  248  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  427
            GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPPF
Sbjct  59   GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPPF  118

Query  428  agaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            A AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q++ 
Sbjct  119  AAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSRT  159



>ref|XP_009623368.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Nicotiana tomentosiformis]
Length=338

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 139/161 (86%), Gaps = 9/161 (6%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR-----PITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGI  244
            MA Q  RLIAN+S K+      P   S LWQQ  +R FGSP P   VFVDKNTRVICQGI
Sbjct  1    MARQATRLIANLSAKLNSSNPTPSASSSLWQQ--YRFFGSPPPPPAVFVDKNTRVICQGI  58

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPP
Sbjct  59   TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPP  118

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q++
Sbjct  119  FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSK  159



>ref|NP_001234574.1| succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial 
[Solanum lycopersicum]
 sp|Q6DQL1.1|SUCA2_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial; Short=SlSCoALalpha2; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAT67464.1| succinyl-CoA ligase alpha 2 subunit [Solanum lycopersicum]
Length=337

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 138/158 (87%), Gaps = 8/158 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP----ITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGIT  247
            MA Q  RLI+N+S K+ P    ++ SPLW Q  +R FGSP P   VFVDKNTRVICQGIT
Sbjct  1    MARQATRLISNLSTKLNPSSPTMSASPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQGIT  58

Query  248  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  427
            GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AK ETKANASV+YVPPPF
Sbjct  59   GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKVETKANASVVYVPPPF  118

Query  428  agaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQ  541
            A AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q
Sbjct  119  AAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQ  156



>ref|XP_006348504.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Solanum tuberosum]
Length=332

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 136/157 (87%), Gaps = 5/157 (3%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS--PAPEVFVDKNTRVICQGITGKNG  259
            MA Q  +LIAN+S K   ++ S      Q+RLFGS  P P VFVDKNTRVICQGITGKNG
Sbjct  1    MARQATKLIANLSTK---LSSSNPTLATQNRLFGSAPPPPAVFVDKNTRVICQGITGKNG  57

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AA
Sbjct  58   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAA  117

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            IME +EAELDL+VCITEGIPQHDMV+VKAALK+Q++ 
Sbjct  118  IMEGLEAELDLIVCITEGIPQHDMVRVKAALKKQSRT  154



>gb|AIS71903.1| mitochondrial succinyl-CoA ligase ADP-forming subunit alpha-2 
[Nicotiana tabacum]
Length=340

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 139/164 (85%), Gaps = 11/164 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPIT-------QSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQ  238
            MA Q  RL++ +S K+ P +        SPLW Q  +R FGSP P   VFVDKNTRVICQ
Sbjct  1    MARQATRLVSKLSSKLSPNSPTISASPSSPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQ  58

Query  239  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  418
            GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVP
Sbjct  59   GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVP  118

Query  419  PPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            PPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q++ 
Sbjct  119  PPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSKT  162



>ref|XP_009775900.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Nicotiana sylvestris]
Length=251

 Score =   224 bits (572),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 138/163 (85%), Gaps = 11/163 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPIT-------QSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQ  238
            MA Q  RL++ +S K+ P +        SPLW Q  +R FGSP P   VFVDKNTRVICQ
Sbjct  1    MARQATRLVSKLSSKLSPNSPTISASPSSPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQ  58

Query  239  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  418
            GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV +AKAETKANASV+YVP
Sbjct  59   GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVEEAKAETKANASVVYVP  118

Query  419  PPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            PPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q++
Sbjct  119  PPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSK  161



>ref|XP_009781531.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Nicotiana sylvestris]
Length=338

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 140/162 (86%), Gaps = 9/162 (6%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSP-----LWQQQQHRLFGSPAP--EVFVDKNTRVICQGI  244
            MA Q  R+IAN+S K+   + +P     LWQQ  +R FGSP P   VFVDKNTRVICQGI
Sbjct  1    MARQATRVIANLSTKLNSSSPTPSASSSLWQQ--YRFFGSPLPPPAVFVDKNTRVICQGI  58

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPP
Sbjct  59   TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPP  118

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q++ 
Sbjct  119  FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSKT  160



>emb|CDP14400.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 138/157 (88%), Gaps = 6/157 (4%)
 Frame = +2

Query  86   MAWQTAR-LIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKN  256
            MA QT + LI N++ K   + Q+P  + QQ R FGSP P   VFVDKNTRVICQGITGKN
Sbjct  1    MARQTTKSLIGNLASK---LLQNPNGKSQQLRHFGSPPPPAAVFVDKNTRVICQGITGKN  57

Query  257  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  436
            GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA A
Sbjct  58   GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAA  117

Query  437  aimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            AIMEAMEAELDLVVCITEGIPQHDMVKVKAALK+Q++
Sbjct  118  AIMEAMEAELDLVVCITEGIPQHDMVKVKAALKKQSK  154



>ref|XP_011091459.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Sesamum indicum]
Length=330

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 133/156 (85%), Gaps = 7/156 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKNG  259
            MA    RLI N+S+++      P  + QQHR FGSP P   VFVDKNTRVICQGITGKNG
Sbjct  1    MARHATRLIGNLSRRL----LCP-KELQQHRNFGSPPPPPAVFVDKNTRVICQGITGKNG  55

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTP KGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA  A
Sbjct  56   TFHTEQAIEYGTKMVGGVTPGKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAKA  115

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            IME++EAELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  116  IMESLEAELDLVVCITEGIPQHDMVRVKAALNKQSK  151



>ref|NP_001234277.1| succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Solanum lycopersicum]
 sp|Q8GTQ9.1|SUCA1_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial; Short=SlSCoALalpha1; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAN86619.1| succinyl-CoA ligase alpha 1 subunit [Solanum lycopersicum]
Length=332

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 134/156 (86%), Gaps = 3/156 (2%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRL-FGSPAPEVFVDKNTRVICQGITGKNGT  262
            MA Q  +LIAN+SKK+   + +P  +  +  +  G+  P VFVDKNTRVICQGITGKNGT
Sbjct  1    MARQATKLIANLSKKLS--SSNPHTRCSEQTVWIGAAPPAVFVDKNTRVICQGITGKNGT  58

Query  263  FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaai  442
            FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV +AKAETKANASVIYVPPPFA AAI
Sbjct  59   FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVEEAKAETKANASVIYVPPPFAAAAI  118

Query  443  meameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ME +EAELDL+VCITEGIPQHDMV+VKAALK+Q++ 
Sbjct  119  MEGLEAELDLIVCITEGIPQHDMVRVKAALKKQSRT  154



>gb|AFL48180.1| succinyl-CoA synthetase [Capsicum annuum]
 gb|AFL48181.1| succinyl-CoA synthetase [Capsicum annuum]
Length=326

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 133/157 (85%), Gaps = 11/157 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS--PAPEVFVDKNTRVICQGITGKNG  259
            MA Q  R+I+  S K+ P          ++R FGS  P P VFVDKNTRVICQGITGKNG
Sbjct  1    MARQATRVISKWSTKLNP---------NEYRYFGSSAPPPAVFVDKNTRVICQGITGKNG  51

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPPFA AA
Sbjct  52   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPPFAAAA  111

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            IMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q++ 
Sbjct  112  IMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSRT  148



>gb|KJB79847.1| hypothetical protein B456_013G069200 [Gossypium raimondii]
Length=268

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 130/157 (83%), Gaps = 5/157 (3%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKN  256
            MA Q +RL+ ++S +        L   Q  R F +   P P VFVDKNTRVICQGITGKN
Sbjct  1    MARQASRLLRSLSSQFS--HHKSLLSPQHSRSFSAAPAPQPAVFVDKNTRVICQGITGKN  58

Query  257  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  436
            GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA  
Sbjct  59   GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAP  118

Query  437  aimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            AIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ++
Sbjct  119  AIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSK  155



>gb|KJB79846.1| hypothetical protein B456_013G069200 [Gossypium raimondii]
Length=335

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 130/157 (83%), Gaps = 5/157 (3%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKN  256
            MA Q +RL+ ++S +        L   Q  R F +   P P VFVDKNTRVICQGITGKN
Sbjct  1    MARQASRLLRSLSSQFS--HHKSLLSPQHSRSFSAAPAPQPAVFVDKNTRVICQGITGKN  58

Query  257  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  436
            GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA  
Sbjct  59   GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAP  118

Query  437  aimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            AIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ++
Sbjct  119  AIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSK  155



>gb|EYU19899.1| hypothetical protein MIMGU_mgv1a009825mg [Erythranthe guttata]
Length=330

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 132/157 (84%), Gaps = 7/157 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKNG  259
            M+ Q  RLI ++S ++      P  Q QQHR F SP P   VFVDKNTRVICQGITGKNG
Sbjct  1    MSRQATRLIHSLSSRLF----CP-KQLQQHRNFASPPPPPAVFVDKNTRVICQGITGKNG  55

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANA+VIYVPPPFA  A
Sbjct  56   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANATVIYVPPPFAAKA  115

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            IMEA+EAELDL VCITEGIPQHDM++VK+AL QQ++ 
Sbjct  116  IMEAIEAELDLAVCITEGIPQHDMIRVKSALNQQSKT  152



>gb|EPS68438.1| hypothetical protein M569_06331, partial [Genlisea aurea]
Length=329

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 131/156 (84%), Gaps = 7/156 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKNG  259
            MA Q  RLI  +S +V      P  + Q  R FGSP P   VFVDKNTRVICQGITGKNG
Sbjct  1    MARQVNRLIGQLSSRVL----CP-GRIQNSRSFGSPPPPPAVFVDKNTRVICQGITGKNG  55

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQA+EYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAET+ANASVIYVPPPFA  A
Sbjct  56   TFHTEQAVEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETRANASVIYVPPPFAAKA  115

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            I+EA+EAELDL+VCITEGIPQHDMV+VKAAL +Q++
Sbjct  116  ILEALEAELDLIVCITEGIPQHDMVRVKAALNKQSK  151



>ref|XP_010934473.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Elaeis guineensis]
Length=340

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 135/161 (84%), Gaps = 6/161 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKV----RPITQSPLWQQQQHRLFGSPAPE--VFVDKNTRVICQGIT  247
            M+ Q A+L+ +++ ++    +P   SPL  Q +     +P P   VFVDKNTRVICQGIT
Sbjct  1    MSRQAAKLVGSLASRLVSEPKPFVSSPLSSQYRRHFAAAPPPPPAVFVDKNTRVICQGIT  60

Query  248  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  427
            GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPF
Sbjct  61   GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPF  120

Query  428  agaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            A AAI+EAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++ 
Sbjct  121  AAAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKT  161



>gb|KDO52721.1| hypothetical protein CISIN_1g0195001mg, partial [Citrus sinensis]
 gb|KDO52722.1| hypothetical protein CISIN_1g0195001mg, partial [Citrus sinensis]
Length=237

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 124/145 (86%), Gaps = 3/145 (2%)
 Frame = +2

Query  122  SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYG  292
            S+ VR +  S      Q R F +   PAP VFVDKNTRVICQGITGKNGTFHTEQAIEYG
Sbjct  7    SRVVRSLYMSSEICCGQSRSFTTAPPPAPAVFVDKNTRVICQGITGKNGTFHTEQAIEYG  66

Query  293  TKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDL  472
            TKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANAS IYVPPPFA AAI+EAMEAELDL
Sbjct  67   TKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASAIYVPPPFAAAAILEAMEAELDL  126

Query  473  VVCITEGIPQHDMVKVKAALKQQNQ  547
            VVCITEGIPQHDMV+VKAAL  Q++
Sbjct  127  VVCITEGIPQHDMVRVKAALNNQSK  151



>ref|XP_002271746.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Vitis vinifera]
 emb|CBI29046.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   211 bits (538),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 129/155 (83%), Gaps = 5/155 (3%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTF  265
            M  Q  RLI  V  +++    SPL    +H    +P P VFVDKNTRVICQGITGKNGTF
Sbjct  1    MVGQVRRLIPYVVSRIK----SPLAPPSRHLGTTAP-PAVFVDKNTRVICQGITGKNGTF  55

Query  266  HTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaim  445
            HTEQAIEYGTKMVGGVTPKKGG EHLGLP+FNTVA+AKAET+ANASVIYVPPPFA AAIM
Sbjct  56   HTEQAIEYGTKMVGGVTPKKGGMEHLGLPIFNTVAEAKAETRANASVIYVPPPFAAAAIM  115

Query  446  eameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            EA+EAELDLVVCITEGIPQHDMVKVKAAL +Q++ 
Sbjct  116  EAVEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  150



>gb|KHG06820.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial 
[Gossypium arboreum]
Length=335

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPE--VFVDKNTRVICQGITGKNG  259
            MA Q +RL+ ++S +     +SPL          +PAP+  VFVDKNTRVICQGITGKNG
Sbjct  1    MARQASRLLRSLSSQFSH-RKSPLSPLHSRSFSAAPAPQPAVFVDKNTRVICQGITGKNG  59

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+A AETKANASVIYVPPPFA AA
Sbjct  60   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEANAETKANASVIYVPPPFAAAA  119

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            IMEAMEAELDLVVCITEGIPQHDMV+VK AL QQ++
Sbjct  120  IMEAMEAELDLVVCITEGIPQHDMVRVKVALNQQSK  155



>gb|KHG04322.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Gossypium arboreum]
Length=346

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 134/166 (81%), Gaps = 12/166 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1    MARQASRLIQSLSSRISPHKPQISPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            YVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ++
Sbjct  121  YVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSK  166



>ref|XP_009355925.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Pyrus x bretschneideri]
Length=334

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQA  280
            A+LI +++ + +P   + L Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQA
Sbjct  7    AKLIGSIASR-KPSLSTSLLQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQA  65

Query  281  IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeamea  460
            IEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAI+EA+EA
Sbjct  66   IEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAILEAVEA  125

Query  461  eLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ELDLVVCITEGIPQHDMV+VKAA+ +Q++ 
Sbjct  126  ELDLVVCITEGIPQHDMVRVKAAINRQSKT  155



>ref|XP_006441424.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
 gb|ESR54664.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
Length=281

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 135/168 (80%), Gaps = 15/168 (9%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  223
            MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1    MARQALAKLIGSIGSR-RPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNT  59

Query  224  RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  403
            RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  60   RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  119

Query  404  VIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            VIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  120  VIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSK  167



>ref|XP_006493424.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Citrus sinensis]
Length=347

 Score =   209 bits (533),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 135/169 (80%), Gaps = 15/169 (9%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  223
            MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1    MARQALAKLIGSIGCR-RPSTASSVSHYRLSTSAAPAAHSRYYGSSAAASQPAVFVDKNT  59

Query  224  RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  403
            RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  60   RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  119

Query  404  VIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            VIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++ 
Sbjct  120  VIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKT  168



>ref|XP_006394592.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum]
 gb|ESQ31878.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum]
Length=401

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 128/166 (77%), Gaps = 11/166 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPI--------TQSPLWQQQQHRLFGS---PAPEVFVDKNTRVI  232
            MA Q  RL+ ++S KVR          +   L    Q R FG+   P   VFVDKNTRVI
Sbjct  57   MARQVTRLLGSLSSKVRSSGGVSEVYPSCCYLTSLTQSRSFGTTPPPPAAVFVDKNTRVI  116

Query  233  CQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIY  412
            CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIY
Sbjct  117  CQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIY  176

Query  413  VPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            VP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  177  VPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQSKT  222



>ref|XP_007152547.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris]
 gb|ESW24541.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris]
Length=324

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  176  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  355
            R F S  P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPV
Sbjct  21   RQFSSATPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPV  80

Query  356  FNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            FNTVA+AKAETKANASVIYVPPPFA AAIME+MEAELDLVVCITEGIPQHDMV+VKAAL 
Sbjct  81   FNTVAEAKAETKANASVIYVPPPFAAAAIMESMEAELDLVVCITEGIPQHDMVRVKAALN  140

Query  536  QQNQN  550
            QQ++ 
Sbjct  141  QQSKT  145



>ref|XP_008375061.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Malus domestica]
Length=334

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = +2

Query  101  ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQA  280
            A+LI +++ + +P   + L Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQA
Sbjct  7    AKLIGSIASR-KPSPSTSLRQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQA  65

Query  281  IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeamea  460
            IEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAI+EA+EA
Sbjct  66   IEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAILEAVEA  125

Query  461  eLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            ELDLVVCITEGIPQHDMV+VKAA+ +Q++
Sbjct  126  ELDLVVCITEGIPQHDMVRVKAAINRQSK  154



>ref|XP_006441425.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
 gb|ESR54665.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
Length=347

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 135/168 (80%), Gaps = 15/168 (9%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  223
            MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1    MARQALAKLIGSIGSR-RPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNT  59

Query  224  RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  403
            RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  60   RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  119

Query  404  VIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            VIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  120  VIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSK  167



>ref|XP_008467310.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Cucumis melo]
Length=342

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            SP P VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V
Sbjct  43   SPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSV  102

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            A+AKAETKANASVIYVPPPFA AAI+EAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  103  AEAKAETKANASVIYVPPPFAAAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSK  162

Query  548  N  550
             
Sbjct  163  T  163



>ref|XP_002514510.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF47910.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
Length=334

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGT  262
            MA Q  A+LI +++ + +P   S   Q +Q+    SP   VFVDKNTRVICQGITGKNGT
Sbjct  1    MARQAVAKLIGSIASR-KPSLSSSAIQTRQYAAAASPPAAVFVDKNTRVICQGITGKNGT  59

Query  263  FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaai  442
            FHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAI
Sbjct  60   FHTEQAIEYGTTMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAI  119

Query  443  meameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            MEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++ 
Sbjct  120  MEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKT  155



>ref|XP_007043270.1| Succinyl-CoA ligase, alpha subunit [Theobroma cacao]
 gb|EOX99101.1| Succinyl-CoA ligase, alpha subunit [Theobroma cacao]
Length=351

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 133/171 (78%), Gaps = 17/171 (10%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------------ITQSPLWQQQQHRLFGSPAPE--VFVD  214
            MA Q +RLI ++S K+ P                + S            +PAP+  VFVD
Sbjct  1    MARQASRLIKSMSSKISPRNPQISPLSPFSSTSSSSSSSSLTLSRSFSAAPAPQPAVFVD  60

Query  215  KNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKA  394
            KNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKA
Sbjct  61   KNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKA  120

Query  395  NASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            NASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ++
Sbjct  121  NASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSK  171



>ref|XP_010423114.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Camelina sativa]
Length=343

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 129/163 (79%), Gaps = 10/163 (6%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQ  238
            M+ Q ARLI ++S K R      P  QS L    Q R F S   P   VFVDKNTRV+CQ
Sbjct  1    MSRQVARLIGSLSSKARGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTRVLCQ  59

Query  239  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  418
            GITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP
Sbjct  60   GITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVP  119

Query  419  PPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
             PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q++
Sbjct  120  APFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSK  162



>ref|XP_008240339.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Prunus mume]
Length=329

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  ARLIANV-SKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  277
            A+LI ++ S+K  P   + + Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQ
Sbjct  7    AKLIGSIASRKPSPSPSTSILQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQ  66

Query  278  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  457
            AIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAIMEAME
Sbjct  67   AIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAME  126

Query  458  aeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            AELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  127  AELDLVVCITEGIPQHDMVRVKAALNRQSK  156



>ref|XP_006374278.1| hypothetical protein POPTR_0015s056201g, partial [Populus trichocarpa]
 gb|ERP52075.1| hypothetical protein POPTR_0015s056201g, partial [Populus trichocarpa]
Length=181

 Score =   202 bits (514),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  48   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  107

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            ETKANASVIYVPPPFA AAI+EAMEAEL+LVVCITEGIPQHDMV+VKAAL +Q +
Sbjct  108  ETKANASVIYVPPPFAAAAILEAMEAELNLVVCITEGIPQHDMVRVKAALNRQTK  162



>ref|NP_001241205.1| uncharacterized protein LOC100782001 [Glycine max]
 gb|ACU24596.1| unknown [Glycine max]
Length=324

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  176  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  355
            RLF + +P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPV
Sbjct  21   RLFSAASPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPV  80

Query  356  FNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            FNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL 
Sbjct  81   FNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALN  140

Query  536  QQNQN  550
            +Q++ 
Sbjct  141  RQSKT  145



>ref|XP_006437603.1| hypothetical protein CICLE_v10032075mg [Citrus clementina]
 gb|ESR50843.1| hypothetical protein CICLE_v10032075mg [Citrus clementina]
Length=331

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 3/146 (2%)
 Frame = +2

Query  122  SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYG  292
            S+ VR +  S      Q R F +   PAP VFVDKNTRVICQGITGKNGTFHT QAIEYG
Sbjct  7    SRVVRSLYMSSEICCGQSRSFTTAPPPAPAVFVDKNTRVICQGITGKNGTFHTAQAIEYG  66

Query  293  TKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDL  472
            TKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS IYVPPPFA AAI+EAMEAELDL
Sbjct  67   TKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASAIYVPPPFAAAAILEAMEAELDL  126

Query  473  VVCITEGIPQHDMVKVKAALKQQNQN  550
            VVCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  127  VVCITEGIPQHDMVRVKAALNNQSKT  152



>ref|XP_010547709.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Tarenaya hassleriana]
Length=348

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 132/162 (81%), Gaps = 9/162 (6%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR--------PITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQG  241
            M+ Q ARL+ ++S KVR        P  +S L Q +       P P VFVDKNTRVICQG
Sbjct  1    MSRQVARLLGSLSSKVRRSGNQEVFPSCRS-LTQSRSFTAAPPPPPAVFVDKNTRVICQG  59

Query  242  ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPP  421
            ITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP 
Sbjct  60   ITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPA  119

Query  422  PFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            PFA AAIMEA+EAELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  120  PFAAAAIMEAVEAELDLVVCITEGIPQHDMVRVKAALAKQSK  161



>ref|XP_007209332.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica]
 gb|EMJ10531.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica]
Length=336

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +2

Query  101  ARLIANV-SKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  277
            A+LI ++ S+K  P   + + Q++ +    SP P VFVDKNTRVICQGITGKNGTFHTEQ
Sbjct  7    AKLIGSIASRKPSPSPSTSILQRRHYSPAPSPPPAVFVDKNTRVICQGITGKNGTFHTEQ  66

Query  278  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  457
            AIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAIMEAME
Sbjct  67   AIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAME  126

Query  458  aeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            AELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  127  AELDLVVCITEGIPQHDMVRVKAALNRQSK  156



>ref|XP_009136375.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Brassica rapa]
Length=346

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 128/167 (77%), Gaps = 12/167 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPI---------TQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            M+ Q A+L+ ++  K+R           + S L    + R FG+   P   VFVDKNTRV
Sbjct  1    MSRQVAKLVGSLPSKLRSSVASSELLYPSCSSLTSLTKSRSFGTTPPPPAAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q + 
Sbjct  121  YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQTKT  167



>emb|CDY61908.1| BnaC07g49680D [Brassica napus]
Length=345

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 127/166 (77%), Gaps = 11/166 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPI--------TQSPLWQQQQHRLFGS---PAPEVFVDKNTRVI  232
            M+ Q  RL+ ++  K+R          + S L    + R FG+   P   VFVDKNTRVI
Sbjct  1    MSRQVTRLLGSLPSKLRSSVSSSELYPSCSSLTSLTKSRSFGTTPPPPAAVFVDKNTRVI  60

Query  233  CQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIY  412
            CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIY
Sbjct  61   CQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIY  120

Query  413  VPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            VP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q + 
Sbjct  121  VPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQTKT  166



>ref|XP_009413310.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Musa acuminata subsp. malaccensis]
Length=336

 Score =   206 bits (525),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 132/157 (84%), Gaps = 2/157 (1%)
 Frame = +2

Query  86   MAWQTARLIANVSKKV--RPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNG  259
            M+ Q ++L+ +++ K+   P    P     +H     PAP VFVDKNTRVICQGITGKNG
Sbjct  1    MSRQASKLVGSLASKIFANPTPVVPSSPLSRHFAAAPPAPAVFVDKNTRVICQGITGKNG  60

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFH+EQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV++AKAETKANASVIYVPPPFA AA
Sbjct  61   TFHSEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVSEAKAETKANASVIYVPPPFAAAA  120

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            IMEA+EAELDLVVC+TEGIPQHDMV+VKAAL +Q++ 
Sbjct  121  IMEALEAELDLVVCVTEGIPQHDMVRVKAALDKQSKT  157



>ref|XP_010491456.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Camelina sativa]
Length=348

 Score =   207 bits (526),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 127/167 (76%), Gaps = 13/167 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q ARLI ++S K R          P     L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVARLIGSLSSKARRCSTGGSEVFPSCHQSLTSLTQSRSFASDPHPPAAVFVDKNTR  60

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  61   VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  120

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q++
Sbjct  121  IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSK  167



>ref|XP_010452813.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Camelina sativa]
Length=347

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 129/167 (77%), Gaps = 14/167 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q++
Sbjct  120  IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSK  166



>ref|XP_002514509.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF47909.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
Length=334

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGT  262
            MA Q  A+LI +++ + +P   S   Q +Q+    SP   VFVDKNT +ICQGITGKNGT
Sbjct  1    MARQAVAKLIGSIASR-KPSLSSSAIQTRQYAAAASPPAAVFVDKNTGLICQGITGKNGT  59

Query  263  FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaai  442
            FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAI
Sbjct  60   FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAI  119

Query  443  meameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            MEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++ 
Sbjct  120  MEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKT  155



>ref|XP_006288079.1| hypothetical protein CARUB_v10001317mg [Capsella rubella]
 gb|EOA20977.1| hypothetical protein CARUB_v10001317mg [Capsella rubella]
Length=347

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 129/168 (77%), Gaps = 14/168 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q++ 
Sbjct  120  IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSKT  167



>ref|XP_006484523.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Citrus sinensis]
Length=331

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 122/146 (84%), Gaps = 3/146 (2%)
 Frame = +2

Query  122  SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYG  292
            S+ VR +  S      Q R F +   PAP VFVDKNTRVICQGITGKNGTFHT Q IEYG
Sbjct  7    SRVVRSLYMSSEICCGQSRSFTTAPPPAPAVFVDKNTRVICQGITGKNGTFHTAQGIEYG  66

Query  293  TKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDL  472
            TKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS IYVPPPFA AAI+EAMEAELDL
Sbjct  67   TKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASAIYVPPPFAAAAILEAMEAELDL  126

Query  473  VVCITEGIPQHDMVKVKAALKQQNQN  550
            VVCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  127  VVCITEGIPQHDMVRVKAALNNQSKT  152



>ref|XP_004137529.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Cucumis sativus]
 gb|KGN64210.1| Succinyl-CoA ligase alpha 1 subunit [Cucumis sativus]
Length=342

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            SP P VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V
Sbjct  43   SPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSV  102

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            A+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  103  AEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSK  162

Query  548  N  550
             
Sbjct  163  T  163



>emb|CDX81092.1| BnaC03g03460D [Brassica napus]
Length=346

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 128/166 (77%), Gaps = 13/166 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR-----------PITQSPLWQQQQHRLFGS-PAPEVFVDKNTRV  229
            M+ Q ARLI ++S K R           P  QS L    Q R F S P   VFVDKNTRV
Sbjct  1    MSRQVARLIGSLSSKARRCSNGGGSEAFPSRQS-LSSLTQSRSFASDPPAAVFVDKNTRV  59

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            +CQGITGKNGTFHTEQAIEYGT MV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  60   MCQGITGKNGTFHTEQAIEYGTNMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  119

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            YVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q++
Sbjct  120  YVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSK  165



>ref|NP_196447.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis 
thaliana]
 sp|P68209.1|SUCA1_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha-1; Short=SCS-alpha-1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA05023.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 emb|CAC08330.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAL61940.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAM47932.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAM60889.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AED91279.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis 
thaliana]
Length=347

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 129/167 (77%), Gaps = 14/167 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKA+TKANASV
Sbjct  60   VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKADTKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q++
Sbjct  120  IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSK  166



>ref|XP_003548295.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Glycine max]
Length=325

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 122/136 (90%), Gaps = 2/136 (1%)
 Frame = +2

Query  149  SPLWQQQQH--RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPK  322
            S +  ++ H  R F + +P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPK
Sbjct  11   SSIASRRHHGLRHFSAASPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPK  70

Query  323  KGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQ  502
            KGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQ
Sbjct  71   KGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQ  130

Query  503  HDMVKVKAALKQQNQN  550
            HDMV+VKAAL +Q++ 
Sbjct  131  HDMVRVKAALNRQSKT  146



>ref|XP_008393504.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Malus domestica]
Length=334

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 130/150 (87%), Gaps = 3/150 (2%)
 Frame = +2

Query  101  ARLIANV-SKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  277
            A+LI ++ S +  P T   L Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQ
Sbjct  7    AKLIRSIASHRTSPSTS--LLQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQ  64

Query  278  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  457
            AIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAI+EA+E
Sbjct  65   AIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAILEAVE  124

Query  458  aeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            AELDLVVCITEGIPQHDMV+VKAA+ +Q++
Sbjct  125  AELDLVVCITEGIPQHDMVRVKAAINRQSK  154



>ref|XP_002871316.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47575.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 129/167 (77%), Gaps = 14/167 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKA+TKANASV
Sbjct  60   VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKADTKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q++
Sbjct  120  IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSK  166



>gb|KJB31856.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=288

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 133/166 (80%), Gaps = 12/166 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1    MARQASRLIQSLSSRISPHKPQLSPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            YVPP FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ++
Sbjct  121  YVPPAFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSK  166



>gb|KJB31854.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=261

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1    MARQASRLIQSLSSRISPHKPQLSPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            YVPP FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ++ 
Sbjct  121  YVPPAFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKT  167



>ref|XP_002460917.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
 gb|EER97438.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
Length=332

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  34   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  93

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            +AKAETKANASVIYVPPPFA AAIMEAM+AELDLVVCITEGIPQHDMVKVKAAL +Q++ 
Sbjct  94   EAKAETKANASVIYVPPPFAAAAIMEAMDAELDLVVCITEGIPQHDMVKVKAALNRQSKT  153



>gb|AFK38534.1| unknown [Medicago truncatula]
Length=216

 Score =   201 bits (510),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  149  SPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKG  328
            S +    +     +P+P V VDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKG
Sbjct  11   SSIASNNRRNFSSTPSPAVLVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKG  70

Query  329  GTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHD  508
            GTEHLGLPVFN+VA+AK ETKANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHD
Sbjct  71   GTEHLGLPVFNSVAEAKTETKANASVIYVPPPFAAAAIMEAVEAELDLVVCITEGIPQHD  130

Query  509  MVKVKAALKQQNQ  547
            MV+VKAAL +Q++
Sbjct  131  MVRVKAALNRQSK  143



>ref|XP_006288023.1| hypothetical protein CARUB_v10001256mg, partial [Capsella rubella]
 gb|EOA20921.1| hypothetical protein CARUB_v10001256mg, partial [Capsella rubella]
Length=359

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 128/165 (78%), Gaps = 11/165 (7%)
 Frame = +2

Query  86   MAWQTARLIANV-------SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVIC  235
            M+ Q  RL+ ++       S +V P   S L    Q R FG+   P   VFVDKNTRVIC
Sbjct  17   MSRQITRLLGSLRRSCGGGSSEVVPSCCS-LTSLTQSRSFGTTPPPPAAVFVDKNTRVIC  75

Query  236  QGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYV  415
            QGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYV
Sbjct  76   QGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYV  135

Query  416  PPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            P PFA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  136  PAPFAAAAIMEGIAAELDLIVCITEGIPQHDMVRVKAALNSQSKT  180



>ref|XP_003620150.1| Succinyl-CoA ligase [Medicago truncatula]
 gb|AES76368.1| succinyl-CoA ligase [ADP-forming] subunit alpha-2 [Medicago truncatula]
Length=323

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  149  SPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKG  328
            S +    +     +P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKG
Sbjct  11   SSIASNNRRNFSSTPSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKG  70

Query  329  GTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHD  508
            GTEHLGLPVFN+VA+AK ETKANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHD
Sbjct  71   GTEHLGLPVFNSVAEAKTETKANASVIYVPPPFAAAAIMEAVEAELDLVVCITEGIPQHD  130

Query  509  MVKVKAALKQQNQ  547
            MV+VKAAL +Q++
Sbjct  131  MVRVKAALNRQSK  143



>gb|KJB31855.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=275

 Score =   202 bits (514),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 133/166 (80%), Gaps = 12/166 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1    MARQASRLIQSLSSRISPHKPQLSPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            YVPP FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ++
Sbjct  121  YVPPAFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSK  166



>ref|XP_003562832.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Brachypodium distachyon]
Length=327

 Score =   204 bits (518),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            +P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+V
Sbjct  28   APSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSV  87

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            A+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q++
Sbjct  88   AEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSK  147

Query  548  N  550
             
Sbjct  148  T  148



>gb|KJB31853.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=346

 Score =   204 bits (519),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 133/166 (80%), Gaps = 12/166 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1    MARQASRLIQSLSSRISPHKPQLSPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            YVPP FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ++
Sbjct  121  YVPPAFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSK  166



>emb|CDY02216.1| BnaA03g39510D [Brassica napus]
Length=346

 Score =   204 bits (519),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 127/167 (76%), Gaps = 12/167 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPI---------TQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            M+ +  +L+ ++  K+R           + S L    + R FG+   P   VFVDKNTRV
Sbjct  1    MSRRVTKLVGSLPSKLRSSVASSELLNPSCSSLTSLTKSRSFGTTPPPPAAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVI
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q + 
Sbjct  121  YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQTKT  167



>emb|CDX69957.1| BnaA10g23060D [Brassica napus]
Length=347

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 128/168 (76%), Gaps = 14/168 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q  RL+ ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQFTRLLGSLSSKARRCSIGFSEVSPSCQS-LTSLTQSRSFASDPPPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            IYVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q++ 
Sbjct  120  IYVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKT  167



>ref|XP_010421123.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Camelina sativa]
Length=345

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 116/137 (85%), Gaps = 3/137 (2%)
 Frame = +2

Query  149  SPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTP  319
            S L    Q R FG+   P   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV GVTP
Sbjct  30   SSLTSLTQSRSFGTTPPPPAAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVAGVTP  89

Query  320  KKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIP  499
            KKGGTEHLGLPVFNTVA+AKAETKANASVIYVP PFA AAIME + AELDLVVCITEGIP
Sbjct  90   KKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAPFAAAAIMEGVAAELDLVVCITEGIP  149

Query  500  QHDMVKVKAALKQQNQN  550
            QHDMV+VKAAL  Q++ 
Sbjct  150  QHDMVRVKAALNSQSKT  166



>ref|XP_006399319.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum]
 gb|ESQ40772.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum]
Length=347

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 128/167 (77%), Gaps = 14/167 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q  RL+ ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVTRLLGSLSSKARRCSIGGSEVFPSCQS-LSSLTQSRSFASDPPPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            IYVP PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q++
Sbjct  120  IYVPAPFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSK  166



>ref|XP_009125723.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Brassica rapa]
 emb|CDY40757.1| BnaAnng06200D [Brassica napus]
Length=342

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 127/161 (79%), Gaps = 7/161 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSP----LWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  244
            M+ Q ARL+ ++S++    +       L    Q R F S   P   VFVDKNTRV+CQGI
Sbjct  1    MSRQVARLLGSLSRRCSSTSSEAIPPTLSSFTQSRSFASDPPPPAAVFVDKNTRVMCQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP P
Sbjct  61   TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPAP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            FA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q++
Sbjct  121  FAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSK  161



>ref|XP_010493442.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Camelina sativa]
Length=345

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 128/167 (77%), Gaps = 13/167 (8%)
 Frame = +2

Query  86   MAWQTARLIANV---------SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            M+ Q  RL+ ++         S+ V P + S L      R FG+   P   VFVDKNTRV
Sbjct  1    MSRQVTRLLGSLRRCSGGGGSSELVIP-SCSSLTSLTHSRSFGTTPPPPAAVFVDKNTRV  59

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVI
Sbjct  60   ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVI  119

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  120  YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQSKT  166



>ref|XP_008788992.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Phoenix dactylifera]
Length=341

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/116 (92%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  47   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  106

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ETKANASVIYVPPPFA AAI+EAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++ 
Sbjct  107  ETKANASVIYVPPPFAAAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKT  162



>ref|XP_010087141.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1 [Morus notabilis]
 gb|EXB27046.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1 [Morus notabilis]
Length=273

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  42   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKA  101

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            ETKANASVIYVPPPFA AAIMEA+EAELDLVVC+TEGIPQHDMV+VKAAL +Q++
Sbjct  102  ETKANASVIYVPPPFAAAAIMEAVEAELDLVVCVTEGIPQHDMVRVKAALNRQSK  156



>ref|XP_004958125.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Setaria italica]
Length=332

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  34   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  93

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q++ 
Sbjct  94   EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  153



>emb|CDX78333.1| BnaA03g02450D [Brassica napus]
Length=346

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 127/166 (77%), Gaps = 13/166 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR-----------PITQSPLWQQQQHRLFGS-PAPEVFVDKNTRV  229
            M  Q ARLI ++S K R           P  Q+ L    Q R F S P   VFVDKNTRV
Sbjct  1    MFRQVARLIGSLSSKARRCSSGGGSEAFPSCQT-LSSLTQSRSFASDPPAAVFVDKNTRV  59

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            +CQGITGKNGTFHTEQAIEYGT MV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  60   MCQGITGKNGTFHTEQAIEYGTNMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  119

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            YVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q++
Sbjct  120  YVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSK  165



>gb|KDP45810.1| hypothetical protein JCGZ_17417 [Jatropha curcas]
Length=339

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTR+ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  45   VFVDKNTRLICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  104

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            ETKANASVIYVPPPFA AAIMEA EAELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  105  ETKANASVIYVPPPFAAAAIMEATEAELDLVVCITEGIPQHDMVRVKAALNKQSK  159



>ref|NP_001136494.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 gb|ACF82043.1| unknown [Zea mays]
 tpg|DAA63303.1| TPA: succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=331

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q++ 
Sbjct  93   EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  152



>sp|Q6ZL94.1|SUCA_ORYSJ RecName: Full=Probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial; AltName: Full=Succinyl-CoA synthetase 
subunit alpha; Short=SCS-alpha; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAC83073.1| putative succinyl-CoA ligase alpha subunit [Oryza sativa Japonica 
Group]
 gb|EAZ40411.1| hypothetical protein OsJ_24862 [Oryza sativa Japonica Group]
 dbj|BAH01520.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTTMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q++ 
Sbjct  93   EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNKQSKT  152



>ref|XP_011022031.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Populus euphratica]
Length=331

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  37   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKA  96

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ETKANASVIYVPPPFA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAA+K+Q++ 
Sbjct  97   ETKANASVIYVPPPFAAAAILEAVEAELDLVVCITEGIPQHDMVRVKAAIKKQSKT  152



>ref|XP_011003681.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
 ref|XP_011003682.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
Length=373

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  79   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  138

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            ETKANASVIYVPPPFA AAI+EAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  139  ETKANASVIYVPPPFAAAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSK  193



>gb|KFK27646.1| hypothetical protein AALP_AA8G410300 [Arabis alpina]
Length=347

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 127/168 (76%), Gaps = 13/168 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKK----------VRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q  RL+ ++S K          V P   S L    Q R FG+   P   VFVDKNTR
Sbjct  1    MSRQVTRLLGSLSSKALRSGSSSSEVYPSCSSSLTSLTQSRSFGTTPPPPAAVFVDKNTR  60

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            VICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKA ASV
Sbjct  61   VICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKATASV  120

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            IYVP PFA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  121  IYVPAPFAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKT  168



>ref|XP_011047755.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
Length=342

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 135/163 (83%), Gaps = 10/163 (6%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRP--------ITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQ  238
            MA Q  A+L+ +++ + +P        ++ SP+ Q + +     P P VFVDKNTRVICQ
Sbjct  1    MARQAVAKLLGSIASR-KPSSATSLINLSPSPVAQTRHYAAAPPPPPAVFVDKNTRVICQ  59

Query  239  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  418
            GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAET+ANASVIYVP
Sbjct  60   GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETRANASVIYVP  119

Query  419  PPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            PPFA AAIMEAMEAEL+LVVCITEGIPQHDMV+VKAAL +Q +
Sbjct  120  PPFAAAAIMEAMEAELNLVVCITEGIPQHDMVRVKAALNRQTK  162



>ref|XP_002268479.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Vitis vinifera]
Length=340

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 129/157 (82%), Gaps = 3/157 (2%)
 Frame = +2

Query  86   MAWQTA--RLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNG  259
            MA + A  +LI +++ K+   T S   Q +       P P VFVDKNTRVICQGITGKNG
Sbjct  5    MARRAAAQQLIDSIASKLSSATASS-AQTRGFAAAAHPPPAVFVDKNTRVICQGITGKNG  63

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKAN SVIYVPPPFA AA
Sbjct  64   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANTSVIYVPPPFAAAA  123

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            IMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q + 
Sbjct  124  IMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQTKT  160



>ref|XP_010454606.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Camelina sativa]
Length=346

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 127/167 (76%), Gaps = 12/167 (7%)
 Frame = +2

Query  86   MAWQTARLIANV---------SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  229
            M+ Q  RL+ ++         S+ V   + S L    Q R FG+   P   VFVDKNTRV
Sbjct  1    MSRQVTRLLGSLRRCSGGGGSSELVVVPSCSSLTSLTQSRSFGTTHPPPAAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASV 
Sbjct  61   ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVS  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  121  YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQSKT  167



>emb|CDY21531.1| BnaC09g47610D [Brassica napus]
Length=347

 Score =   202 bits (514),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 129/167 (77%), Gaps = 14/167 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS-PAP--EVFVDKNTR  226
            M+ Q  RL+ ++S   R          P  QS L    Q R F S P+P   VFVDKNTR
Sbjct  1    MSRQVTRLLGSLSSNARRCSIGFSEVSPSCQS-LTSLTQSRSFASDPSPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            IYVP PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q++
Sbjct  120  IYVPAPFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSK  166



>ref|XP_002872045.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48304.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   202 bits (514),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 115/135 (85%), Gaps = 3/135 (2%)
 Frame = +2

Query  155  LWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKK  325
            L    Q R FG+   P   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV GVTPKK
Sbjct  26   LTSLTQSRSFGTTPPPPAAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVAGVTPKK  85

Query  326  GGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQH  505
            GGTEHLGLPVFNTVA+AKAETKANASVIYVP PFA AAIME + AELDL+VCITEGIPQH
Sbjct  86   GGTEHLGLPVFNTVAEAKAETKANASVIYVPAPFAAAAIMEGLAAELDLIVCITEGIPQH  145

Query  506  DMVKVKAALKQQNQN  550
            DMV+VKAAL  Q++ 
Sbjct  146  DMVRVKAALNSQSKT  160



>emb|CBI35274.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 129/157 (82%), Gaps = 3/157 (2%)
 Frame = +2

Query  86   MAWQTA--RLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNG  259
            MA + A  +LI +++ K+   T S   Q +       P P VFVDKNTRVICQGITGKNG
Sbjct  1    MARRAAAQQLIDSIASKLSSATASS-AQTRGFAAAAHPPPAVFVDKNTRVICQGITGKNG  59

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKAN SVIYVPPPFA AA
Sbjct  60   TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANTSVIYVPPPFAAAA  119

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            IMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q + 
Sbjct  120  IMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQTKT  156



>ref|NP_001119263.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
 gb|AED93142.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
Length=297

 Score =   200 bits (509),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 124/161 (77%), Gaps = 7/161 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQ----SPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  244
            M+ Q  RL+ ++       +       L    Q R FG+   P   VFVDKNTRVICQGI
Sbjct  1    MSRQVTRLLGSLRHSGGGCSGSSKVCSLTSLVQSRSFGTTPPPPAAVFVDKNTRVICQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVP P
Sbjct  61   TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            FA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q++
Sbjct  121  FAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSK  161



>ref|XP_009131054.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Brassica rapa]
Length=343

 Score =   202 bits (513),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 128/163 (79%), Gaps = 10/163 (6%)
 Frame = +2

Query  86   MAWQTAR-LIANVSKKVR-------PITQSPLWQQQQHRLFGS-PAPEVFVDKNTRVICQ  238
            M+ Q AR LI ++S K R       P  Q+ L    Q R F S P   VFVDKNTRV+CQ
Sbjct  1    MSRQVARRLIGSLSSKARRCSSEVFPSCQT-LSSLTQSRSFASDPPAAVFVDKNTRVMCQ  59

Query  239  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  418
            GITGKNGTFHTEQAIEYGT MV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP
Sbjct  60   GITGKNGTFHTEQAIEYGTNMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVP  119

Query  419  PPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
             PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q++
Sbjct  120  APFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSK  162



>gb|KCW57893.1| hypothetical protein EUGRSUZ_H00643 [Eucalyptus grandis]
Length=255

 Score =   199 bits (505),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK+TRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+A
Sbjct  42   PAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEA  101

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            KAETKANASV+YVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  102  KAETKANASVVYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSK  158



>gb|AAM65450.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
Length=341

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 124/162 (77%), Gaps = 7/162 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQ----SPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  244
            M+ Q  RL+ ++       +       L    Q R FG+   P   VFVDKNTRVICQGI
Sbjct  1    MSRQVTRLLGSLRHSGGGCSGSSKVCSLTSLVQSRSFGTTPPPPAAVFVDKNTRVICQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVP P
Sbjct  61   TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            FA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  121  FAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKT  162



>ref|NP_197716.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
 sp|Q8LAD2.2|SUCA2_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha-2; Short=SCS-alpha-2; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB11180.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gb|AAM12993.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gb|AAM47926.1| succinyl-CoA synthetase alpha subunit [Arabidopsis thaliana]
 gb|AED93141.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
Length=341

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 124/162 (77%), Gaps = 7/162 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQ----SPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  244
            M+ Q  RL+ ++       +       L    Q R FG+   P   VFVDKNTRVICQGI
Sbjct  1    MSRQVTRLLGSLRHSGGGCSGSSKVCSLTSLVQSRSFGTTPPPPAAVFVDKNTRVICQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVP P
Sbjct  61   TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            FA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  121  FAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKT  162



>gb|KDP45811.1| hypothetical protein JCGZ_17418 [Jatropha curcas]
Length=341

 Score =   201 bits (511),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 108/116 (93%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  47   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  106

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++ 
Sbjct  107  ETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKT  162



>ref|XP_010069514.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Eucalyptus grandis]
 gb|KCW57892.1| hypothetical protein EUGRSUZ_H00643 [Eucalyptus grandis]
Length=339

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK+TRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+A
Sbjct  42   PAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEA  101

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            KAETKANASV+YVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++ 
Sbjct  102  KAETKANASVVYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKT  159



>ref|XP_002307162.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa]
 gb|EEE94158.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa]
Length=331

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/116 (90%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V++AKA
Sbjct  37   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVSEAKA  96

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ETKANASVIYVPPPFA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAA+K+Q + 
Sbjct  97   ETKANASVIYVPPPFAAAAILEAVEAELDLVVCITEGIPQHDMVRVKAAIKKQTKT  152



>gb|ABK95068.1| unknown [Populus trichocarpa]
Length=331

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/116 (90%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V++AKA
Sbjct  37   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVSEAKA  96

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ETKANASVIYVPPPFA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAA+K+Q + 
Sbjct  97   ETKANASVIYVPPPFAAAAILEAVEAELDLVVCITEGIPQHDMVRVKAAIKKQTKT  152



>ref|XP_004515280.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Cicer arietinum]
Length=327

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFNTV++A
Sbjct  31   PAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNTVSEA  90

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            KAETKANASVIYVPPPFA AAIME++EAELDLVVCITEGIPQHDMV+VKAAL +Q++ 
Sbjct  91   KAETKANASVIYVPPPFAAAAIMESLEAELDLVVCITEGIPQHDMVRVKAALNRQSKT  148



>ref|XP_009389047.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Musa acuminata subsp. malaccensis]
Length=341

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 130/161 (81%), Gaps = 7/161 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKV--RP-----ITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGI  244
            M  Q +RLI  ++ K+  RP      + +     +       P P VFVDKNTRVICQGI
Sbjct  1    MNRQASRLIGTLASKIFSRPNPSAASSSTLSSPSRHFAAAPPPPPAVFVDKNTRVICQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPP
Sbjct  61   TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q++
Sbjct  121  FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSK  161



>gb|KDO46157.1| hypothetical protein CISIN_1g030169mg [Citrus sinensis]
Length=181

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 125/157 (80%), Gaps = 15/157 (10%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  223
            MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1    MARQALAKLIGSIGSR-RPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNT  59

Query  224  RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  403
            RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  60   RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  119

Query  404  VIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMV  514
            VIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV
Sbjct  120  VIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMV  156



>ref|XP_010688675.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=342

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 126/163 (77%), Gaps = 8/163 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQH----RLFGS----PAPEVFVDKNTRVICQG  241
            MA Q +RL+A +S K++    S            R FG+    P P VFVDK+TRVICQG
Sbjct  1    MARQASRLVATLSSKIQSPKSSISSSISSSSPKTRDFGTVARHPPPAVFVDKHTRVICQG  60

Query  242  ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPP  421
            ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLG+PVFN+VA+AK  T A ASVIYVPP
Sbjct  61   ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGVPVFNSVAEAKEATGAQASVIYVPP  120

Query  422  PFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            PFA  AIME +EAELDL+VCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  121  PFAAKAIMEGLEAELDLIVCITEGIPQHDMVRVKAALNSQSKT  163



>ref|XP_009122444.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Brassica rapa]
Length=347

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 127/166 (77%), Gaps = 12/166 (7%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPIT-----QSP----LWQQQQHRLFGS---PAPEVFVDKNTRV  229
            M+ Q  RL+ ++S   R  +      SP    L    Q R F S   P   VFVDKNTRV
Sbjct  1    MSRQVTRLLGSLSSNARRCSIGFSEVSPSCQYLTSLTQSRSFASDPPPPAAVFVDKNTRV  60

Query  230  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  409
            +CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61   MCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  410  YVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            YVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q++
Sbjct  121  YVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSK  166



>dbj|BAJ94034.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92411.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  35   VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  94

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ETKANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMVKVKAAL +Q++ 
Sbjct  95   ETKANASVIYVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  150



>dbj|BAK03449.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/116 (90%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  35   VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  94

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ETKANASVIYVPPPFA A IMEA+EAELDLVVCITEGIPQHDMVKVKAAL +Q++ 
Sbjct  95   ETKANASVIYVPPPFAAATIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  150



>gb|EMT17065.1| Putative succinyl-CoA ligase (GDP-forming) subunit alpha, mitochondrial 
[Aegilops tauschii]
Length=356

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  36   VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  95

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ETKANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMVKVKAAL +Q++ 
Sbjct  96   ETKANASVIYVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  151



>ref|XP_004172973.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Cucumis sativus]
Length=154

 Score =   194 bits (492),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            SP P VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V
Sbjct  43   SPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSV  102

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMV  514
            A+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV
Sbjct  103  AEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMV  151



>gb|ACG31861.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=320

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  26   VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  85

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ETKANASVIYVPPPFA AAIME+MEAELDLVVCITEGIPQHDMVKVKAAL +Q++ 
Sbjct  86   ETKANASVIYVPPPFAAAAIMESMEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  141



>ref|XP_008796686.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Phoenix dactylifera]
Length=340

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 134/161 (83%), Gaps = 6/161 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKV----RPITQSPLWQQQQHRLFGSPAPE--VFVDKNTRVICQGIT  247
            M+ Q ++L+ +++ K+    R    SPL  Q +     +P+P   VFVDKNTRVICQGIT
Sbjct  1    MSRQASKLVGSLASKLVSQPRFSASSPLSSQLRRHFAAAPSPPPAVFVDKNTRVICQGIT  60

Query  248  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  427
            GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPP F
Sbjct  61   GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPAF  120

Query  428  agaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            A AAI+EA+EAELDLVVCITEGIPQHDMV+VKAAL QQ++ 
Sbjct  121  AAAAILEALEAELDLVVCITEGIPQHDMVRVKAALNQQSKT  161



>ref|NP_001149702.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 gb|ACG36440.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 tpg|DAA41208.1| TPA: succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=331

 Score =   199 bits (506),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            +AKAETKANA+VIYVPPPFA AAIMEAMEAELDL VCITEGIPQHDMVKVKAAL  Q++
Sbjct  93   EAKAETKANATVIYVPPPFAAAAIMEAMEAELDLAVCITEGIPQHDMVKVKAALNSQSK  151



>gb|AGT16123.1| succinyl-CoA ligase [Saccharum hybrid cultivar R570]
Length=458

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33   PSPVVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q++ 
Sbjct  93   EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  152



>ref|XP_002964011.1| hypothetical protein SELMODRAFT_405593 [Selaginella moellendorffii]
 gb|EFJ34344.1| hypothetical protein SELMODRAFT_405593 [Selaginella moellendorffii]
Length=150

 Score =   192 bits (489),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = +2

Query  116  NVSKKVRPITQSPLWQQQQHRLFGSPA--PEVFVDKNTRVICQGITGKNGTFHTEQAIEY  289
            + ++++    +       Q R FGS A  P VFVDKNTRV+CQGITGKNGTFHTEQAIEY
Sbjct  3    SAARRIAAFVERSSSAGSQRRGFGSSASTPAVFVDKNTRVLCQGITGKNGTFHTEQAIEY  62

Query  290  GTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLD  469
            GTKMVGGVTPKKGGTEHLGLPVFN+V +AKAETKANA+VIYVPP FA AAIMEA+EAELD
Sbjct  63   GTKMVGGVTPKKGGTEHLGLPVFNSVHEAKAETKANATVIYVPPKFAAAAIMEAVEAELD  122

Query  470  LVVCITEGIPQHDM  511
            LVVCITEGIPQHDM
Sbjct  123  LVVCITEGIPQHDM  136



>ref|XP_004299462.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=337

 Score =   199 bits (505),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 132/158 (84%), Gaps = 3/158 (2%)
 Frame = +2

Query  86   MAWQT-ARLIANVS--KKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKN  256
            MA Q+ A+LI +++  K   P T +    Q++H     P P VFVDKNTRVICQGITGKN
Sbjct  1    MARQSVAKLIGSIASRKLSSPSTSTTSIIQRRHYAAAPPPPAVFVDKNTRVICQGITGKN  60

Query  257  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  436
            GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V +AKAETKANA+VIYVPPPFA A
Sbjct  61   GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVVEAKAETKANATVIYVPPPFAAA  120

Query  437  aimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            AIMEAMEAELDLVVCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  121  AIMEAMEAELDLVVCITEGIPQHDMVRVKAALNSQSKT  158



>ref|XP_010546242.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Tarenaya hassleriana]
Length=346

 Score =   199 bits (505),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 128/161 (80%), Gaps = 7/161 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQ----QQHRLF---GSPAPEVFVDKNTRVICQGI  244
            M+    RL+ ++S  VR    S ++       Q R F     P P VFVDKNTRVICQGI
Sbjct  1    MSRLVTRLLGSLSSNVRRSGNSEVFPSCPLLTQSRSFTAAPPPPPAVFVDKNTRVICQGI  60

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP P
Sbjct  61   TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPAP  120

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL  Q++
Sbjct  121  FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNSQSK  161



>ref|XP_006394390.1| hypothetical protein EUTSA_v10003962mg [Eutrema salsugineum]
 gb|ESQ31676.1| hypothetical protein EUTSA_v10003962mg [Eutrema salsugineum]
Length=539

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 128/167 (77%), Gaps = 14/167 (8%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  226
            M+ Q  RL+ ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1    MSRQVTRLLGSLSSKARRCSIGGSEVFPSCQS-LSSLTQSRSFASDPPPPAAVFVDKNTR  59

Query  227  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  406
            V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60   VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  407  IYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            IYVP PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q++
Sbjct  120  IYVPAPFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSK  166



>ref|XP_002967911.1| hypothetical protein SELMODRAFT_408824 [Selaginella moellendorffii]
 gb|EFJ31258.1| hypothetical protein SELMODRAFT_408824 [Selaginella moellendorffii]
Length=150

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = +2

Query  116  NVSKKVRPITQSPLWQQQQHRLFGSPA--PEVFVDKNTRVICQGITGKNGTFHTEQAIEY  289
            + ++++    +       Q R FGS A  P VFVDKNTRV+CQGITGKNGTFHTEQAIEY
Sbjct  3    SAARRIAAFVERSNSAGSQRRGFGSSASTPAVFVDKNTRVLCQGITGKNGTFHTEQAIEY  62

Query  290  GTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLD  469
            GTKMVGGVTPKKGGTEHLGLPVFN+V +AKAETKANA+VIYVPP FA AAIMEA+EAELD
Sbjct  63   GTKMVGGVTPKKGGTEHLGLPVFNSVHEAKAETKANATVIYVPPKFAAAAIMEAVEAELD  122

Query  470  LVVCITEGIPQHDM  511
            LVVCITEGIPQHDM
Sbjct  123  LVVCITEGIPQHDM  136



>ref|XP_010241497.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
 ref|XP_010241498.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
 ref|XP_010241499.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
Length=346

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  212  DKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETK  391
            DKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETK
Sbjct  55   DKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETK  114

Query  392  ANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMV+VKAAL +Q++ 
Sbjct  115  ANASVIYVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVRVKAALNKQSKT  167



>ref|XP_010031908.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Eucalyptus grandis]
 gb|KCW51304.1| hypothetical protein EUGRSUZ_J00864 [Eucalyptus grandis]
Length=333

 Score =   197 bits (500),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK+TRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  39   VFVDKSTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKA  98

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ETKANAS +YVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMV+VKAA+  Q++ 
Sbjct  99   ETKANASAVYVPPPFAAAAIMEAVEAELDLVVCITEGIPQHDMVRVKAAINSQSKT  154



>gb|ABK94372.1| unknown [Populus trichocarpa]
Length=331

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V++AKA
Sbjct  37   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVSEAKA  96

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            ETKANASVIYV PPFA AAI+EA+EAELDLVVCITEGIPQHD+V+VKAA+K+Q++ 
Sbjct  97   ETKANASVIYVTPPFAAAAILEAVEAELDLVVCITEGIPQHDVVRVKAAIKKQSKT  152



>emb|CAA48891.1| succinate--CoA ligase (GDP-forming) [Arabidopsis thaliana]
Length=345

 Score =   196 bits (499),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
            +VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AK
Sbjct  50   QVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAK  109

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            AETKANASVIYVP PFA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q++ 
Sbjct  110  AETKANASVIYVPAPFAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKT  166



>ref|XP_006658733.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like, partial [Oryza brachyantha]
Length=294

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +2

Query  206  FVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAE  385
            FVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKAE
Sbjct  1    FVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKAE  60

Query  386  TKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            TKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q++
Sbjct  61   TKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNKQSK  114



>gb|KDO46156.1| hypothetical protein CISIN_1g030169mg [Citrus sinensis]
Length=182

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 125/158 (79%), Gaps = 16/158 (10%)
 Frame = +2

Query  86   MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  223
            MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1    MARQALAKLIGSIGSR-RPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNT  59

Query  224  RVICQGITGKNGTFHTEQAIEYGTKMV-GGVTPKKGGTEHLGLPVFNTVADAKAETKANA  400
            RVICQGITGKNGTFHTEQAIEYGTKMV GGVTPKKGGTEHLGLPVFN+VA+AKAETKANA
Sbjct  60   RVICQGITGKNGTFHTEQAIEYGTKMVVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANA  119

Query  401  SVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMV  514
            SVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV
Sbjct  120  SVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMV  157



>gb|KHN23614.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Glycine soja]
Length=345

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 123/160 (77%), Gaps = 21/160 (13%)
 Frame = +2

Query  131  VRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGG  310
            V  +  S   ++   RLF + +P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGG
Sbjct  6    VTKLLSSIASRRHGLRLFSAASPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGG  65

Query  311  VTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITE  490
            VTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITE
Sbjct  66   VTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITE  125

Query  491  GIPQHDM---------------------VKVKAALKQQNQ  547
            GIPQHDM                     V+VKAAL +Q++
Sbjct  126  GIPQHDMASRFGILNSGEMYLAPLNGGKVRVKAALNRQSK  165



>ref|XP_006376608.1| hypothetical protein POPTR_0012s00920g [Populus trichocarpa]
 gb|ERP54405.1| hypothetical protein POPTR_0012s00920g [Populus trichocarpa]
Length=282

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  45   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  104

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMV  514
            ETKANASVIYVPPPFA AAI+EAMEAELDLVVCITEGIPQHDMV
Sbjct  105  ETKANASVIYVPPPFAAAAILEAMEAELDLVVCITEGIPQHDMV  148



>ref|XP_001765853.1| predicted protein [Physcomitrella patens]
 gb|EDQ69444.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 122/149 (82%), Gaps = 6/149 (4%)
 Frame = +2

Query  104  RLIANVSKKV-RPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQA  280
            R +A +++++ R  T S   ++Q      S  P VFVDK TRVICQGITGKNGTFHTEQA
Sbjct  2    RRVAGIARQLGRLATHSDGGRRQL-----SSRPAVFVDKTTRVICQGITGKNGTFHTEQA  56

Query  281  IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeamea  460
            I+YGT MVGGVTPKKGGTEHLGLPVFNTVA+AK ETKANASVIYVP   A  AI+EA++A
Sbjct  57   IDYGTNMVGGVTPKKGGTEHLGLPVFNTVAEAKKETKANASVIYVPASLAANAILEALDA  116

Query  461  eLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            ELDLVVCITEGIPQHDMVKVK+AL QQ++
Sbjct  117  ELDLVVCITEGIPQHDMVKVKSALLQQSK  145



>tpg|DAA41209.1| TPA: hypothetical protein ZEAMMB73_389921 [Zea mays]
Length=142

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +2

Query  191  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  370
            P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33   PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  371  DAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMV  514
            +AKAETKANA+VIYVPPPFA AAIMEAMEAELDL VCITEGIPQHDMV
Sbjct  93   EAKAETKANATVIYVPPPFAAAAIMEAMEAELDLAVCITEGIPQHDMV  140



>emb|CAN73796.1| hypothetical protein VITISV_018824 [Vitis vinifera]
Length=468

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 118/142 (83%), Gaps = 5/142 (4%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTF  265
            M  Q  RLI  V  +++    SPL    +H L  +  P VFVDKNTRVICQGITGKNGTF
Sbjct  1    MVGQVRRLIPYVVSRIK----SPLAPPSRH-LGTTAPPAVFVDKNTRVICQGITGKNGTF  55

Query  266  HTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaim  445
            HTEQAIEYGTKMVGGVTPKKGG EHLGLP+FNTVA+AKAET+ANASVIYVPPPFA AAIM
Sbjct  56   HTEQAIEYGTKMVGGVTPKKGGMEHLGLPIFNTVAEAKAETRANASVIYVPPPFAAAAIM  115

Query  446  eameaeLDLVVCITEGIPQHDM  511
            EA+EAELDLVVCITEGIPQHDM
Sbjct  116  EAVEAELDLVVCITEGIPQHDM  137



>ref|XP_001762925.1| predicted protein [Physcomitrella patens]
 gb|EDQ72130.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = +2

Query  104  RLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAI  283
            R I  +++++    Q    Q+   R   +  P VFVDK TRVICQGITGKNGTFHTEQAI
Sbjct  2    RGIGGIARQL----QRLAAQRDGARRQLTTGPAVFVDKTTRVICQGITGKNGTFHTEQAI  57

Query  284  EYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameae  463
            +YGT MVGGVTPKKGGTEHLGLPVFNTVA+AK ET+ANASVIYVP   A  AI+EA++AE
Sbjct  58   DYGTNMVGGVTPKKGGTEHLGLPVFNTVAEAKKETRANASVIYVPASLAANAILEALDAE  117

Query  464  LDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            LDLVVCITEGIPQHDMVKVK+AL QQ++
Sbjct  118  LDLVVCITEGIPQHDMVKVKSALLQQSK  145



>ref|XP_010923343.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Elaeis guineensis]
Length=340

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 135/162 (83%), Gaps = 8/162 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKV----RPITQSPLWQQQQHRLFGSPAPE---VFVDKNTRVICQGI  244
            M+ Q A+L+ +++ K+    +    SPL  Q + R FG+  P    VFVDKNTR+ICQGI
Sbjct  1    MSRQAAKLVGSLASKLVSQPKLSASSPLASQSR-RHFGAAPPPAPAVFVDKNTRIICQGI  59

Query  245  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  424
            TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAE KANASVIYVPPP
Sbjct  60   TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAEAKANASVIYVPPP  119

Query  425  FagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            FA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAAL QQ++ 
Sbjct  120  FAAAAILEALEAELDLVVCITEGIPQHDMVRVKAALNQQSKT  161



>gb|KDD74604.1| hypothetical protein H632_c1190p0 [Helicosporidium sp. ATCC 50920]
Length=326

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = +2

Query  176  RLFGS-PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLP  352
            RL+ S P P VFVDKNTRVICQG TGKNGTFH+EQA+ YGTKMVGGVTPKKGG+ HLGLP
Sbjct  24   RLYSSVPPPAVFVDKNTRVICQGFTGKNGTFHSEQAVAYGTKMVGGVTPKKGGSTHLGLP  83

Query  353  VFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            VFN+V +AK  T ANA+VIYVPPPFA AAI+EA+EAELDLVVCITEG+PQHDMV+VK AL
Sbjct  84   VFNSVREAKEATNANATVIYVPPPFAAAAILEAVEAELDLVVCITEGVPQHDMVRVKQAL  143

Query  533  KQQ  541
             + 
Sbjct  144  ARS  146



>gb|KHN24503.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Glycine soja]
Length=352

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 110/129 (85%), Gaps = 9/129 (7%)
 Frame = +2

Query  176  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  355
            RLF + +P    DK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPV
Sbjct  21   RLFSAASP----DKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPV  76

Query  356  FNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            FNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDM      L 
Sbjct  77   FNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMASRFGIL-  135

Query  536  QQNQNSSYW  562
                NS+Y+
Sbjct  136  ----NSTYF  140



>ref|XP_002507022.1| succinate-coa ligase [Micromonas sp. RCC299]
 gb|ACO68280.1| succinate-coa ligase [Micromonas sp. RCC299]
Length=326

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFV+K+T+VICQG TGKNGTFH+EQAI YGT MVGGVTPKKGGT HLGLPVFNTVA+A
Sbjct  31   PAVFVNKHTKVICQGFTGKNGTFHSEQAIAYGTNMVGGVTPKKGGTTHLGLPVFNTVAEA  90

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            KAET ANAS IYVPPPFA  AIMEAMEAE+DLVVCITEGIPQHDMV+VK AL +Q++
Sbjct  91   KAETGANASAIYVPPPFAAKAIMEAMEAEIDLVVCITEGIPQHDMVRVKQALMRQSK  147



>ref|XP_001693108.1| succinyl-coa ligase alpha chain [Chlamydomonas reinhardtii]
 ref|XP_001693109.1| succinyl-CoA ligase [Chlamydomonas reinhardtii]
 gb|EDP03134.1| succinyl-coa ligase alpha chain [Chlamydomonas reinhardtii]
 gb|EDP03135.1| succinyl-CoA ligase [Chlamydomonas reinhardtii]
Length=329

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 110/128 (86%), Gaps = 3/128 (2%)
 Frame = +2

Query  176  RLFGSPA---PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLG  346
            R F S A   P VFVDKNT+VICQG+TGKNGTFHTEQAI YGT+MVGGVTPKKGGT HLG
Sbjct  24   RGFASQAAHNPAVFVDKNTKVICQGLTGKNGTFHTEQAIAYGTQMVGGVTPKKGGTSHLG  83

Query  347  LPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKA  526
            LPVFNTVA+AKA T  +A+VIYVPPPFA  AI+EA+EAEL+LVVCITEGIPQHDMV+VK 
Sbjct  84   LPVFNTVAEAKAATGCHATVIYVPPPFAAKAILEAVEAELELVVCITEGIPQHDMVRVKK  143

Query  527  ALKQQNQN  550
            A++ Q + 
Sbjct  144  AMQGQTKT  151



>ref|XP_002957241.1| succinate-coa ligase alpha chain, succinyl-CoA synthetase mitochondrial 
precursor [Volvox carteri f. nagariensis]
 gb|EFJ41739.1| succinate-coa ligase alpha chain, succinyl-CoA synthetase mitochondrial 
precursor [Volvox carteri f. nagariensis]
Length=328

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 110/128 (86%), Gaps = 3/128 (2%)
 Frame = +2

Query  176  RLFGSPA---PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLG  346
            R F S A   P VFVDKNT+VICQGITGKNGTFHTEQAI YGT+MVGGVTPKKGG+ HLG
Sbjct  23   RGFASQAAYNPAVFVDKNTKVICQGITGKNGTFHTEQAIAYGTQMVGGVTPKKGGSTHLG  82

Query  347  LPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKA  526
            LPVFN+V +AK+ T  +ASVIYVPPPFA  AI+EA+EAELDLVVCITEGIPQHDMVKVK 
Sbjct  83   LPVFNSVKEAKSATGCHASVIYVPPPFAARAILEAVEAELDLVVCITEGIPQHDMVKVKK  142

Query  527  ALKQQNQN  550
             L++Q++ 
Sbjct  143  TLQEQSKT  150



>emb|CDY44764.1| BnaC02g01230D [Brassica napus]
Length=343

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 126/163 (77%), Gaps = 8/163 (5%)
 Frame = +2

Query  86   MAWQTARLIANVSKKVRPITQSPL-----WQQQQHRLFGS---PAPEVFVDKNTRVICQG  241
            M+ Q ARL+ ++S++    T   +         Q R F S   P   VFVDKNTRV+CQG
Sbjct  1    MSRQVARLLGSLSRRCSSTTSEAIPPTLSSLTTQSRSFASDPPPPAAVFVDKNTRVMCQG  60

Query  242  ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPP  421
            ITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAE KANASVIYVP 
Sbjct  61   ITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAEAKANASVIYVPA  120

Query  422  PFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q++ 
Sbjct  121  PFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSKT  163



>ref|XP_003078495.1| putative succinyl-CoA ligase alpha subunit (ISS) [Ostreococcus 
tauri]
 emb|CAL53236.1| Succinyl-CoA synthetase-like [Ostreococcus tauri]
Length=331

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 119/154 (77%), Gaps = 10/154 (6%)
 Frame = +2

Query  89   AWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFH  268
            A ++ R +AN       +T+S + +   +    S AP VFVD NTRVI QG TGKNGTFH
Sbjct  10   ARESQRGVANA------LTRSSIARTADY----STAPAVFVDGNTRVIVQGFTGKNGTFH  59

Query  269  TEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaime  448
            +EQAI YGTK+VGGVTPKKGGT HLGLPVF+TV +A  ETKANASVIYVPPPFA  AIME
Sbjct  60   SEQAIAYGTKVVGGVTPKKGGTTHLGLPVFDTVREAVVETKANASVIYVPPPFAAKAIME  119

Query  449  ameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            A+EAE+DLVVCITEG+PQHDMV+VK AL  Q++ 
Sbjct  120  AVEAEIDLVVCITEGVPQHDMVRVKRALMSQSKT  153



>gb|KIY97057.1| succinyl-CoA synthetase alpha subunit [Monoraphidium neglectum]
Length=188

 Score =   174 bits (440),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            +  P VFVDK T+VICQGITGKNGTFHTEQAI YGT+MVGGVTPKKGG+ HLGLP+FNTV
Sbjct  27   AAGPAVFVDKTTKVICQGITGKNGTFHTEQAIAYGTQMVGGVTPKKGGSTHLGLPIFNTV  86

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
             +AKA T   ASVIYVPPPFA AAI+EA+ AELDLVV ITEGIPQHDMVKVK  + +Q++
Sbjct  87   EEAKAATGCTASVIYVPPPFAAAAILEAVRAELDLVVAITEGIPQHDMVKVKKIMSEQSK  146

Query  548  N  550
             
Sbjct  147  T  147



>ref|XP_003054766.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60018.1| predicted protein [Micromonas pusilla CCMP1545]
Length=312

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK+T+V+ QG TGKNGTFH++QAI YGT+MVGGVTPKKGG+ HLGLPVFNTVA+A
Sbjct  17   PAVFVDKDTKVLVQGFTGKNGTFHSQQAIAYGTRMVGGVTPKKGGSTHLGLPVFNTVAEA  76

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            K  T ANAS IYVPPPFA  AI+EA+EAELDLVVCITEGIPQHDM++VK A+  Q++ 
Sbjct  77   KTATGANASAIYVPPPFAAKAILEAVEAELDLVVCITEGIPQHDMIRVKQAMMTQSKT  134



>ref|XP_001416813.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95106.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=344

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  194  APEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAD  373
            +P VFVDKNTRVI QG TGKNGTFH+EQAI YGT++VGGVTP+KGGT HL LPVF+TV +
Sbjct  48   SPAVFVDKNTRVIVQGFTGKNGTFHSEQAIAYGTQVVGGVTPRKGGTTHLNLPVFDTVRE  107

Query  374  AKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            AK  TKANASVIYVPPPFA  A+MEA+EAE++LVVCITEGIPQHDMV+VK AL  Q++ 
Sbjct  108  AKESTKANASVIYVPPPFAARAVMEAIEAEVELVVCITEGIPQHDMVRVKQALMSQSKT  166



>ref|XP_005643816.1| succinyl-CoA ligase alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE19272.1| succinyl-CoA ligase alpha chain [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
            EV  DK T+VICQG TGKNGTFH+EQAI YGT+MVGGVTPKKGGT+HLGLPVF+TV +A 
Sbjct  6    EVSEDKTTKVICQGFTGKNGTFHSEQAIAYGTQMVGGVTPKKGGTKHLGLPVFDTVKEAV  65

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
            AET A ASVIYVPPPFA  AI+E ++A LDLVVCITEGIPQHDMVKVK  LK+  
Sbjct  66   AETGATASVIYVPPPFAAKAILEGVDAGLDLVVCITEGIPQHDMVKVKKVLKESK  120



>ref|XP_007512066.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66154.1| predicted protein [Bathycoccus prasinos]
Length=391

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P+VFV+K+T+V+CQG TGKNGTFH+EQAI+YGTK+VGGVTPKKGGT HL LPVFNTV +A
Sbjct  96   PKVFVNKDTKVVCQGFTGKNGTFHSEQAIKYGTKLVGGVTPKKGGTMHLNLPVFNTVREA  155

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            K +T A+A+ IYVPPPFA +AI+EA+EAELDL+VCITEG+PQHDM++VK AL  Q+++
Sbjct  156  KEQTGASATSIYVPPPFAASAILEALEAELDLIVCITEGVPQHDMIRVKDALMSQSRS  213



>ref|XP_001780609.1| predicted protein [Physcomitrella patens]
 gb|EDQ54592.1| predicted protein [Physcomitrella patens]
Length=299

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDK TR+I QGITGKNGTFHTEQAI YGT++VGGVTP KGGT+HLGLPVFNTVA+AK 
Sbjct  6    VFVDKATRLIVQGITGKNGTFHTEQAIAYGTQVVGGVTPNKGGTQHLGLPVFNTVAEAKQ  65

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
              +ANA+VIYVPP  A  AI+EA++AELDLVVCITEGIPQ DM +VKAAL  Q++ 
Sbjct  66   GVQANATVIYVPPKMACNAILEALDAELDLVVCITEGIPQQDMARVKAALLSQSKT  121



>ref|XP_006376690.1| hypothetical protein POPTR_0012s033102g, partial [Populus trichocarpa]
 gb|ERP54487.1| hypothetical protein POPTR_0012s033102g, partial [Populus trichocarpa]
Length=137

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/75 (99%), Positives = 75/75 (100%), Gaps = 0/75 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  48   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  107

Query  383  ETKANASVIYVPPPF  427
            ETKANASVIYVPPPF
Sbjct  108  ETKANASVIYVPPPF  122



>ref|WP_022728556.1| succinyl-CoA synthetase subsunit alpha [Fodinicurvata sediminis]
Length=292

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             V VDKNTRVICQG TG  GTFH+EQAI YGT+MVGGVTP KGG++HL LPVFNTV+DA 
Sbjct  2    SVLVDKNTRVICQGFTGAQGTFHSEQAIAYGTQMVGGVTPGKGGSKHLDLPVFNTVSDAV  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
            +ET ANASVIYVPPPFA  AI+EA++  ++LVVCITEGIP  DMVKVK AL   N
Sbjct  62   SETGANASVIYVPPPFAAEAILEAIDGGIELVVCITEGIPVLDMVKVKRALADSN  116



>ref|WP_026988416.1| succinate--CoA ligase [Fodinicurvata fenggangensis]
Length=292

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             V VDKNTRVICQG TG  GTFH+EQAI YGT+MVGGVTP KGG++HL LPVFNTV+DA 
Sbjct  2    SVLVDKNTRVICQGFTGAQGTFHSEQAIAYGTQMVGGVTPGKGGSKHLDLPVFNTVSDAV  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
            +ET ANASVIYVPPPFA  AI+EA++  ++LVVCITEGIP  DMVKVK AL   N
Sbjct  62   SETGANASVIYVPPPFAADAILEAIDGGIELVVCITEGIPVLDMVKVKRALADSN  116



>gb|KDO21510.1| succinyl-CoA ligase subunit alpha [Saprolegnia parasitica CBS 
223.65]
Length=312

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +2

Query  155  LWQQQQHRLFG-SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGG  331
            + +Q +H +   S + +V+++K+T+VICQG TGK GTFH+EQAI YGT MVGGVTPKKGG
Sbjct  1    MLRQPKHAVRAMSASAKVWINKDTKVICQGFTGKQGTFHSEQAIAYGTNMVGGVTPKKGG  60

Query  332  TEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDM  511
            T HLGLPVFNTVA+AK ET+A+ASVIYVPPPF  AAI++A+EAE+ L+V ITEGIPQ DM
Sbjct  61   TTHLGLPVFNTVAEAKKETQADASVIYVPPPFCAAAIIDAIEAEIPLIVAITEGIPQQDM  120

Query  512  VKVKAALKQQN  544
            VKVK AL QQN
Sbjct  121  VKVKWALAQQN  131



>gb|EDK99001.1| succinate-CoA ligase, GDP-forming, alpha subunit, isoform CRA_b 
[Mus musculus]
Length=149

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VGG TP KGG +HLGL
Sbjct  10   RHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQKHLGL  69

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  70   PVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHR  129

Query  530  LKQQ  541
            L +Q
Sbjct  130  LTRQ  133



>dbj|GAM28077.1| hypothetical protein SAMD00019534_112530 [Acytostelium subglobosum 
LB1]
Length=320

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P V +DKNT+VICQG TGK GTFH++QAIEYGTKMVGGV+P KGG+ HL LPVFNTVADA
Sbjct  27   PYVLIDKNTKVICQGFTGKQGTFHSQQAIEYGTKMVGGVSPGKGGSTHLQLPVFNTVADA  86

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            K  T ANASVIYVPPP A AAI+EA+EAE++LVVCITEGIPQ DMV+VK+ L +Q +
Sbjct  87   KKGTGANASVIYVPPPGAAAAIIEAIEAEMELVVCITEGIPQQDMVRVKSILNRQTK  143



>ref|XP_009524111.1| hypothetical protein PHYSODRAFT_557468 [Phytophthora sojae]
 gb|EGZ21394.1| hypothetical protein PHYSODRAFT_557468 [Phytophthora sojae]
Length=316

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  19   SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  78

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            A+AK ET A+ASVIYVPPPF  A+I+EA+EAE+ LVV ITEGIPQ DMVKVK  L+ QN+
Sbjct  79   AEAKQETGADASVIYVPPPFCAASIIEAIEAEIPLVVAITEGIPQQDMVKVKWHLRNQNK  138



>ref|XP_004920729.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like, partial [Xenopus (Silurana) tropicalis]
Length=182

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 110/154 (71%), Gaps = 9/154 (6%)
 Frame = +2

Query  80   VVMAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNG  259
             + AW    L   +S +   + Q      ++H         +++DK+TRVICQG TGK G
Sbjct  2    CIGAWLRRNLCFCLSVQQNGVRQCSYTASRKH---------LYIDKDTRVICQGFTGKQG  52

Query  260  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  439
            TFH++QA+EYGTK+VGGV+P KGG+ HLGLPVFN+VA+AK  T A ASVIYVPPPFA AA
Sbjct  53   TFHSQQALEYGTKLVGGVSPGKGGSAHLGLPVFNSVAEAKEATGATASVIYVPPPFAAAA  112

Query  440  imeameaeLDLVVCITEGIPQHDMVKVKAALKQQ  541
            I EA++AE+ LVVCITEGIPQ DMV+VK  L +Q
Sbjct  113  IHEAIDAEISLVVCITEGIPQQDMVRVKHRLLRQ  146



>ref|WP_015466944.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Micavibrio aeruginosavorus]
 gb|AGH97391.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Micavibrio aeruginosavorus 
EPB]
Length=293

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVA AKA
Sbjct  3    VLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLNLPVFDTVAQAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
            ET  NASVIYVPPPFA  AI+EA++A +DL +CITEGIP  DMV+V+ AL   N
Sbjct  63   ETGCNASVIYVPPPFAADAILEAIDAGIDLAICITEGIPVLDMVRVRRALDGSN  116



>ref|XP_004351803.1| succinate-CoA ligase [Dictyostelium fasciculatum]
 gb|EGG15083.1| succinate-CoA ligase [Dictyostelium fasciculatum]
Length=320

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = +2

Query  125  KKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV  304
            KK + + +S + +Q   R + S  P V V+K+T+VICQG TGK GTFH++QAI+YGT+MV
Sbjct  2    KKRKMLARSSILRQAFVRGYAS-KPFVMVNKDTKVICQGFTGKQGTFHSQQAIDYGTQMV  60

Query  305  GGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCI  484
            GGV+P KGG++HL LPVFN+V +AK  T ANASVIYVPPP+A  AI+EA+EAE++LVVCI
Sbjct  61   GGVSPGKGGSKHLDLPVFNSVKEAKKATDANASVIYVPPPYAAQAIIEAIEAEMELVVCI  120

Query  485  TEGIPQHDMVKVKAALKQQNQ  547
            TEGIPQ DMV+VK  L +QN+
Sbjct  121  TEGIPQQDMVRVKYLLNRQNK  141



>ref|XP_008608930.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Saprolegnia diclina VS20]
 gb|EQC37410.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Saprolegnia diclina VS20]
Length=312

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = +2

Query  155  LWQQQQHRLFG-SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGG  331
            + +Q +H +   S + +V+++K+T+VICQG TGK GTFH+EQAI YGT MVGGVTPKKGG
Sbjct  1    MLRQPKHAVRAMSASAKVWINKDTKVICQGFTGKQGTFHSEQAIAYGTNMVGGVTPKKGG  60

Query  332  TEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDM  511
            T HLGLPVFNTVA+AK  T+A+ASVIYVPPPF  AAI++A+EAE+ L+V ITEGIPQ DM
Sbjct  61   TTHLGLPVFNTVAEAKTATQADASVIYVPPPFCAAAIIDAIEAEIPLIVAITEGIPQQDM  120

Query  512  VKVKAALKQQN  544
            VKVK AL QQN
Sbjct  121  VKVKWALAQQN  131



>ref|WP_035251770.1| succinate--CoA ligase [Actibacterium atlanticum]
 gb|KCV81620.1| succinyl-CoA synthetase subunit alpha [Actibacterium atlanticum]
Length=295

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + VD+NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG EHLGLPVFN+V +AKA
Sbjct  3    ILVDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGAEHLGLPVFNSVHEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            +T+ANASVIYVPPPFAG +I+EA++AE++L++CITEGIP  DM+KVK AL+     
Sbjct  63   KTEANASVIYVPPPFAGDSILEAIDAEMELIICITEGIPVLDMMKVKRALEDSKSR  118



>dbj|BAC40634.1| unnamed protein product [Mus musculus]
Length=333

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  72   GTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQN  544
            EGIPQ DMV+VK  L +Q 
Sbjct  132  EGIPQQDMVRVKHRLTRQG  150



>dbj|BAB22331.1| unnamed protein product [Mus musculus]
Length=333

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  72   GTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQN  544
            EGIPQ DMV+VK  L +Q 
Sbjct  132  EGIPQQDMVRVKHRLTRQG  150



>dbj|BAB23804.1| unnamed protein product [Mus musculus]
 gb|AAH11087.1| Succinate-CoA ligase, GDP-forming, alpha subunit [Mus musculus]
 gb|EDK99000.1| succinate-CoA ligase, GDP-forming, alpha subunit, isoform CRA_a 
[Mus musculus]
Length=333

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  72   GTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQN  544
            EGIPQ DMV+VK  L +Q 
Sbjct  132  EGIPQQDMVRVKHRLTRQG  150



>gb|AAD33927.2|AF144101_1 succinyl-CoA synthetase [Mus musculus]
Length=333

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  72   GTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQN  544
            EGIPQ DMV+VK  L +Q 
Sbjct  132  EGIPQQDMVRVKHRLTRQG  150



>emb|CEN55653.1| succinyl-CoA synthetase alpha chain [Methylophilaceae bacterium 
B1]
Length=294

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             + V+KNT+V+CQG TGK GTFH+EQA+ YGTKMVGGVTP KGG  HLGLP FNT+ DA 
Sbjct  2    SILVNKNTKVLCQGFTGKQGTFHSEQALAYGTKMVGGVTPGKGGQSHLGLPAFNTMRDAV  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
             ET ANASVIYVPPPFA  +I+EA +A +DL+VCITEGIP  DM+ VKAALK  N
Sbjct  62   RETGANASVIYVPPPFAADSILEACDAGIDLIVCITEGIPVLDMLNVKAALKANN  116



>ref|WP_043744920.1| succinate--CoA ligase [Oceanicola sp. 22II-S11g]
 gb|KGM50534.1| succinate--CoA ligase [Oceanicola sp. 22II-S11g]
Length=293

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VD+NT+VICQG+TG  GTFHTEQAI YGTKMVGGVTP KGGT HL LPVFN+V +AK 
Sbjct  3    VLVDENTKVICQGLTGSQGTFHTEQAIAYGTKMVGGVTPGKGGTTHLDLPVFNSVHEAKH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
             T+ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVKAALK     
Sbjct  63   VTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKAALKNSKSR  118



>ref|NP_063932.2| succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial 
precursor [Mus musculus]
 sp|Q9WUM5.4|SUCA_MOUSE RecName: Full=Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha; Short=SCS-alpha; Flags: Precursor [Mus musculus]
Length=346

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    +++DKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  85   GTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQN  544
            EGIPQ DMV+VK  L +Q 
Sbjct  145  EGIPQQDMVRVKHRLTRQG  163



>ref|WP_038463120.1| succinate--CoA ligase [Candidatus Paracaedibacter acanthamoebae]
 gb|AIK95740.1| succinate--CoA ligase [Candidatus Paracaedibacter acanthamoebae]
Length=306

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             + VDKNT+VICQG TGKNGTFH+EQAI YGTKMVGGVTP KGGTEHLGLPVFNTV DA 
Sbjct  2    SILVDKNTKVICQGFTGKNGTFHSEQAIAYGTKMVGGVTPGKGGTEHLGLPVFNTVGDAV  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
             +T A ASVIYVP P+A  +I+EA +A ++L+VCITEGIP  DMV+VK AL+
Sbjct  62   KKTGATASVIYVPAPYAADSILEAADAGIELIVCITEGIPVMDMVQVKRALE  113



>ref|XP_008905429.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica INRA-310]
 gb|ETI47142.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P1569]
 gb|ETK87077.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETL40492.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETL93622.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETM46890.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETN09596.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica INRA-310]
 gb|ETO75838.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P1976]
 gb|ETP16936.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica CJ01A1]
Length=318

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  21   SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  80

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
            A+AK ET A+ASVIYVPPPF  A+I+EA+EAE+ LVV ITEGIPQ DMVKVK  L+ Q+
Sbjct  81   AEAKKETGADASVIYVPPPFCAASIIEAIEAEIPLVVAITEGIPQQDMVKVKWHLRNQS  139



>ref|WP_023386589.1| succinyl-CoA synthetase subsunit alpha [Anaplasma marginale]
 gb|AGZ78618.1| succinyl-CoA synthetase subsunit alpha [Anaplasma marginale str. 
Gypsy Plains]
 gb|AGZ79469.1| succinyl-CoA synthetase subsunit alpha [Anaplasma marginale str. 
Dawn]
Length=294

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             V VDKNTRVICQG TG NGTFH+EQAI YGTKMVGGVTP KGGT HLGLPVF+TV  AK
Sbjct  2    SVLVDKNTRVICQGFTGSNGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFDTVLQAK  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
             ET+ANASVIYVP P+A  AI EA+EAE++L+VCITEGIP  DMV+VK AL
Sbjct  62   VETQANASVIYVPAPYAADAIFEAIEAEIELIVCITEGIPVLDMVQVKRAL  112



>ref|WP_014102208.1| succinyl-CoA synthetase subsunit alpha [Micavibrio aeruginosavorus]
 gb|AEP08985.1| succinyl-CoA synthetase, alpha subunit [Micavibrio aeruginosavorus 
ARL-13]
Length=293

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVA AKA
Sbjct  3    VLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLNLPVFDTVAQAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
            ET  NASVIYVPPPFA  AI+EA++A ++L +CITEGIP  DMV+V+ AL   N
Sbjct  63   ETGCNASVIYVPPPFAADAILEAIDAGIELAICITEGIPVLDMVRVRRALDGSN  116



>ref|WP_010137369.1| succinyl-CoA synthetase subsunit alpha [Oceanicola sp. S124]
Length=294

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VD+NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGTEHLGLPVF+ VA+A  
Sbjct  3    VLVDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTEHLGLPVFDGVAEAVE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
             T ANASVIYVPPPFA  +I+EA++AE+ L+VCITEGIP  DM+KVKAALK     
Sbjct  63   RTGANASVIYVPPPFAADSILEAIDAEIPLIVCITEGIPVLDMMKVKAALKNSKSR  118



>ref|WP_009540580.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Caenispirillum 
salinarum]
 gb|EKV30513.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Caenispirillum 
salinarum AK4]
Length=291

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V +D NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVADAK 
Sbjct  3    VLIDSNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVADAKE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQ  541
             T ANA+VIYVPPPFA  AI+EA++AE+DL VCITEGIP  DMVKVK AL+  
Sbjct  63   ATGANATVIYVPPPFAADAILEAIDAEMDLAVCITEGIPVLDMVKVKRALENS  115



>ref|WP_022731741.1| succinyl-CoA synthetase subsunit alpha [Thalassospira lucentensis]
Length=291

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVFNTVA+AK 
Sbjct  3    VLVDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFNTVAEAKH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
             T+ANASVIYVPPPFA  AI+EA++A+++L VCITEGIP  DMV+VK AL+  +
Sbjct  63   VTEANASVIYVPPPFAADAILEAIDAKIELAVCITEGIPVADMVRVKRALEGSS  116



>ref|XP_002908607.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor [Phytophthora 
infestans T30-4]
 gb|EEY61690.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor [Phytophthora 
infestans T30-4]
Length=339

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  42   SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  101

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
            A+AK ET A+ASVIYVPPPF  A+I+EA+EA++ LVV ITEGIPQ DMVKVK  L+ Q+
Sbjct  102  AEAKKETGADASVIYVPPPFCAASIIEAIEAKIPLVVAITEGIPQQDMVKVKWHLRNQS  160



>ref|WP_036634769.1| succinate--CoA ligase [Paenirhodobacter enshiensis]
 gb|KFI29705.1| succinate--CoA ligase [Paenirhodobacter enshiensis]
Length=295

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + +DK TRV+CQG+TG  GTFHTEQAI YGT+MVGGVTP KGGTEHLGLPVFN+V +A A
Sbjct  3    ILIDKTTRVLCQGLTGSQGTFHTEQAIAYGTQMVGGVTPGKGGTEHLGLPVFNSVHEAAA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            +T+ANA+VIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL
Sbjct  63   KTQANATVIYVPPPFAADSILEAIDAEIELIVCITEGIPVLDMMKVKRAL  112



>ref|WP_010263012.1| succinyl-CoA ligase chain A (sucD), partial [Anaplasma marginale]
Length=294

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             V VDKNTRVICQG TG NGTFH+EQA+ YGTKMVGGVTP KGGT HLGLPVF+TV  AK
Sbjct  2    SVLVDKNTRVICQGFTGSNGTFHSEQAVAYGTKMVGGVTPGKGGTTHLGLPVFDTVLQAK  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
             ET+ANASVIYVP P+A  AI EA+EAE++L+VCITEGIP  DMV+VK AL
Sbjct  62   VETQANASVIYVPAPYAADAIFEAIEAEIELIVCITEGIPVLDMVQVKRAL  112



>gb|ACO52022.1| Succinyl-CoA ligase subunit alpha, mitochondrial precursor [Rana 
catesbeiana]
Length=325

 Score =   159 bits (402),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 108/137 (79%), Gaps = 1/137 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ-QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGG  310
            R IT+  L Q   +H  + +    +++DK+T+VICQG TGK GTFH++QA+EYGTK+VGG
Sbjct  5    RLITRLLLQQNGVRHNSYTASRKHLYIDKDTKVICQGFTGKQGTFHSQQALEYGTKLVGG  64

Query  311  VTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITE  490
            V+P KGG  HLGLPVFN+VA+AKA T A ASVIYVPPPFA AAI E+++AE+ LVVCITE
Sbjct  65   VSPGKGGKTHLGLPVFNSVAEAKAGTGATASVIYVPPPFAAAAIHESIDAEMPLVVCITE  124

Query  491  GIPQHDMVKVKAALKQQ  541
            GIPQ DMV+VK  L +Q
Sbjct  125  GIPQQDMVRVKHRLLRQ  141



>ref|WP_002721254.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [Rhodobacter]
 ref|YP_354050.1| Succinyl-CoA synthetase, alpha subunit [Rhodobacter sphaeroides 
2.4.1]
 gb|ABA80149.1| Succinyl-CoA synthetase, alpha subunit [Rhodobacter sphaeroides 
2.4.1]
 gb|ABN77728.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Rhodobacter 
sphaeroides ATCC 17029]
 gb|ACM02218.1| 2-oxoglutarate dehydrogenase E1 component [Rhodobacter sphaeroides 
KD131]
 gb|EGJ22466.1| succinyl-CoA synthetase, alpha subunit [Rhodobacter sphaeroides 
WS8N]
 gb|EKX58032.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Rhodobacter sp. 
AKP1]
Length=294

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V++NT+VICQGITG  GTFHTEQAI YGTKMVGGVTP KGG+EHLGLPVFN+V +A+ 
Sbjct  3    VLVNENTKVICQGITGSQGTFHTEQAIAYGTKMVGGVTPGKGGSEHLGLPVFNSVYEARE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
             T ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL+  +  
Sbjct  63   VTGANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALQGSSSR  118



>ref|XP_004415607.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Odobenus rosmarus divergens]
Length=333

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L QQ   +H  + +    ++VDKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  12   RLLSRSFLLQQNGIRHCSYIASRKHLYVDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK ET A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  72   GTTPGKGGQTHLGLPVFNTVKEAKEETGATASVIYVPPPFAAAAINEAVEAEVPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  132  EGIPQQDMVRVKHKLLRQGK  151



>ref|XP_009182789.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Papio anubis]
 gb|EHH22270.1| hypothetical protein EGK_05503 [Macaca mulatta]
 gb|EHH55709.1| hypothetical protein EGM_04965 [Macaca fascicularis]
Length=346

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLAQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  145  EGIPQQDMVRVKHKLLRQGK  164



>ref|NP_001270301.1| uncharacterized protein LOC101867049 [Macaca fascicularis]
 dbj|BAE87929.1| unnamed protein product [Macaca fascicularis]
Length=346

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLAQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  145  EGIPQQDMVRVKHKLLRQGK  164



>gb|ETP44985.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P10297]
Length=318

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  21   SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  80

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
            A+AK +T A+ASVIYVPPPF  A+I+EA+EAE+ LVV ITEGIPQ DMVKVK  L+ Q+
Sbjct  81   AEAKKDTGADASVIYVPPPFCAASIIEAIEAEIPLVVAITEGIPQQDMVKVKWHLRNQS  139



>ref|XP_003282290.2| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like [Nomascus leucogenys]
Length=206

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  145  EGIPQQDMVRVKHKLLRQGK  164



>gb|EGV93208.1| Succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Cricetulus griseus]
Length=333

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 107/140 (76%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L Q    +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12   RLLSRTFLLQHNGIRHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G +P KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  72   GTSPGKGGKTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+V+  L  Q +
Sbjct  132  EGIPQQDMVRVRHTLSHQGK  151



>emb|CCA20859.1| unnamed protein product [Albugo laibachii Nc14]
Length=325

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = +2

Query  125  KKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV  304
            K VRP   +   + +  R   S A +V+++++TRVICQG TGK GTFH+EQAI YGTKMV
Sbjct  5    KDVRPFVCA--LETRAGRSMSSSA-KVWINEDTRVICQGFTGKQGTFHSEQAIAYGTKMV  61

Query  305  GGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCI  484
            GGVTPKKGG+ HLGLPVFN+V++AK  T A+ASVIYVPPPF   AI++A+EAE+ LVV I
Sbjct  62   GGVTPKKGGSTHLGLPVFNSVSEAKRATNADASVIYVPPPFCAQAIIDAIEAEIPLVVAI  121

Query  485  TEGIPQHDMVKVKAALKQQ  541
            TEGIPQ DMVKVK  L+QQ
Sbjct  122  TEGIPQQDMVKVKWHLRQQ  140



>ref|NP_001025589.1| succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial 
[Xenopus (Silurana) tropicalis]
 gb|AAH91038.1| succinate-CoA ligase, alpha subunit [Xenopus (Silurana) tropicalis]
Length=325

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             +++DK+TRVICQG TGK GTFH++QA+EYGTK+VGGV+P KGG+ HLGLPVFN+VA+AK
Sbjct  28   HLYIDKDTRVICQGFTGKQGTFHSQQALEYGTKLVGGVSPGKGGSAHLGLPVFNSVAEAK  87

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQ  541
              T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  L +Q
Sbjct  88   EATGATASVIYVPPPFAAAAIHEAIDAEISLVVCITEGIPQQDMVRVKHRLLRQ  141



>ref|WP_038066282.1| succinate--CoA ligase [Thioclava dalianensis]
 gb|KEP69482.1| succinate--CoA ligase [Thioclava dalianensis]
Length=294

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V++NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG EHLGLPVFN+V +AKA
Sbjct  3    VLVNENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGQEHLGLPVFNSVHEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            +T+ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL
Sbjct  63   KTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRAL  112



>ref|WP_028287755.1| succinate--CoA ligase [Oceanicola nanhaiensis]
Length=293

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VD+NTRVICQG+TG  GTFHTEQAI YGTKMVGGVTP KGGT HL LPV+N+V +A  
Sbjct  3    VLVDENTRVICQGLTGSQGTFHTEQAIAYGTKMVGGVTPGKGGTTHLDLPVYNSVHEAMH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            ET+ANASVIYVPPPFA  +I+EA++AE+ L++CITEGIP  DM+KVKAAL+
Sbjct  63   ETQANASVIYVPPPFAADSILEAIDAEMPLIICITEGIPVLDMMKVKAALQ  113



>ref|XP_003294260.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium purpureum]
 gb|EGC29214.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium purpureum]
Length=312

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  FGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN  361
            F S  P V +DKNT+VICQG TG  GTFH++QAIEYGT+MVGGV+P KGG +HL LPVFN
Sbjct  12   FFSTKPHVLIDKNTKVICQGFTGNQGTFHSKQAIEYGTQMVGGVSPGKGGQKHLELPVFN  71

Query  362  TVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQ  541
            TV +AK +T ANA+VIYVPPPFA AAI EA++A+++L+VCITEGIPQ DMVKVK  L ++
Sbjct  72   TVQEAKQQTGANATVIYVPPPFAAAAIKEAIDADMELIVCITEGIPQQDMVKVKKYLNEK  131



>ref|WP_011907146.1| succinyl-CoA synthetase subsunit alpha [Rhodobacter sphaeroides]
 gb|ABP68989.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Rhodobacter 
sphaeroides ATCC 17025]
Length=294

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V++NT+VICQGITG  GTFHTEQAI YGTKMVGGVTP KGG+EHLGLPVFN+V +A+ 
Sbjct  3    VLVNENTKVICQGITGSQGTFHTEQAIAYGTKMVGGVTPGKGGSEHLGLPVFNSVFEARD  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
             T ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL+
Sbjct  63   VTGANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALE  113



>ref|XP_007625515.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Cricetulus griseus]
Length=346

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 107/140 (76%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L Q    +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRTFLLQHNGIRHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G +P KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  85   GTSPGKGGKTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+V+  L  Q +
Sbjct  145  EGIPQQDMVRVRHTLSHQGK  164



>ref|XP_003505683.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Cricetulus griseus]
Length=346

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 107/140 (76%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L Q    +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRTFLLQHNGIRHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G +P KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  85   GTSPGKGGKTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+V+  L  Q +
Sbjct  145  EGIPQQDMVRVRHTLSHQGK  164



>ref|WP_010267151.1| succinyl-CoA synthetase subsunit alpha [Anaplasma marginale]
 gb|AAV86340.1| succinyl-CoA ligase chain A [Anaplasma marginale str. St. Maries]
 gb|ACM49048.1| succinyl-CoA ligase chain A (sucD) [Anaplasma marginale str. 
Florida]
Length=294

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             V VDKNTRVICQG TG NGTFH+EQAI YGTK+VGGVTP KGGT HLGLPVF+TV  AK
Sbjct  2    SVLVDKNTRVICQGFTGSNGTFHSEQAIAYGTKVVGGVTPGKGGTTHLGLPVFDTVLQAK  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
             ET+ANASVIYVP P+A  AI EA+EAE++L+VCITEGIP  DMV+VK AL
Sbjct  62   VETQANASVIYVPAPYAADAIFEAIEAEIELIVCITEGIPVLDMVQVKRAL  112



>gb|ABW76150.1| succinyl-CoA synthetase alpha subunit [Blastocystis sp. NandII]
 gb|ABY62723.1| mitochondrial succinyl-CoA synthetase alpha subunit [Blastocystis 
sp. ATCC 50177]
Length=318

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S    V+VDKNTRVI QGITGKNGTFHT+QAIEYGTKMVGGV PKK GT HLGLP+F +V
Sbjct  19   SSTARVWVDKNTRVIGQGITGKNGTFHTQQAIEYGTKMVGGVNPKKAGTTHLGLPIFASV  78

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
             +AK  T A+A+VIYVPP  A  AI+EA+ AE+ L+VCITEGIPQHDM++VK  +K QN+
Sbjct  79   EEAKKATNADATVIYVPPSGAAGAILEAVAAEIPLIVCITEGIPQHDMLRVKDIMKSQNK  138

Query  548  N  550
            +
Sbjct  139  S  139



>ref|WP_012880976.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [Anaplasma]
 gb|ACZ49539.1| succinyl-CoA synthetase, alpha subunit [Anaplasma centrale str. 
Israel]
Length=293

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             V VDKNTRVICQG TG NGTFH+EQAI YGTK+VGGVTP KGGT HLGLPVF+TV  AK
Sbjct  2    SVLVDKNTRVICQGFTGSNGTFHSEQAIAYGTKVVGGVTPGKGGTTHLGLPVFDTVLQAK  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
             ET+ANASVIYVP P+A  AI EA+EAE++L+VCITEGIP  DMV+VK AL
Sbjct  62   VETQANASVIYVPAPYAADAIFEAIEAEIELIVCITEGIPVLDMVQVKRAL  112



>gb|KIX19593.1| succinate--CoA ligase [Paracoccus sp. 361]
Length=294

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQGITG  GTFHTEQAI YGT+MVGGVTP KGGT+HLG+PVFN+V +A A
Sbjct  3    VLVDKNTKVICQGITGSQGTFHTEQAIAYGTQMVGGVTPGKGGTDHLGMPVFNSVHEAVA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            +T ANASVIYVPPPFA  +I+EA++A++ L+VCITEGIP  DM++VK AL
Sbjct  63   KTGANASVIYVPPPFAADSILEAIDAQIPLIVCITEGIPVLDMMRVKRAL  112



>ref|WP_042245435.1| succinate--CoA ligase [Paracoccus sp. PAMC 22219]
Length=294

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQGITG  GTFHTEQAI YGTKMVGGVTP KGGT+HLG+PVFN+V +A A
Sbjct  3    VLVDKNTKVICQGITGSQGTFHTEQAIAYGTKMVGGVTPGKGGTDHLGMPVFNSVHEAVA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
             T ANASVIYVPPPFA  +I+EA++AE+ L+VCITEGIP  DM++VK AL
Sbjct  63   VTGANASVIYVPPPFAADSILEAIDAEVPLIVCITEGIPVLDMMRVKRAL  112



>ref|WP_033444427.1| succinate--CoA ligase, partial [Candidatus Odyssella thessalonicensis]
Length=294

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             + V+K T+VICQG TGKNGTFH+EQA+ YGTKMVGGVTP KGGT+HLGLPVFNTV DA 
Sbjct  2    SILVNKETKVICQGFTGKNGTFHSEQALAYGTKMVGGVTPGKGGTQHLGLPVFNTVGDAV  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
              T ANASVIYVP PFA  +I+EA +A ++L+VCITEGIP  DMV+VK AL   N
Sbjct  62   KTTGANASVIYVPAPFAADSILEAADAGIELIVCITEGIPVLDMVRVKRALAGSN  116



>ref|WP_009605554.1| succinyl-CoA synthetase subsunit alpha [SAR116 cluster alpha 
proteobacterium HIMB100]
 gb|EHI48297.1| succinyl-CoA synthetase, alpha subunit [SAR116 cluster alpha 
proteobacterium HIMB100]
Length=292

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             V VD  T+VICQG TG  GTFH++QAIEYGTKMVGGVTP KGG EHLGLPVFNTVA+A+
Sbjct  2    SVLVDSTTKVICQGFTGAQGTFHSQQAIEYGTKMVGGVTPGKGGQEHLGLPVFNTVAEAR  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
             +T A ASVIYVPPPFA  +I+EA+ A++ L+VCITEGIP  DMV+VK AL   N 
Sbjct  62   EQTGATASVIYVPPPFAADSILEAIAADMPLIVCITEGIPVLDMVEVKRALAASNS  117



>dbj|BAH12424.1| unnamed protein product [Homo sapiens]
Length=248

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  145  EGIPQQDMVRVKHKLLRQEK  164



>emb|CCI47059.1| unnamed protein product [Albugo candida]
Length=322

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = +2

Query  125  KKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV  304
            K VRP+  +   + +  R   + A +V+++K T+VICQG TGK GTFH+EQAI YGTKMV
Sbjct  5    KDVRPLVCA--LEARAGRSMSTSA-KVWINKETKVICQGFTGKQGTFHSEQAISYGTKMV  61

Query  305  GGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCI  484
            GGVTPKKGG+ HLGLPVFNTV++AK  T A+ASVIYVPPPF   AI++A+EAE+ L+V I
Sbjct  62   GGVTPKKGGSTHLGLPVFNTVSEAKRATNADASVIYVPPPFCAQAIIDAIEAEIPLIVAI  121

Query  485  TEGIPQHDMVKVKAALKQQ  541
            TEGIPQ DMV+VK  L+QQ
Sbjct  122  TEGIPQQDMVRVKWHLRQQ  140



>emb|CCI47060.1| unnamed protein product [Albugo candida]
Length=301

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +2

Query  188  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  367
            S + +V+++K T+VICQG TGK GTFH+EQAI YGTKMVGGVTPKKGG+ HLGLPVFNTV
Sbjct  2    STSAKVWINKETKVICQGFTGKQGTFHSEQAISYGTKMVGGVTPKKGGSTHLGLPVFNTV  61

Query  368  ADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQ  541
            ++AK  T A+ASVIYVPPPF   AI++A+EAE+ L+V ITEGIPQ DMV+VK  L+QQ
Sbjct  62   SEAKRATNADASVIYVPPPFCAQAIIDAIEAEIPLIVAITEGIPQQDMVRVKWHLRQQ  119



>ref|XP_010077723.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like, partial [Pterocles gutturalis]
Length=230

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = +2

Query  80   VVMAWQTARLIANVSKKVRPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGK  253
            ++    T R  + +    R ++++ L QQ   +H  + +    +++ KNT+VICQG TGK
Sbjct  8    LIFEKHTYRNFSKLRIDKRKLSKTFLLQQNGVRHCSYSASRKNLYISKNTKVICQGFTGK  67

Query  254  NGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFag  433
             GTFH++QA++YGT +VGG +P KGG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA 
Sbjct  68   QGTFHSQQALDYGTSLVGGTSPGKGGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAA  127

Query  434  aaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
            AAI EA++AE+ LVVCITEGIPQ DMV+VK  L +Q++
Sbjct  128  AAINEAIDAEMPLVVCITEGIPQQDMVRVKHRLLRQDK  165



>gb|KFP25909.1| hypothetical protein N325_08777, partial [Colius striatus]
Length=168

 Score =   153 bits (386),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = +2

Query  152  PLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKK  325
            PL QQ   +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG++P K
Sbjct  2    PLVQQNGVRHCTYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGK  61

Query  326  GGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQH  505
            GG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ 
Sbjct  62   GGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQ  121

Query  506  DMVKVKAALKQQNQ  547
            DMV+VK  L +Q +
Sbjct  122  DMVRVKHRLLRQGK  135



>gb|EAQ24007.1| succinyl-CoA synthase, alpha subunit [Roseovarius sp. 217]
Length=159

 Score =   152 bits (385),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDK+TRVICQG+TG  GTFH+EQAI YGT+MVGGVTP KGGT HL LPVFN+V +AK 
Sbjct  3    VLVDKHTRVICQGLTGSQGTFHSEQAIAYGTQMVGGVTPGKGGTTHLDLPVFNSVHEAKH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
             T+ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM++VK AL+
Sbjct  63   VTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMRVKRALE  113



>ref|WP_035260183.1| succinate--CoA ligase [Actibacterium mucosum]
 gb|KAJ55018.1| succinate--CoA ligase [Actibacterium mucosum KCTC 23349]
Length=293

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VD+NT+VICQG+TG  GTFH+EQAI YGTKMVGGVTP KGG  HLGLPVFN+V +AK 
Sbjct  3    VLVDENTKVICQGLTGSQGTFHSEQAIAYGTKMVGGVTPGKGGQTHLGLPVFNSVHEAKH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
             T+ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL+  +  
Sbjct  63   VTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRALETSSST  118



>ref|XP_004660591.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Jaculus jaculus]
Length=348

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    ++VDKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  27   RLLSRTFLLQQNGIRHSSYVASRKNLYVDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  86

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVF++V +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  87   GTTPGKGGMTHLGLPVFDSVKEAKEKTGATASVIYVPPPFAAAAITEAIDAEIPLVVCIT  146

Query  488  EGIPQHDMVKVKAALKQQNQN  550
            EGIPQ DMV+V+  L  Q + 
Sbjct  147  EGIPQQDMVRVRHKLSHQGKT  167



>ref|XP_007536491.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like [Erinaceus europaeus]
Length=304

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R + +S L QQ   +H  + +    ++VDKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  12   RLLPRSYLLQQNGIRHCSYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG +HLGLPVFN+V +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  72   GTTPGKGGQKHLGLPVFNSVKEAKEKTGATASVIYVPPPFAAAAIDEAIEAEMSLVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  132  EGIPQQDMVRVKHKLVRQGK  151



>ref|WP_038144207.1| succinate--CoA ligase [Thioclava sp. 13D2W-2]
 gb|KFE35934.1| succinyl-CoA synthetase subunit alpha [Thioclava sp. 13D2W-2]
Length=295

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V++NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG EHLGLPVF++V +AKA
Sbjct  3    VLVNENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGQEHLGLPVFDSVHEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            +T+ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL
Sbjct  63   KTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKRAL  112



>ref|XP_010201069.1| PREDICTED: LOW QUALITY PROTEIN: succinyl-CoA ligase [ADP/GDP-forming] 
subunit alpha, mitochondrial-like, partial [Colius 
striatus]
Length=175

 Score =   152 bits (385),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +2

Query  140  ITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGV  313
            I+ S L QQ   +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG+
Sbjct  6    ISFSXLVQQNGVRHCTYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGI  65

Query  314  TPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEG  493
            +P KGG  HLGLPVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEG
Sbjct  66   SPGKGGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEG  125

Query  494  IPQHDMVKVKAALKQQNQ  547
            IPQ DMV+VK  L +Q +
Sbjct  126  IPQQDMVRVKHRLLRQGK  143



>ref|WP_009507065.1| succinyl-CoA synthetase subsunit alpha [Citreicella sp. 357]
 gb|EIE48869.1| succinyl-CoA synthetase, alpha subunit [Citreicella sp. 357]
Length=294

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VD NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG EHLGLPVFN+V +AKA
Sbjct  3    VLVDANTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGQEHLGLPVFNSVHEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            +T+ANASVIYVPPPFA  +I+EA++A ++L+VCITEGIP  DM++VK  L
Sbjct  63   KTEANASVIYVPPPFAADSILEAIDAGIELIVCITEGIPVLDMMRVKRTL  112



>ref|XP_011398589.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Auxenochlorella protothecoides]
 gb|KFM25693.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Auxenochlorella protothecoides]
Length=321

 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK TRVI QG TGKNGTFH++QAI+YGT MVGGVTPKKGGT HLGLPVF+TVA+A
Sbjct  26   PAVFVDKTTRVIVQGFTGKNGTFHSQQAIDYGTNMVGGVTPKKGGTTHLGLPVFDTVAEA  85

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            +A T A A+ IYVPPPFA AAIMEA+EAE+ L+VCITEGIPQHDMV+VK AL QQ+ +
Sbjct  86   RAATGATATAIYVPPPFAAAAIMEALEAEIPLIVCITEGIPQHDMVRVKKALSQQSAS  143



>ref|XP_004742358.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X2 [Mustela putorius furo]
 ref|XP_004805738.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Mustela putorius furo]
Length=346

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L QQ   +H  + +    +++DKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  25   RLLSRSFLLQQNGIRHCSYVASRKHLYIDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAISEAVEAEVPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  145  EGIPQQDMVRVKHKLLRQGK  164



>ref|XP_010366218.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial, partial [Rhinopithecus roxellana]
Length=332

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VGG TP KGG  HLGL
Sbjct  25   RHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGL  84

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCITEGIPQ DMV+VK  
Sbjct  85   PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVEAEIPLVVCITEGIPQQDMVRVKHK  144

Query  530  LKQQNQ  547
            L +Q +
Sbjct  145  LLRQGK  150



>ref|XP_011227722.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Ailuropoda melanoleuca]
Length=414

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L QQ   +H  + +    ++VDKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  93   RLLSRSFLLQQNGIRHCSYIASRKHLYVDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  152

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK ET A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  153  GTTPGKGGQTHLGLPVFNTVKEAKEETGATASVIYVPPPFAAAAINEAVEAEVPLVVCIT  212

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  213  EGIPQQDMVRVKHKLLRQGK  232



>gb|ERE66319.1| succinyl-CoA ligase [GDP-forming] subunit alpha [Cricetulus griseus]
Length=341

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VGG +P KGG  HLGL
Sbjct  34   RHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGTSPGKGGKTHLGL  93

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+V+  
Sbjct  94   PVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCITEGIPQQDMVRVRHT  153

Query  530  LKQQNQ  547
            L  Q +
Sbjct  154  LSHQGK  159



>ref|XP_008698280.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X1 [Ursus maritimus]
Length=346

 Score =   157 bits (397),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 107/139 (77%), Gaps = 2/139 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++ S L QQ   +H  + +    ++VDKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  25   RLLSPSFLLQQNGIRHCSYIASRKHLYVDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK ET A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEETGATASVIYVPPPFAAAAINEAVEAEVPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQN  544
            EGIPQ DMV+VK  L +Q 
Sbjct  145  EGIPQQDMVRVKHKLLRQG  163



>ref|XP_003420463.2| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Loxodonta africana]
Length=333

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +T+  L QQ   +H  + S    +++DK+T+VICQG TGK GTFH+++A+EYGTK+VG
Sbjct  12   RLLTRYFLVQQNGIRHSSYVSSRKHLYIDKDTKVICQGFTGKQGTFHSQKALEYGTKLVG  71

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HL LPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  72   GTTPGKGGQMHLDLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEALEAEIALVVCIT  131

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK AL +Q +
Sbjct  132  EGIPQQDMVRVKHALLRQGK  151



>ref|WP_041873600.1| succinate--CoA ligase [Bdellovibrio sp. ArHS]
 gb|KHD88013.1| succinate--CoA ligase [Bdellovibrio sp. ArHS]
Length=289

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + ++K+T+VICQG TG  GTFH+EQA+ YGTKMVGGVTP KGGT H+GLPVFNTVADAK 
Sbjct  3    ILINKDTKVICQGFTGAQGTFHSEQAVAYGTKMVGGVTPGKGGTTHIGLPVFNTVADAKE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVK  523
            +T  NASVI+VPPPFA  +IMEA++AELDLV+CITEGIP  DMVKVK
Sbjct  63   KTGCNASVIFVPPPFAADSIMEAVDAELDLVICITEGIPVLDMVKVK  109



>ref|WP_018985877.1| hypothetical protein [Methylophilus methylotrophus]
Length=293

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + VDKNT+V+CQG TGK GTFH+EQA+ YGTKMVGGVTP KGG +HL LPVFNT+ +A  
Sbjct  3    ILVDKNTKVLCQGFTGKQGTFHSEQALAYGTKMVGGVTPGKGGQQHLNLPVFNTMREAVK  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            ET+ANASVIYVPPPFA  +I+EA +A ++L+VCITEGIP  DM+ VKAAL+
Sbjct  63   ETQANASVIYVPPPFAADSILEAADAGIELIVCITEGIPALDMLNVKAALR  113



>ref|WP_044152630.1| succinate--CoA ligase [Anaplasma phagocytophilum]
 gb|KDB56127.1| succinate--CoA ligase [Anaplasma phagocytophilum str. MRK]
Length=295

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGT MVGGVTP KGGTEHLGLPVF+TVA AK 
Sbjct  3    VLVDKNTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGTEHLGLPVFDTVAQAKE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
             T ANASVIYVP  FA  AI+EA+EAE++L+VCITEGIP  DMV+VK AL+
Sbjct  63   ATGANASVIYVPAAFAADAILEALEAEIELIVCITEGIPVLDMVRVKRALR  113



>ref|WP_015092761.1| succinyl-CoA synthetase subunit alpha [Bdellovibrio bacteriovorus]
 gb|AFY03362.1| succinyl-CoA synthetase alpha chain [Bdellovibrio bacteriovorus 
str. Tiberius]
Length=290

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + ++KNT+VICQG TG  GTFH+EQA+ YGTKMVGGVTP KGGT H+GLPVFNTV +AKA
Sbjct  3    ILINKNTKVICQGFTGAQGTFHSEQALAYGTKMVGGVTPGKGGTTHIGLPVFNTVKEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQ  541
             T  NASVI+VPPPFA  +IMEA++A+LDLV+CITEGIP  DMVKVK  +K +
Sbjct  63   ATGCNASVIFVPPPFAADSIMEAVDADLDLVICITEGIPVLDMVKVKEYMKGK  115



>ref|XP_002289446.1| precursor of synthetase [Thalassiosira pseudonana CCMP1335]
 gb|EED92983.1| precursor of synthetase [Thalassiosira pseudonana CCMP1335]
Length=299

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
            +V++DK+TRVICQG TGK GTFH+ QAIEYGT MVGGVTPKKGG EHLGLPVF++VADA 
Sbjct  6    KVWIDKDTRVICQGFTGKQGTFHSTQAIEYGTNMVGGVTPKKGGQEHLGLPVFDSVADAV  65

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQ  547
             E K +ASVIYVPPP+  AAI++A+E E+ LVV ITEG+PQ DMV+VK AL  Q++
Sbjct  66   LEVKPDASVIYVPPPYCAAAILDAIENEIPLVVAITEGVPQQDMVRVKKALLSQDK  121



>ref|XP_005843440.1| hypothetical protein CHLNCDRAFT_141133 [Chlorella variabilis]
 gb|EFN51338.1| hypothetical protein CHLNCDRAFT_141133 [Chlorella variabilis]
Length=330

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P VFVDK+T+VI QG TGKNGTFH+EQAI+YGT++VGGV PKKGGT HLGLPVF +V +A
Sbjct  35   PAVFVDKDTKVIVQGFTGKNGTFHSEQAIQYGTQVVGGVNPKKGGTTHLGLPVFASVREA  94

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            K  T  +A+ IYVPPP A  AI+EA+EAELDLVVCITE IPQHDMV+VK  L +Q++ 
Sbjct  95   KEATGCHATAIYVPPPGAAKAILEAVEAELDLVVCITEAIPQHDMVRVKKVLSEQSKT  152



>ref|XP_007968242.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Chlorocebus sabaeus]
Length=415

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  94   RLLSRSFLLAQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  153

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  154  GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVEAEIPLVVCIT  213

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  214  EGIPQQDMVRVKHKLLRQGK  233



>ref|WP_014241630.1| succinyl-CoA synthetase subsunit alpha [Azospirillum brasilense]
 emb|CCC99459.1| succinyl-CoA synthetase, alpha subunit,NAD(P)-binding [Azospirillum 
brasilense Sp245]
 gb|EZQ09513.1| succinate--CoA ligase [Azospirillum brasilense]
 gb|AIB12739.1| succinate--CoA ligase [Azospirillum brasilense]
Length=291

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVADA  
Sbjct  3    VLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVADAVE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            +T ANASVIYVPPPFA  AI+EA++AE+ LVVCITEGIP  DMV+VK AL
Sbjct  63   KTGANASVIYVPPPFAADAILEAIDAEIPLVVCITEGIPVLDMVRVKRAL  112



>ref|WP_038528120.1| succinate--CoA ligase [Azospirillum brasilense]
 gb|EZQ08744.1| succinate--CoA ligase [Azospirillum brasilense]
 gb|AIB11866.1| succinate--CoA ligase [Azospirillum brasilense]
Length=291

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVADA  
Sbjct  3    VLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVADAVE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            +T ANASVIYVPPPFA  AI+EA++AE+ LVVCITEGIP  DMV+VK AL
Sbjct  63   KTGANASVIYVPPPFAADAILEAIDAEIPLVVCITEGIPVLDMVRVKRAL  112



>ref|WP_021693117.1| succinyl-CoA ligase [ADP-forming] alpha chain [Loktanella cinnabarina]
 dbj|GAD55009.1| succinyl-CoA ligase [ADP-forming] alpha chain [Loktanella cinnabarina 
LL-001]
Length=293

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + VD+NTRVICQG+TG  GTFHTEQA+ YGT+MVGGVTP KGG  HL LPVF++V +AKA
Sbjct  3    ILVDENTRVICQGLTGSQGTFHTEQAVAYGTRMVGGVTPGKGGQTHLDLPVFDSVHEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            +T+ANASVIYVPPPFA  +IMEA++AE++LV+CITEGIP  DM+KVK AL
Sbjct  63   KTEANASVIYVPPPFAADSIMEAIDAEMELVICITEGIPVLDMMKVKRAL  112



>ref|WP_021799836.1| succinyl-CoA synthetase, alpha subunit [Anaplasma phagocytophilum]
 gb|EOA62511.1| succinyl-CoA synthetase, alpha subunit [Anaplasma phagocytophilum 
str. CRT38]
Length=295

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGT MVGGVTP KGGTEHLGLPVF+TVA AK 
Sbjct  3    VLVDKNTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGTEHLGLPVFDTVAQAKK  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
             T ANASVIYVP  FA  AI+EA+EAE++L+VCITEGIP  DMV+VK AL+
Sbjct  63   ATGANASVIYVPAAFAADAILEALEAEIELIVCITEGIPVLDMVRVKRALR  113



>ref|WP_020849415.1| succinyl-CoA synthetase subsunit alpha [Anaplasma phagocytophilum]
 gb|EOA61286.1| succinyl-CoA synthetase, alpha subunit [Anaplasma phagocytophilum 
str. HGE1]
 gb|AGR80253.1| succinyl-CoA synthetase subsunit alpha [Anaplasma phagocytophilum 
str. JM]
 gb|AGR81507.1| succinyl-CoA synthetase subsunit alpha [Anaplasma phagocytophilum 
str. Dog2]
Length=295

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGT MVGGVTP KGGTEHLGLPVF+TVA AK 
Sbjct  3    VLVDKNTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGTEHLGLPVFDTVAQAKE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
             T ANASVIYVP  FA  AI+EA+EAE++L+VCITEGIP  DMV+VK AL+
Sbjct  63   ATGANASVIYVPAAFAADAILEALEAEIELIVCITEGIPVLDMVRVKRALR  113



>ref|WP_011451122.1| succinyl-CoA synthetase subsunit alpha [Anaplasma phagocytophilum]
 gb|ABD43415.1| succinyl-CoA synthetase, alpha subunit [Anaplasma phagocytophilum 
str. HZ]
 gb|AGR79006.1| succinyl-CoA synthetase subsunit alpha [Anaplasma phagocytophilum 
str. HZ2]
Length=295

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGT MVGGVTP KGGTEHLGLPVF+TVA AK 
Sbjct  3    VLVDKNTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGTEHLGLPVFDTVAQAKE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
             T ANASVIYVP  FA  AI+EA+EAE++L+VCITEGIP  DMV+VK AL+
Sbjct  63   ATGANASVIYVPAAFAADAILEALEAEIELIVCITEGIPVLDMVRVKRALR  113



>ref|WP_011166112.1| succinyl-CoA synthetase subsunit alpha [Bdellovibrio bacteriovorus]
 emb|CAE81169.1| succinyl-CoA synthetase alpha chain [Bdellovibrio bacteriovorus 
HD100]
Length=290

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + ++KNT+VICQG TG  GTFH+EQA+ YGTKMVGGVTP KGGT H+GLPVFNTV +AKA
Sbjct  3    ILINKNTKVICQGFTGAQGTFHSEQALAYGTKMVGGVTPGKGGTTHIGLPVFNTVKEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQ  541
             T  NASVI+VPPPFA  +IMEA++A+LDLV+CITEGIP  DMVKVK  +K +
Sbjct  63   ATGCNASVIFVPPPFAADSIMEAVDADLDLVICITEGIPVLDMVKVKEYMKGK  115



>ref|WP_036561342.1| succinate--CoA ligase [Oceanicola sp. MCTG156(1a)]
Length=293

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VD+NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG +HLGLPVFN+V +AK 
Sbjct  3    VLVDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGQDHLGLPVFNSVHEAKH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
             T+ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL+
Sbjct  63   VTEANASVIYVPPPFAADSILEAIDAEMELIVCITEGIPVLDMMKVKKALE  113



>gb|AAA85724.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium discoideum 
AX2]
Length=310

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +2

Query  176  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  355
            + F S  P V ++KNT+VICQG TG  GTFH++QAIEYGT MVGGV+P KGG +HL LP 
Sbjct  13   KRFFSTKPSVLINKNTKVICQGFTGNQGTFHSKQAIEYGTNMVGGVSPGKGGQKHLDLPA  72

Query  356  FNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            FNTV +AK  T ANA+VIYVPPP A AAI EA++AE++LVVCITEGIPQ DMVKVK  L 
Sbjct  73   FNTVKEAKEATGANATVIYVPPPHAAAAIKEAIDAEMELVVCITEGIPQQDMVKVKYLLN  132

Query  536  QQNQ  547
            +QN+
Sbjct  133  KQNK  136



>ref|WP_006035775.1| succinyl-CoA synthetase subunit alpha [Rickettsiella grylli]
 gb|EDP46806.1| succinyl-CoA synthetase, alpha subunit [Rickettsiella grylli]
Length=289

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +2

Query  200  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  379
             + +DKNT+VICQG TGK GTFH+EQAI YGTKMVGGVTP KGGT+HLGLPVF+TVADA 
Sbjct  2    SILIDKNTKVICQGFTGKQGTFHSEQAIAYGTKMVGGVTPGKGGTQHLGLPVFDTVADAV  61

Query  380  AETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
            A+T A+ASVIYVP PF   +I+EA +A +  +VCITEGIP  DM+ VK  L+ +N
Sbjct  62   AKTGADASVIYVPAPFCKDSIIEAADAGISFIVCITEGIPVLDMLDVKVYLETKN  116



>ref|WP_020401362.1| succinyl-CoA synthetase subsunit alpha [Kordiimonas gwangyangensis]
Length=291

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V K+T+VICQG TG  GTFH+EQAI YGT+MVGGVTP KGG++HL LPVF+TVADA+ 
Sbjct  3    VLVGKHTKVICQGFTGAQGTFHSEQAIAYGTQMVGGVTPGKGGSKHLDLPVFDTVADARE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
             T ANASVIYVPPPFA  AI+EA++AEL+LVVCITEGIP  DMV+VK ALK   
Sbjct  63   ATDANASVIYVPPPFAADAILEAIDAELELVVCITEGIPVMDMVRVKRALKNSG  116



>ref|WP_020038867.1| succinyl-CoA synthetase subsunit alpha [Salipiger mucosus]
 gb|EPX85508.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Salipiger mucosus 
DSM 16094]
Length=295

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VD+NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG EHLGLPVFN+V +A  
Sbjct  3    VLVDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGAEHLGLPVFNSVHEAVQ  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            +T+ANASVIYVPPPFA  +I+EA++AE++L+VCITEGIP  DM+KVK AL
Sbjct  63   KTEANASVIYVPPPFAADSILEAIDAEIELIVCITEGIPVLDMMKVKRAL  112



>ref|XP_005837665.1| hypothetical protein GUITHDRAFT_157241 [Guillardia theta CCMP2712]
 gb|EKX50685.1| hypothetical protein GUITHDRAFT_157241 [Guillardia theta CCMP2712]
Length=297

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +2

Query  197  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  376
            P  FV+K+TRVICQG TG  GTFH+EQ+I YGTKMVGGVTPKKGGT HLGLPVFNTV +A
Sbjct  5    PPPFVNKDTRVICQGFTGSQGTFHSEQSIAYGTKMVGGVTPKKGGTTHLGLPVFNTVREA  64

Query  377  KAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
            K   K +ASVIYVPPPFA  A ++A+EAE+ LVV ITEGIPQ DMV+VK AL    + 
Sbjct  65   KEAVKPDASVIYVPPPFAMRAALDAIEAEIPLVVVITEGIPQQDMVRVKHALNMSTKT  122



>ref|WP_044105250.1| succinate--CoA ligase [Anaplasma phagocytophilum]
 gb|KDB56875.1| succinate--CoA ligase [Anaplasma phagocytophilum str. CRT35]
Length=295

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGT MVGGVTP KGGTEHLGLPVF+TVA AK 
Sbjct  3    VLVDKNTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGTEHLGLPVFDTVAQAKK  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
             T ANASVIYVP  FA  AI+EA+EAE++L+VCITEGIP  DMV+VK AL+
Sbjct  63   TTGANASVIYVPAAFAADAILEALEAEIELIVCITEGIPVLDMVRVKRALR  113



>ref|WP_014415904.1| succinyl-CoA synthetase subsunit alpha [Rhodospirillum photometricum]
 emb|CCG09274.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rhodospirillum 
photometricum DSM 122]
Length=291

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V K+TRVICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT HL LPVF+TVA+A+ 
Sbjct  3    VLVGKDTRVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLDLPVFDTVAEARE  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQ  541
             T  NA+VIYVPPPFA  AI+EA++AELDL VCITEGIP  DMVKVK AL+  
Sbjct  63   RTGCNATVIYVPPPFAADAILEAIDAELDLAVCITEGIPVLDMVKVKRALRNS  115



>ref|XP_001082705.2| PREDICTED: succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Macaca mulatta]
Length=382

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VGG TP KGG  HLGL
Sbjct  50   RHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGL  109

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCITEGIPQ DMV+VK  
Sbjct  110  PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVEAEIPLVVCITEGIPQQDMVRVKHK  169

Query  530  LKQQNQ  547
            L +Q +
Sbjct  170  LLRQGK  175



>ref|WP_038450336.1| succinate--CoA ligase [Bdellovibrio bacteriovorus]
 gb|AHZ85564.1| succinate--CoA ligase [Bdellovibrio bacteriovorus]
Length=290

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + ++KNT+VICQG TG  GTFH+EQA+ YGTKMVGGVTP KGGT H+GLPVFNTV +AKA
Sbjct  3    ILINKNTKVICQGFTGAQGTFHSEQALAYGTKMVGGVTPGKGGTTHIGLPVFNTVKEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQ  541
             T  NASVI+VPPPFA  +IMEA++A+LDLV+CITEGIP  DMVKVK  +K +
Sbjct  63   ATGCNASVIFVPPPFAADSIMEAVDADLDLVICITEGIPVLDMVKVKQYMKGK  115



>ref|XP_008167941.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X4 [Chrysemys picta bellii]
Length=314

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++++KNT+VICQG TGK GTFH++QA+EYGTK+VGG++P KGG  HLGL
Sbjct  7    RHCSYSATRKNLYINKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGISPGKGGKTHLGL  66

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  67   PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVDAEIPLVVCITEGIPQQDMVRVKHK  126

Query  530  LKQQNQ  547
            L +Q++
Sbjct  127  LIRQDK  132



>gb|KDB02198.1| succinyl-CoA synthetase subsunit alpha [Defluviimonas sp. 20V17]
Length=316

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 104/134 (78%), Gaps = 8/134 (6%)
 Frame = +2

Query  155  LWQQQQHRLFGSPAPE--------VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGG  310
               ++ +R F +P P+        V VD+NTRVICQGITG  GTFH+EQAI YGTKMVGG
Sbjct  2    FCSRKIYRRFAAPDPKTKQEGQMAVLVDENTRVICQGITGSQGTFHSEQAIAYGTKMVGG  61

Query  311  VTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITE  490
            VTP KGG  HL LPVF++V +A A+T+ANA+VIYVPPPFA  +I+EA++AE++L+VCITE
Sbjct  62   VTPGKGGQTHLNLPVFDSVHEAVAKTEANATVIYVPPPFAADSILEAIDAEIELIVCITE  121

Query  491  GIPQHDMVKVKAAL  532
            GIP  DM+KVK AL
Sbjct  122  GIPVLDMMKVKRAL  135



>ref|WP_043870886.1| succinate--CoA ligase [Celeribacter indicus]
 gb|AJE48588.1| succinyl-CoA synthetase subunit alpha [Celeribacter indicus]
Length=295

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + VD+NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT HL LPVFN+V +A+A
Sbjct  3    ILVDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLDLPVFNSVHEARA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            +T+ANASVIYVPPPFA  +I+EA++AE++L++CITEGIP  DM+KVK AL
Sbjct  63   KTEANASVIYVPPPFAADSILEAIDAEMELIICITEGIPVLDMMKVKRAL  112



>ref|WP_039523079.1| succinate--CoA ligase [Ruegeria sp. ANG-S4]
 gb|KIC46534.1| succinate--CoA ligase [Ruegeria sp. ANG-S4]
Length=293

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V +D+NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG EHLGLPVFN+V +AK 
Sbjct  3    VLIDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGMEHLGLPVFNSVHEAKH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
             T+ANASVIYVPPPFA  +I+EA++AE++++VCITEGIP  DM+KVK AL+
Sbjct  63   VTEANASVIYVPPPFAADSILEAIDAEMEVIVCITEGIPVLDMMKVKRALE  113



>ref|XP_004742357.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X1 [Mustela putorius furo]
Length=352

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L QQ   +H  + +    +++DKNT+VICQG TGK GTFH++QA++YGT++VG
Sbjct  25   RLLSRSFLLQQNGIRHCSYVASRKHLYIDKNTKVICQGFTGKQGTFHSQQALDYGTQLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAISEAVEAEVPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  145  EGIPQQDMVRVKHKLLRQGK  164



>ref|WP_008756783.1| succinyl-CoA synthetase subsunit alpha [Rhodobacteraceae bacterium 
KLH11]
 gb|EEE37606.1| succinyl-CoA synthase, alpha subunit [Rhodobacteraceae bacterium 
KLH11]
Length=293

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V +D+NT+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG EHL LPVFN+V +AKA
Sbjct  3    VLIDENTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGMEHLDLPVFNSVHEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQNQN  550
             T+ANASVIYVPPPFA  +I+EA++A ++++VCITEGIP  DM+KVK AL+  N  
Sbjct  63   VTEANASVIYVPPPFAADSILEAIDARMEVIVCITEGIPVLDMMKVKRALEGSNSR  118



>ref|XP_007470656.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Lipotes vexillifer]
Length=346

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R ++++ L QQ   +H  + +    ++VDK+T+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRAFLLQQNGIRHCSYTASRKHLYVDKDTKVICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVF+TV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGETHLGLPVFSTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEVSLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  145  EGIPQQDMVRVKHKLLRQEK  164



>ref|WP_027256408.1| succinate--CoA ligase [Leisingera aquimarina]
Length=294

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V +D+NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG EHLGLPVFN+V +AK 
Sbjct  3    VLIDENTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGMEHLGLPVFNSVHEAKH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
             T+ANASVIYVPPPFA  +I+EA++AE++++VCITEGIP  DM+KVK AL+
Sbjct  63   VTEANASVIYVPPPFAADSILEAIDAEMEVIVCITEGIPVLDMMKVKRALE  113



>ref|WP_037260544.1| succinate--CoA ligase [Roseivivax halodurans]
 gb|ETX15119.1| succinyl-CoA synthetase subsunit alpha [Roseivivax halodurans 
JCM 10272]
Length=295

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + VD NT+VICQG+TG  GTFHTEQAI YGTKMVGGVTP KGG  HL LPVFN+V +AKA
Sbjct  3    ILVDANTKVICQGLTGSQGTFHTEQAIAYGTKMVGGVTPGKGGQTHLDLPVFNSVHEAKA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            +T+ANASVIYVPPPFA  +I EA++AE++L+VCITEGIP  DM+KVK AL+
Sbjct  63   KTEANASVIYVPPPFAADSICEAIDAEMELIVCITEGIPVLDMMKVKRALE  113



>ref|XP_636263.1| succinate-CoA ligase [Dictyostelium discoideum AX4]
 sp|P36967.3|SUCA_DICDI RecName: Full=Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha; Short=SCS-alpha; AltName: Full=p36; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL62749.1| succinate-CoA ligase [Dictyostelium discoideum AX4]
Length=315

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  176  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  355
            + F S  P V ++K+T+VICQG TG  GTFH++QAIEYGT MVGGV+P KGG +HL LPV
Sbjct  13   KRFFSTKPSVLINKHTKVICQGFTGNQGTFHSKQAIEYGTNMVGGVSPGKGGQKHLDLPV  72

Query  356  FNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            FNTV +AK  T ANA+VIYVPPP A AAI EA++AE++LVVCITEGIPQ DMVKVK  L 
Sbjct  73   FNTVKEAKEATGANATVIYVPPPHAAAAIKEAIDAEMELVVCITEGIPQQDMVKVKYLLN  132

Query  536  QQNQ  547
            +QN+
Sbjct  133  KQNK  136



>gb|KFP67749.1| hypothetical protein N322_02167, partial [Cariama cristata]
Length=167

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++++KNT+VICQG TGK GTFH++QA++YGT +VGG++P KGG  HLGL
Sbjct  10   RHCSYSASRKNLYINKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISPGKGGKTHLGL  69

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFN+V +AK +T A+A+VIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  70   PVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIPQQDMVRVKHR  129

Query  530  LKQQNQ  547
            L +Q++
Sbjct  130  LLRQDK  135



>ref|WP_020951286.1| succinyl-CoA synthetase, subunit alpha [Paracoccus aminophilus]
 gb|AGT09648.1| succinyl-CoA synthetase, subunit alpha [Paracoccus aminophilus 
JCM 7686]
Length=294

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQGITG  GTFHTEQAI YGTKMVGGVTP KGG+EHLGLPVF++V DA A
Sbjct  3    VLVDKNTKVICQGITGSQGTFHTEQAIAYGTKMVGGVTPGKGGSEHLGLPVFDSVHDAVA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            +T A ASVIYVPPPFA  +I+EA++AE+ L+V ITEGIP  DM+KVK AL
Sbjct  63   KTGATASVIYVPPPFAADSILEAIDAEIPLIVAITEGIPVLDMMKVKRAL  112



>ref|XP_005292517.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X2 [Chrysemys picta bellii]
Length=330

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++++KNT+VICQG TGK GTFH++QA+EYGTK+VGG++P KGG  HLGL
Sbjct  23   RHCSYSATRKNLYINKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGISPGKGGKTHLGL  82

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  83   PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVDAEIPLVVCITEGIPQQDMVRVKHK  142

Query  530  LKQQNQ  547
            L +Q++
Sbjct  143  LIRQDK  148



>ref|WP_025311911.1| succinate--CoA ligase [Roseibacterium elongatum]
 gb|AHM04100.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Roseibacterium 
elongatum DSM 19469]
Length=293

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG  HL LPVFN+V +A+ 
Sbjct  3    VLVDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGQTHLDLPVFNSVHEARH  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
             T+ANASVIYVPPPFA  +I+EA++AE+DL+VCITEGIP  DM+KVK AL+  +
Sbjct  63   ATEANASVIYVPPPFAADSILEAIDAEMDLIVCITEGIPVLDMMKVKRALENSD  116



>ref|WP_028718094.1| succinate--CoA ligase [Paracoccus yeei]
Length=294

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V+K+T+VICQG+TG  GTFHTEQAI YGT+MVGGVTP KGG+EHLGLPVFN+V +A A
Sbjct  3    VLVNKDTKVICQGLTGSQGTFHTEQAIAYGTQMVGGVTPGKGGSEHLGLPVFNSVHEAVA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALK  535
            +T ANASVIYVPPPFA  +I+EA++AE+ L+VCITEGIP  DM+KVK AL+
Sbjct  63   KTGANASVIYVPPPFAADSILEAIDAEIPLIVCITEGIPVLDMMKVKRALQ  113



>ref|WP_012567360.1| succinyl-CoA synthetase subsunit alpha [Rhodospirillum centenum]
 gb|ACI99575.1| succinyl-CoA synthetase, alpha subunit [Rhodospirillum centenum 
SW]
Length=290

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            V V+K+T+VICQG TG  GTFH+EQAI YGT+MVGGVTP KGGT HL LPVF+TVADA A
Sbjct  3    VLVNKDTKVICQGFTGAQGTFHSEQAIAYGTRMVGGVTPGKGGTTHLDLPVFDTVADAVA  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAALKQQN  544
            +T ANASVIYVPPPFA  AI+EA++A + LVVCITEGIP  DMVKVK AL+   
Sbjct  63   KTGANASVIYVPPPFAADAILEAIDAGIPLVVCITEGIPVLDMVKVKRALQDSG  116



>ref|XP_002757610.3| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X2 [Callithrix jacchus]
Length=346

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 107/140 (76%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L  Q +
Sbjct  145  EGIPQQDMVRVKHKLLHQGK  164



>ref|WP_029148401.1| succinyl-CoA synthetase subunit alpha [Methylophilus sp. 5]
Length=293

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  382
            + VDKNT+V+CQG TGK GTFH+EQA+ YGTKMVGGVTP KGG +HL LPVFNT+ +A  
Sbjct  3    ILVDKNTKVLCQGFTGKQGTFHSEQALAYGTKMVGGVTPGKGGQQHLALPVFNTMREAVK  62

Query  383  ETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAAL  532
            ET+ANASVIYVPPPFA  +I+EA +A ++L+VCITEGIP  DM+ VKAAL
Sbjct  63   ETQANASVIYVPPPFAADSILEAADAGIELIVCITEGIPVLDMLNVKAAL  112



>ref|NP_001126825.1| succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial 
[Pongo abelii]
 emb|CAH93082.1| hypothetical protein [Pongo abelii]
Length=346

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = +2

Query  134  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  307
            R +++S L  Q   +H  + +    ++VDKNT++ICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25   RLLSRSFLLPQNGIRHCSYTASRKHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  308  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCIT  487
            G TP KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA+EAE+ LVVCIT
Sbjct  85   GTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCIT  144

Query  488  EGIPQHDMVKVKAALKQQNQ  547
            EGIPQ DMV+VK  L +Q +
Sbjct  145  EGIPQQDMVRVKHKLLRQGK  164



>ref|XP_005292518.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial isoform X3 [Chrysemys picta bellii]
Length=323

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  170  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  349
            +H  + +    ++++KNT+VICQG TGK GTFH++QA+EYGTK+VGG++P KGG  HLGL
Sbjct  16   RHCSYSATRKNLYINKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGISPGKGGKTHLGL  75

Query  350  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaeLDLVVCITEGIPQHDMVKVKAA  529
            PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+VK  
Sbjct  76   PVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAVDAEIPLVVCITEGIPQQDMVRVKHK  135

Query  530  LKQQNQ  547
            L +Q++
Sbjct  136  LIRQDK  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880