BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002G02

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009785507.1|  PREDICTED: tetraspanin-2                           289   2e-94   Nicotiana sylvestris
ref|XP_009603765.1|  PREDICTED: tetraspanin-2-like                      281   2e-91   Nicotiana tomentosiformis
ref|XP_009631964.1|  PREDICTED: tetraspanin-2-like                      263   2e-84   Nicotiana tomentosiformis
emb|CDP03178.1|  unnamed protein product                                261   8e-84   Coffea canephora [robusta coffee]
ref|XP_004242965.1|  PREDICTED: tetraspanin-2-like                      257   3e-82   Solanum lycopersicum
ref|XP_006361826.1|  PREDICTED: tetraspanin-2-like                      256   7e-82   Solanum tuberosum [potatoes]
ref|XP_009779686.1|  PREDICTED: tetraspanin-2-like                      251   1e-79   Nicotiana sylvestris
ref|XP_004234795.1|  PREDICTED: tetraspanin-2-like                      244   3e-77   Solanum lycopersicum
ref|XP_006349548.1|  PREDICTED: tetraspanin-2-like                      244   4e-77   Solanum tuberosum [potatoes]
ref|XP_011077968.1|  PREDICTED: tetraspanin-2                           243   2e-76   Sesamum indicum [beniseed]
ref|XP_007012865.1|  Tetraspanin2                                       242   4e-76   Theobroma cacao [chocolate]
gb|EYU27305.1|  hypothetical protein MIMGU_mgv1a011848mg                236   6e-74   Erythranthe guttata [common monkey flower]
ref|XP_010262176.1|  PREDICTED: tetraspanin-2-like                      231   8e-72   Nelumbo nucifera [Indian lotus]
ref|XP_011014710.1|  PREDICTED: tetraspanin-2                           228   8e-71   Populus euphratica
ref|XP_004287540.1|  PREDICTED: tetraspanin-2                           227   2e-70   Fragaria vesca subsp. vesca
ref|XP_002308295.1|  senescence-associated family protein               225   1e-69   
ref|XP_008459286.1|  PREDICTED: tetraspanin-2                           224   3e-69   Cucumis melo [Oriental melon]
ref|XP_004141051.1|  PREDICTED: uncharacterized protein LOC101204213    224   3e-69   Cucumis sativus [cucumbers]
gb|KJB06764.1|  hypothetical protein B456_001G011200                    224   3e-69   Gossypium raimondii
gb|KJB06763.1|  hypothetical protein B456_001G011200                    224   4e-69   Gossypium raimondii
gb|KJB54355.1|  hypothetical protein B456_009G031000                    224   4e-69   Gossypium raimondii
gb|KJB54354.1|  hypothetical protein B456_009G031000                    223   6e-69   Gossypium raimondii
ref|XP_002282397.1|  PREDICTED: tetraspanin-2                           223   7e-69   Vitis vinifera
ref|XP_010090033.1|  hypothetical protein L484_027263                   224   9e-69   
ref|XP_010047582.1|  PREDICTED: tetraspanin-2                           221   3e-68   Eucalyptus grandis [rose gum]
ref|XP_008242412.1|  PREDICTED: tetraspanin-2                           221   4e-68   Prunus mume [ume]
ref|XP_007202447.1|  hypothetical protein PRUPE_ppa009984mg             221   4e-68   Prunus persica
ref|XP_010526407.1|  PREDICTED: tetraspanin-2                           219   3e-67   Tarenaya hassleriana [spider flower]
ref|XP_010690424.1|  PREDICTED: tetraspanin-2                           219   3e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006298321.1|  hypothetical protein CARUB_v10014386mg             216   4e-66   Capsella rubella
ref|XP_008337694.1|  PREDICTED: tetraspanin-2                           216   6e-66   
ref|XP_006298322.1|  hypothetical protein CARUB_v10014386mg             216   6e-66   Capsella rubella
ref|XP_010242186.1|  PREDICTED: tetraspanin-2                           216   5e-65   Nelumbo nucifera [Indian lotus]
ref|XP_002514142.1|  conserved hypothetical protein                     214   8e-65   
gb|KDP33819.1|  hypothetical protein JCGZ_07390                         213   9e-65   Jatropha curcas
ref|XP_008366601.1|  PREDICTED: tetraspanin-2-like                      211   3e-64   
ref|XP_004503540.1|  PREDICTED: tetraspanin-2-like                      211   6e-64   Cicer arietinum [garbanzo]
ref|XP_009352637.1|  PREDICTED: tetraspanin-2                           208   5e-63   Pyrus x bretschneideri [bai li]
ref|XP_008793244.1|  PREDICTED: tetraspanin-2                           208   8e-63   Phoenix dactylifera
emb|CDY21656.1|  BnaA09g44070D                                          203   3e-62   Brassica napus [oilseed rape]
ref|XP_009102150.1|  PREDICTED: tetraspanin-2-like                      202   1e-61   Brassica rapa
ref|XP_009117532.1|  PREDICTED: tetraspanin-2-like                      204   1e-61   Brassica rapa
gb|KDO57736.1|  hypothetical protein CISIN_1g024312mg                   202   2e-61   Citrus sinensis [apfelsine]
emb|CDY58324.1|  BnaCnng32990D                                          201   2e-61   Brassica napus [oilseed rape]
ref|XP_009112617.1|  PREDICTED: tetraspanin-2-like                      204   3e-61   Brassica rapa
ref|NP_179548.1|  tetraspanin2                                          204   3e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CDY03356.1|  BnaC09g09920D                                          204   3e-61   
ref|XP_002883983.1|  hypothetical protein ARALYDRAFT_899924             204   3e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_008387703.1|  PREDICTED: tetraspanin-2-like                      202   8e-61   
ref|XP_006408875.1|  hypothetical protein EUTSA_v10002073mg             202   1e-60   Eutrema salsugineum [saltwater cress]
emb|CDY48714.1|  BnaA09g09890D                                          202   2e-60   Brassica napus [oilseed rape]
ref|XP_010925419.1|  PREDICTED: tetraspanin-2                           201   2e-60   Elaeis guineensis
ref|XP_009102152.1|  PREDICTED: tetraspanin-2                           201   5e-60   Brassica rapa
gb|KHG24338.1|  hypothetical protein F383_01681                         200   6e-60   Gossypium arboreum [tree cotton]
ref|XP_010467909.1|  PREDICTED: tetraspanin-2-like isoform X1           199   1e-59   Camelina sativa [gold-of-pleasure]
gb|KDO57734.1|  hypothetical protein CISIN_1g024312mg                   199   1e-59   Citrus sinensis [apfelsine]
ref|XP_006451442.1|  hypothetical protein CICLE_v10009193mg             199   2e-59   Citrus clementina [clementine]
ref|XP_010467910.1|  PREDICTED: tetraspanin-2-like isoform X2           199   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010416857.1|  PREDICTED: tetraspanin-2 isoform X2                199   2e-59   Camelina sativa [gold-of-pleasure]
gb|KCW82491.1|  hypothetical protein EUGRSUZ_C03887                     196   2e-59   Eucalyptus grandis [rose gum]
ref|XP_010489156.1|  PREDICTED: tetraspanin-2-like isoform X2           199   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010416849.1|  PREDICTED: tetraspanin-2 isoform X1                199   2e-59   Camelina sativa [gold-of-pleasure]
gb|AFK37963.1|  unknown                                                 199   3e-59   Medicago truncatula
ref|XP_010489155.1|  PREDICTED: tetraspanin-2-like isoform X1           199   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_003630634.1|  hypothetical protein MTR_8g101600                  199   3e-59   Medicago truncatula
gb|KFK40333.1|  hypothetical protein AALP_AA3G360500                    198   4e-59   Arabis alpina [alpine rockcress]
ref|XP_003530563.1|  PREDICTED: tetraspanin-2                           197   1e-58   Glycine max [soybeans]
ref|XP_010049725.1|  PREDICTED: tetraspanin-2-like                      196   3e-58   Eucalyptus grandis [rose gum]
ref|XP_009380442.1|  PREDICTED: tetraspanin-2-like                      191   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK45233.1|  unknown                                                 190   6e-56   Lotus japonicus
ref|XP_007160234.1|  hypothetical protein PHAVU_002G304100g             188   4e-55   Phaseolus vulgaris [French bean]
ref|XP_009409323.1|  PREDICTED: tetraspanin-2-like                      183   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007152918.1|  hypothetical protein PHAVU_004G171300g             181   3e-52   Phaseolus vulgaris [French bean]
gb|KGN66227.1|  hypothetical protein Csa_1G586890                       176   1e-51   Cucumis sativus [cucumbers]
emb|CDX81936.1|  BnaC08g36650D                                          175   2e-50   
ref|XP_006836243.1|  hypothetical protein AMTR_s00101p00124120          174   3e-50   
gb|EPS62274.1|  hypothetical protein M569_12516                         174   8e-50   Genlisea aurea
ref|XP_004135705.1|  PREDICTED: uncharacterized protein LOC101208857    174   2e-49   Cucumis sativus [cucumbers]
ref|XP_008450844.1|  PREDICTED: tetraspanin-2-like                      168   2e-47   Cucumis melo [Oriental melon]
ref|XP_003529082.1|  PREDICTED: tetraspanin-2                           167   3e-47   Glycine max [soybeans]
gb|EPS60790.1|  hypothetical protein M569_14011                         160   2e-44   Genlisea aurea
ref|XP_010559299.1|  PREDICTED: protein TORNADO 2                       159   7e-44   Tarenaya hassleriana [spider flower]
ref|XP_008343041.1|  PREDICTED: protein TORNADO 2-like                  156   7e-44   
ref|XP_003571711.1|  PREDICTED: tetraspanin-2-like                      159   8e-44   Brachypodium distachyon [annual false brome]
ref|XP_008783967.1|  PREDICTED: protein TORNADO 2-like                  155   1e-43   Phoenix dactylifera
gb|KJB65127.1|  hypothetical protein B456_010G082000                    155   7e-43   Gossypium raimondii
ref|XP_008448672.1|  PREDICTED: protein TORNADO 2-like                  156   7e-43   Cucumis melo [Oriental melon]
ref|XP_006838537.1|  hypothetical protein AMTR_s00002p00197500          154   7e-43   
ref|XP_006437550.1|  hypothetical protein CICLE_v10032405mg             156   1e-42   Citrus clementina [clementine]
ref|NP_001130594.1|  uncharacterized protein LOC100191693 precursor     155   3e-42   Zea mays [maize]
ref|XP_004148762.1|  PREDICTED: uncharacterized protein LOC101210867    154   3e-42   Cucumis sativus [cucumbers]
ref|XP_004300405.1|  PREDICTED: protein TORNADO 2                       154   3e-42   Fragaria vesca subsp. vesca
ref|XP_006656179.1|  PREDICTED: tetraspanin-2-like                      154   5e-42   Oryza brachyantha
ref|XP_008796279.1|  PREDICTED: protein TORNADO 2-like                  154   7e-42   Phoenix dactylifera
emb|CDP13039.1|  unnamed protein product                                153   1e-41   Coffea canephora [robusta coffee]
ref|XP_010933474.1|  PREDICTED: protein TORNADO 2                       153   1e-41   Elaeis guineensis
ref|XP_010088251.1|  hypothetical protein L484_003211                   152   1e-41   
ref|XP_009384122.1|  PREDICTED: protein TORNADO 2                       153   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006484810.1|  PREDICTED: protein TORNADO 2-like                  152   2e-41   Citrus sinensis [apfelsine]
ref|XP_006437239.1|  hypothetical protein CICLE_v10032401mg             152   3e-41   Citrus clementina [clementine]
ref|XP_010227584.1|  PREDICTED: tetraspanin-2-like                      152   3e-41   Brachypodium distachyon [annual false brome]
ref|XP_009340177.1|  PREDICTED: protein TORNADO 2-like                  152   4e-41   Pyrus x bretschneideri [bai li]
ref|XP_008786324.1|  PREDICTED: protein TORNADO 2-like                  152   4e-41   Phoenix dactylifera
gb|EYU44074.1|  hypothetical protein MIMGU_mgv1a011737mg                151   5e-41   Erythranthe guttata [common monkey flower]
gb|EYU34536.1|  hypothetical protein MIMGU_mgv1a022692mg                151   6e-41   Erythranthe guttata [common monkey flower]
ref|XP_002451779.1|  hypothetical protein SORBIDRAFT_04g007710          151   6e-41   
ref|XP_006484564.1|  PREDICTED: protein TORNADO 2-like isoform X1       151   6e-41   Citrus sinensis [apfelsine]
ref|XP_006484560.1|  PREDICTED: protein TORNADO 2-like                  151   7e-41   Citrus sinensis [apfelsine]
ref|XP_011070272.1|  PREDICTED: protein TORNADO 2                       150   1e-40   Sesamum indicum [beniseed]
ref|XP_009611576.1|  PREDICTED: protein TORNADO 2-like                  150   2e-40   
ref|XP_003516791.1|  PREDICTED: protein TORNADO 2                       149   2e-40   Glycine max [soybeans]
gb|KHN25514.1|  hypothetical protein glysoja_047080                     149   3e-40   Glycine soja [wild soybean]
ref|XP_009371218.1|  PREDICTED: protein TORNADO 2-like                  149   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_007210528.1|  hypothetical protein PRUPE_ppa009969mg             149   3e-40   Prunus persica
ref|XP_009804150.1|  PREDICTED: protein TORNADO 2                       149   3e-40   Nicotiana sylvestris
ref|XP_010055315.1|  PREDICTED: protein TORNADO 2                       149   4e-40   Eucalyptus grandis [rose gum]
ref|XP_009630198.1|  PREDICTED: protein TORNADO 2-like                  149   5e-40   Nicotiana tomentosiformis
ref|XP_002304338.1|  senescence-associated family protein               149   5e-40   
ref|XP_011028172.1|  PREDICTED: protein TORNADO 2                       148   7e-40   Populus euphratica
ref|XP_006647076.1|  PREDICTED: tetraspanin-2-like                      147   1e-39   Oryza brachyantha
gb|KDO37999.1|  hypothetical protein CISIN_1g047660mg                   145   1e-39   Citrus sinensis [apfelsine]
ref|XP_008373579.1|  PREDICTED: protein TORNADO 2                       147   2e-39   
ref|XP_004951448.1|  PREDICTED: tetraspanin-2-like                      147   2e-39   Setaria italica
ref|XP_010687692.1|  PREDICTED: tetraspanin-8-like                      147   2e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB25297.1|  hypothetical protein B456_004G184300                    147   3e-39   Gossypium raimondii
ref|XP_008781378.1|  PREDICTED: tetraspanin-8                           147   3e-39   Phoenix dactylifera
ref|XP_008238234.1|  PREDICTED: protein TORNADO 2                       147   3e-39   Prunus mume [ume]
gb|KHG02386.1|  hypothetical protein F383_25371                         146   3e-39   Gossypium arboreum [tree cotton]
ref|XP_002518412.1|  conserved hypothetical protein                     146   4e-39   Ricinus communis
dbj|BAJ90218.1|  predicted protein                                      146   6e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010911362.1|  PREDICTED: protein TORNADO 2-like                  143   7e-39   Elaeis guineensis
ref|XP_007156422.1|  hypothetical protein PHAVU_003G284700g             145   7e-39   Phaseolus vulgaris [French bean]
gb|EMS47667.1|  hypothetical protein TRIUR3_32517                       143   8e-39   Triticum urartu
gb|EMT16464.1|  hypothetical protein F775_32677                         145   8e-39   
ref|NP_001046313.2|  Os02g0219700                                       145   9e-39   
gb|EAZ01413.1|  hypothetical protein OsI_23447                          145   1e-38   Oryza sativa Indica Group [Indian rice]
gb|KDP20689.1|  hypothetical protein JCGZ_21160                         145   2e-38   Jatropha curcas
ref|XP_006352863.1|  PREDICTED: protein TORNADO 2-like                  145   2e-38   Solanum tuberosum [potatoes]
ref|XP_004245901.1|  PREDICTED: protein TORNADO 2                       145   2e-38   Solanum lycopersicum
ref|NP_001057919.1|  Os06g0572400                                       144   2e-38   
ref|XP_007039476.1|  Tetraspanin family protein                         144   2e-38   
ref|XP_002970026.1|  hypothetical protein SELMODRAFT_440948             144   2e-38   
ref|XP_007039477.1|  Tetraspanin family protein, putative               145   3e-38   
ref|XP_010695565.1|  PREDICTED: protein TORNADO 2                       144   4e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003549518.1|  PREDICTED: tetraspanin-8                           143   6e-38   Glycine max [soybeans]
ref|XP_002993321.1|  hypothetical protein SELMODRAFT_272321             143   6e-38   Selaginella moellendorffii
ref|XP_002278741.1|  PREDICTED: protein TORNADO 2                       143   7e-38   Vitis vinifera
ref|XP_006660645.1|  PREDICTED: tetraspanin-8-like                      143   9e-38   
gb|KHG15651.1|  Tetraspanin-31                                          143   9e-38   Gossypium arboreum [tree cotton]
ref|XP_003542315.2|  PREDICTED: tetraspanin-8-like                      143   2e-37   
gb|ACU20029.1|  unknown                                                 142   2e-37   Glycine max [soybeans]
ref|XP_004966042.1|  PREDICTED: tetraspanin-2-like                      142   2e-37   Setaria italica
ref|XP_007154836.1|  hypothetical protein PHAVU_003G151800g             142   3e-37   Phaseolus vulgaris [French bean]
ref|XP_009414630.1|  PREDICTED: tetraspanin-8                           142   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGV54443.1|  senescence-associated protein                           142   3e-37   Phaseolus vulgaris [French bean]
dbj|BAK03335.1|  predicted protein                                      142   3e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010047035.1|  PREDICTED: tetraspanin-8-like                      141   3e-37   Eucalyptus grandis [rose gum]
gb|KJB23553.1|  hypothetical protein B456_004G104300                    141   3e-37   Gossypium raimondii
gb|KJB53853.1|  hypothetical protein B456_009G008000                    141   4e-37   Gossypium raimondii
ref|XP_002460242.1|  hypothetical protein SORBIDRAFT_02g025180          141   4e-37   Sorghum bicolor [broomcorn]
ref|XP_004172817.1|  PREDICTED: uncharacterized LOC101210475            141   5e-37   
ref|XP_010927974.1|  PREDICTED: tetraspanin-8-like                      141   6e-37   Elaeis guineensis
ref|XP_006437533.1|  hypothetical protein CICLE_v10033400mg             137   7e-37   
ref|XP_002992066.1|  hypothetical protein SELMODRAFT_162119             140   7e-37   Selaginella moellendorffii
ref|XP_002964102.1|  hypothetical protein SELMODRAFT_266767             140   8e-37   Selaginella moellendorffii
ref|XP_008443811.1|  PREDICTED: tetraspanin-8-like                      140   9e-37   Cucumis melo [Oriental melon]
ref|XP_007132173.1|  hypothetical protein PHAVU_011G072100g             140   9e-37   Phaseolus vulgaris [French bean]
ref|XP_006453500.1|  hypothetical protein CICLE_v10009180mg             140   1e-36   Citrus clementina [clementine]
gb|AFD63133.1|  senescence-associated protein                           140   1e-36   Vitis quinquangularis
ref|XP_004512520.1|  PREDICTED: protein TORNADO 2-like                  140   1e-36   Cicer arietinum [garbanzo]
gb|AGT16475.1|  senescence-associated protein                           140   1e-36   Saccharum hybrid cultivar R570
gb|KJB26992.1|  hypothetical protein B456_004G273300                    139   2e-36   Gossypium raimondii
gb|KHG17865.1|  Tetraspanin-31                                          139   2e-36   Gossypium arboreum [tree cotton]
ref|XP_002271684.1|  PREDICTED: tetraspanin-8                           139   3e-36   Vitis vinifera
ref|XP_010273156.1|  PREDICTED: protein TORNADO 2-like                  139   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_004151158.1|  PREDICTED: uncharacterized protein LOC101210475    139   3e-36   Cucumis sativus [cucumbers]
ref|XP_004309857.1|  PREDICTED: tetraspanin-8-like                      139   3e-36   Fragaria vesca subsp. vesca
emb|CAN83511.1|  hypothetical protein VITISV_035079                     139   4e-36   Vitis vinifera
ref|XP_002528212.1|  conserved hypothetical protein                     139   4e-36   Ricinus communis
ref|XP_004505953.1|  PREDICTED: tetraspanin-3-like                      139   4e-36   Cicer arietinum [garbanzo]
gb|AFK47947.1|  unknown                                                 135   6e-36   Lotus japonicus
ref|XP_008807036.1|  PREDICTED: tetraspanin-7-like                      138   7e-36   Phoenix dactylifera
ref|NP_001063223.1|  Os09g0425900                                       138   9e-36   
ref|XP_010526324.1|  PREDICTED: tetraspanin-8-like                      137   1e-35   Tarenaya hassleriana [spider flower]
gb|EMS60689.1|  hypothetical protein TRIUR3_10720                       136   1e-35   Triticum urartu
ref|XP_010240868.1|  PREDICTED: protein TORNADO 2-like                  137   2e-35   Nelumbo nucifera [Indian lotus]
gb|EMT05126.1|  hypothetical protein F775_30220                         137   2e-35   
ref|XP_003606498.1|  hypothetical protein MTR_4g061010                  137   2e-35   Medicago truncatula
gb|ACJ84677.1|  unknown                                                 136   2e-35   Medicago truncatula
ref|XP_010525757.1|  PREDICTED: tetraspanin-8                           136   3e-35   Tarenaya hassleriana [spider flower]
ref|XP_008223564.1|  PREDICTED: tetraspanin-8-like                      136   3e-35   Prunus mume [ume]
gb|AFK38592.1|  unknown                                                 137   3e-35   Medicago truncatula
tpg|DAA61555.1|  TPA: hypothetical protein ZEAMMB73_727484              134   4e-35   
ref|XP_006368392.1|  senescence-associated family protein               136   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_008375950.1|  PREDICTED: tetraspanin-8-like                      135   4e-35   
gb|KHN34762.1|  hypothetical protein glysoja_032938                     135   5e-35   Glycine soja [wild soybean]
ref|XP_011018553.1|  PREDICTED: protein TORNADO 2-like                  135   7e-35   Populus euphratica
gb|KHN05715.1|  hypothetical protein glysoja_024681                     135   7e-35   Glycine soja [wild soybean]
ref|XP_010914059.1|  PREDICTED: tetraspanin-8-like                      135   7e-35   Elaeis guineensis
ref|XP_006592227.1|  PREDICTED: tetraspanin-3                           136   7e-35   
ref|XP_002877422.1|  hypothetical protein ARALYDRAFT_905722             135   8e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_006845476.1|  hypothetical protein AMTR_s00019p00136590          132   8e-35   
ref|XP_010429337.1|  PREDICTED: tetraspanin-8-like isoform X1           135   8e-35   Camelina sativa [gold-of-pleasure]
ref|NP_190146.1|  tetraspanin3                                          135   9e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KJB21099.1|  hypothetical protein B456_003G183100                    135   9e-35   Gossypium raimondii
ref|XP_006294776.1|  hypothetical protein CARUB_v10023828mg             135   9e-35   Capsella rubella
ref|XP_010417125.1|  PREDICTED: tetraspanin-8                           135   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009396242.1|  PREDICTED: tetraspanin-7-like                      135   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010268396.1|  PREDICTED: tetraspanin-8-like                      135   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010514887.1|  PREDICTED: tetraspanin-3-like                      135   1e-34   Camelina sativa [gold-of-pleasure]
gb|ABK24499.1|  unknown                                                 135   1e-34   Picea sitchensis
ref|XP_010043700.1|  PREDICTED: tetraspanin-3                           135   2e-34   Eucalyptus grandis [rose gum]
ref|XP_007013955.1|  Tetraspanin8                                       134   2e-34   
ref|XP_003558742.1|  PREDICTED: protein TORNADO 2                       134   2e-34   Brachypodium distachyon [annual false brome]
ref|XP_010425983.1|  PREDICTED: tetraspanin-3-like                      134   2e-34   Camelina sativa [gold-of-pleasure]
gb|ABK93187.1|  unknown                                                 134   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010472376.1|  PREDICTED: tetraspanin-8-like                      134   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010503176.1|  PREDICTED: tetraspanin-3                           134   2e-34   Camelina sativa [gold-of-pleasure]
gb|ABK24102.1|  unknown                                                 134   2e-34   Picea sitchensis
ref|XP_009387449.1|  PREDICTED: tetraspanin-7-like                      134   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009336391.1|  PREDICTED: tetraspanin-8-like                      133   3e-34   Pyrus x bretschneideri [bai li]
dbj|BAJ99995.1|  predicted protein                                      134   4e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006291625.1|  hypothetical protein CARUB_v10017776mg             134   4e-34   Capsella rubella
ref|NP_001061921.1|  Os08g0443800                                       134   4e-34   
gb|KFK32704.1|  hypothetical protein AALP_AA6G278100                    133   4e-34   Arabis alpina [alpine rockcress]
ref|NP_001131638.1|  Senescence-associated protein 5 isoform 1          133   4e-34   Zea mays [maize]
ref|XP_009336394.1|  PREDICTED: tetraspanin-8-like                      133   4e-34   Pyrus x bretschneideri [bai li]
ref|XP_008789800.1|  PREDICTED: tetraspanin-7                           133   5e-34   Phoenix dactylifera
ref|XP_009101499.1|  PREDICTED: protein TORNADO 2-like                  132   6e-34   Brassica rapa
dbj|BAD42919.1|  similar to senescence-associated protein               133   7e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KDO73130.1|  hypothetical protein CISIN_1g023208mg                   133   7e-34   Citrus sinensis [apfelsine]
ref|XP_006424654.1|  hypothetical protein CICLE_v10028995mg             133   7e-34   Citrus clementina [clementine]
ref|XP_007223206.1|  hypothetical protein PRUPE_ppa010029mg             132   7e-34   Prunus persica
ref|XP_004509732.1|  PREDICTED: protein TORNADO 2-like                  132   8e-34   Cicer arietinum [garbanzo]
gb|KHN22039.1|  hypothetical protein glysoja_008951                     132   1e-33   Glycine soja [wild soybean]
ref|NP_001105285.1|  senescence-associated protein DH                   132   1e-33   Zea mays [maize]
ref|NP_850045.2|  tetraspanin8                                          132   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009133989.1|  PREDICTED: tetraspanin-8-like                      132   1e-33   Brassica rapa
ref|NP_001241564.1|  uncharacterized protein LOC100788977               132   1e-33   Glycine max [soybeans]
ref|XP_008362147.1|  PREDICTED: tetraspanin-8-like                      132   1e-33   Malus domestica [apple tree]
gb|KFK33948.1|  hypothetical protein AALP_AA5G082700                    132   1e-33   Arabis alpina [alpine rockcress]
ref|XP_004136394.1|  PREDICTED: uncharacterized protein LOC101218363    132   1e-33   Cucumis sativus [cucumbers]
ref|XP_009150196.1|  PREDICTED: tetraspanin-3                           132   2e-33   Brassica rapa
emb|CDY63054.1|  BnaA06g40440D                                          131   2e-33   Brassica napus [oilseed rape]
ref|XP_010535582.1|  PREDICTED: tetraspanin-3-like                      132   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_002325098.2|  senescence-associated family protein               131   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011018100.1|  PREDICTED: tetraspanin-8                           131   3e-33   Populus euphratica
ref|XP_006419022.1|  hypothetical protein EUTSA_v10002614mg             132   3e-33   
gb|ABK24083.1|  unknown                                                 130   3e-33   Picea sitchensis
ref|XP_002880529.1|  hypothetical protein ARALYDRAFT_481243             131   3e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_003517052.1|  PREDICTED: protein TORNADO 2-like                  131   3e-33   
ref|XP_001781448.1|  predicted protein                                  130   4e-33   
gb|ABK23290.1|  unknown                                                 130   4e-33   Picea sitchensis
ref|XP_011015152.1|  PREDICTED: tetraspanin-8-like                      130   4e-33   Populus euphratica
ref|XP_007138421.1|  hypothetical protein PHAVU_009G207500g             130   5e-33   Phaseolus vulgaris [French bean]
ref|XP_009630098.1|  PREDICTED: tetraspanin-8-like                      130   5e-33   Nicotiana tomentosiformis
emb|CDX83205.1|  BnaA03g23010D                                          130   7e-33   
ref|XP_009394680.1|  PREDICTED: tetraspanin-7-like                      130   7e-33   
ref|XP_011010505.1|  PREDICTED: tetraspanin-8-like                      129   1e-32   Populus euphratica
ref|XP_009798186.1|  PREDICTED: tetraspanin-8-like                      129   1e-32   Nicotiana sylvestris
gb|ACU24560.1|  unknown                                                 129   1e-32   Glycine max [soybeans]
ref|XP_003534277.1|  PREDICTED: protein TORNADO 2                       129   1e-32   Glycine max [soybeans]
ref|XP_010253525.1|  PREDICTED: tetraspanin-3                           129   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010050248.1|  PREDICTED: tetraspanin-8-like                      129   2e-32   Eucalyptus grandis [rose gum]
gb|KDP38757.1|  hypothetical protein JCGZ_04110                         129   3e-32   Jatropha curcas
ref|XP_006843260.1|  hypothetical protein AMTR_s00080p00116450          126   3e-32   
ref|XP_009384708.1|  PREDICTED: protein TORNADO 2-like                  129   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008463907.1|  PREDICTED: tetraspanin-3-like                      129   3e-32   Cucumis melo [Oriental melon]
gb|KJB25298.1|  hypothetical protein B456_004G184400                    130   3e-32   Gossypium raimondii
ref|XP_002962238.1|  hypothetical protein SELMODRAFT_77149              128   3e-32   
emb|CDY21483.1|  BnaC03g27140D                                          128   3e-32   Brassica napus [oilseed rape]
ref|XP_010448041.1|  PREDICTED: tetraspanin-7                           128   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004149556.1|  PREDICTED: uncharacterized protein LOC101215313    129   4e-32   Cucumis sativus [cucumbers]
gb|AFK47125.1|  unknown                                                 128   4e-32   Medicago truncatula
ref|XP_002438604.1|  hypothetical protein SORBIDRAFT_10g022610          128   4e-32   Sorghum bicolor [broomcorn]
gb|KEH32585.1|  tetraspanin family protein                              128   4e-32   Medicago truncatula
ref|XP_002965152.1|  hypothetical protein SELMODRAFT_83771              128   4e-32   
ref|XP_004163962.1|  PREDICTED: uncharacterized protein LOC101224794    125   5e-32   
ref|XP_003578145.1|  PREDICTED: tetraspanin-8-like                      128   5e-32   Brachypodium distachyon [annual false brome]
ref|XP_008224802.1|  PREDICTED: tetraspanin-3                           128   5e-32   
gb|AAF18611.2|  hypothetical protein                                    124   6e-32   
ref|XP_007205676.1|  hypothetical protein PRUPE_ppa009596mg             128   6e-32   
gb|KFK31443.1|  hypothetical protein AALP_AA6G112300                    127   6e-32   
ref|XP_002865168.1|  hypothetical protein ARALYDRAFT_494309             127   6e-32   
ref|XP_010433267.1|  PREDICTED: tetraspanin-7-like                      127   7e-32   
ref|XP_009592640.1|  PREDICTED: tetraspanin-3-like                      128   7e-32   
ref|XP_011069841.1|  PREDICTED: tetraspanin-8-like                      127   7e-32   
gb|AET03269.2|  tetraspanin family protein                              127   7e-32   
gb|AFK46617.1|  unknown                                                 127   1e-31   
ref|XP_006660171.1|  PREDICTED: tetraspanin-8-like                      127   1e-31   
ref|XP_001775454.1|  predicted protein                                  127   1e-31   
ref|XP_001756386.1|  predicted protein                                  127   1e-31   
ref|XP_002308429.1|  senescence-associated family protein               127   1e-31   
ref|XP_010257628.1|  PREDICTED: LOW QUALITY PROTEIN: tetraspanin-8      127   1e-31   
ref|XP_010441557.1|  PREDICTED: protein TORNADO 2-like                  126   2e-31   
ref|XP_010481424.1|  PREDICTED: protein TORNADO 2                       126   2e-31   
ref|XP_002526335.1|  conserved hypothetical protein                     126   2e-31   
ref|NP_199482.1|  protein TORNADO 2                                     126   2e-31   
ref|XP_004986107.1|  PREDICTED: protein TORNADO 2-like                  126   2e-31   
gb|AAL49918.1|  putative senescence-associated protein 5                126   2e-31   
gb|ACJ84491.1|  unknown                                                 126   2e-31   
ref|XP_006400868.1|  hypothetical protein EUTSA_v10014304mg             126   3e-31   
ref|XP_006404868.1|  hypothetical protein EUTSA_v100002610mg            125   3e-31   
ref|XP_009410199.1|  PREDICTED: tetraspanin-8-like                      125   3e-31   
ref|XP_006281989.1|  hypothetical protein CARUB_v10028216mg             125   3e-31   
ref|XP_003542004.1|  PREDICTED: tetraspanin-3                           126   3e-31   
ref|XP_003628793.1|  hypothetical protein MTR_8g066790                  127   3e-31   
gb|KDP44120.1|  hypothetical protein JCGZ_05587                         126   3e-31   
gb|KHG25500.1|  CD82 antigen                                            126   4e-31   
ref|XP_011089357.1|  PREDICTED: tetraspanin-3-like                      126   4e-31   
dbj|BAJ33633.1|  unnamed protein product                                125   4e-31   
ref|XP_002314262.1|  senescence-associated family protein               125   5e-31   
ref|XP_010438510.1|  PREDICTED: tetraspanin-7-like                      125   5e-31   
ref|XP_010103134.1|  hypothetical protein L484_023007                   124   8e-31   
ref|XP_009796466.1|  PREDICTED: tetraspanin-3-like                      125   8e-31   
ref|XP_009598591.1|  PREDICTED: tetraspanin-3-like                      125   8e-31   
gb|KJB55501.1|  hypothetical protein B456_009G079200                    125   9e-31   
ref|XP_006285537.1|  hypothetical protein CARUB_v10006978mg             124   9e-31   
ref|XP_004241266.1|  PREDICTED: tetraspanin-3                           125   9e-31   
ref|XP_006398365.1|  hypothetical protein EUTSA_v10000993mg             124   1e-30   
emb|CDX71046.1|  BnaC03g11300D                                          124   1e-30   
ref|XP_009117265.1|  PREDICTED: tetraspanin-8                           124   1e-30   
emb|CDY34813.1|  BnaA09g41800D                                          124   1e-30   
ref|XP_002867471.1|  hypothetical protein ARALYDRAFT_913718             124   1e-30   
ref|XP_006650938.1|  PREDICTED: protein TORNADO 2-like                  124   1e-30   
ref|XP_010520340.1|  PREDICTED: tetraspanin-3                           124   2e-30   
ref|XP_010047881.1|  PREDICTED: tetraspanin-8-like                      124   2e-30   
ref|XP_009799298.1|  PREDICTED: tetraspanin-3-like                      124   2e-30   
ref|XP_004147271.1|  PREDICTED: uncharacterized protein LOC101215618    124   2e-30   
ref|XP_010494851.1|  PREDICTED: protein TORNADO 2-like                  124   2e-30   
emb|CDY65436.1|  BnaCnng47130D                                          124   2e-30   
emb|CDY29876.1|  BnaA03g48970D                                          123   2e-30   
ref|XP_009131934.1|  PREDICTED: tetraspanin-3                           124   2e-30   
ref|XP_003522911.1|  PREDICTED: tetraspanin-7                           123   2e-30   
ref|XP_011008848.1|  PREDICTED: tetraspanin-3-like                      124   2e-30   
ref|XP_001751676.1|  predicted protein                                  123   3e-30   
emb|CDY63355.1|  BnaCnng41940D                                          123   3e-30   
ref|XP_007015493.1|  Tetraspanin3                                       123   3e-30   
emb|CDX88744.1|  BnaA03g09050D                                          123   4e-30   
ref|XP_006412999.1|  hypothetical protein EUTSA_v10025997mg             122   4e-30   
ref|XP_004956869.1|  PREDICTED: tetraspanin-8-like                      124   4e-30   
ref|XP_010548632.1|  PREDICTED: tetraspanin-8-like                      123   4e-30   
ref|XP_010278028.1|  PREDICTED: tetraspanin-8-like                      122   5e-30   
ref|XP_008463449.1|  PREDICTED: tetraspanin-3-like                      122   6e-30   
gb|EYU35779.1|  hypothetical protein MIMGU_mgv1a011341mg                122   7e-30   
ref|XP_004251266.1|  PREDICTED: tetraspanin-3                           122   1e-29   
ref|XP_009137756.1|  PREDICTED: tetraspanin-7-like                      121   1e-29   
ref|XP_009144138.1|  PREDICTED: tetraspanin-7                           121   1e-29   
gb|ACH61589.1|  tetraspanin                                             117   1e-29   
emb|CDY19009.1|  BnaC01g20590D                                          121   2e-29   
ref|XP_010323228.1|  PREDICTED: tetraspanin-8-like                      121   2e-29   
gb|ACH61588.1|  tetraspanin                                             117   2e-29   
ref|XP_008363477.1|  PREDICTED: tetraspanin-3-like                      122   2e-29   
gb|KFK27219.1|  hypothetical protein AALP_AA8G353100                    120   2e-29   
emb|CDP08932.1|  unnamed protein product                                121   2e-29   
ref|XP_008359145.1|  PREDICTED: tetraspanin-3-like                      120   2e-29   
ref|XP_006365744.1|  PREDICTED: tetraspanin-3-like                      121   2e-29   
emb|CDY03200.1|  BnaC09g19560D                                          120   2e-29   
ref|XP_002284871.1|  PREDICTED: tetraspanin-3                           121   2e-29   
ref|XP_009114334.1|  PREDICTED: protein TORNADO 2                       120   2e-29   
emb|CDY35176.1|  BnaA09g18130D                                          120   3e-29   
ref|XP_006366390.1|  PREDICTED: tetraspanin-3-like                      121   3e-29   
emb|CDX87687.1|  BnaC02g32620D                                          120   3e-29   
gb|EAY88160.1|  hypothetical protein OsI_09600                          120   4e-29   
emb|CDY33846.1|  BnaC06g05070D                                          120   5e-29   
ref|XP_010067293.1|  PREDICTED: tetraspanin-5-like                      120   6e-29   
gb|KHG00511.1|  Tetraspanin-5                                           120   6e-29   
ref|XP_010666036.1|  PREDICTED: tetraspanin-3-like                      120   7e-29   
gb|EPS57712.1|  hypothetical protein M569_17105                         117   8e-29   
ref|XP_003569039.1|  PREDICTED: tetraspanin-3                           119   9e-29   
gb|KFK27542.1|  hypothetical protein AALP_AA8G396900                    119   1e-28   
ref|XP_007158293.1|  hypothetical protein PHAVU_002G140500g             119   1e-28   
ref|XP_010536954.1|  PREDICTED: tetraspanin-7 isoform X1                119   1e-28   
ref|XP_004294676.1|  PREDICTED: tetraspanin-3                           119   1e-28   
ref|XP_009595213.1|  PREDICTED: tetraspanin-8-like                      119   1e-28   
ref|XP_009790992.1|  PREDICTED: tetraspanin-8-like                      119   1e-28   
ref|XP_008782113.1|  PREDICTED: tetraspanin-8-like                      119   1e-28   
ref|XP_002864674.1|  hypothetical protein ARALYDRAFT_358240             119   1e-28   
ref|XP_003612880.1|  hypothetical protein MTR_5g030070                  118   2e-28   
gb|EYU37288.1|  hypothetical protein MIMGU_mgv1a0252071mg               116   2e-28   
gb|KJB35595.1|  hypothetical protein B456_006G121100                    119   2e-28   
gb|EYU18881.1|  hypothetical protein MIMGU_mgv1a011337mg                119   2e-28   
emb|CDY66746.1|  BnaA02g36810D                                          118   2e-28   
ref|XP_009346587.1|  PREDICTED: tetraspanin-3-like                      120   2e-28   
ref|XP_006343564.1|  PREDICTED: tetraspanin-8-like                      118   2e-28   
gb|EYU37117.1|  hypothetical protein MIMGU_mgv1a011888mg                118   3e-28   
ref|XP_008385375.1|  PREDICTED: LOW QUALITY PROTEIN: tetraspanin-...    115   3e-28   
ref|XP_006291626.1|  hypothetical protein CARUB_v10017777mg             118   3e-28   
ref|XP_004507785.1|  PREDICTED: tetraspanin-8-like                      117   3e-28   
gb|EYU35757.1|  hypothetical protein MIMGU_mgv1a025059mg                115   4e-28   
ref|XP_011089862.1|  PREDICTED: tetraspanin-3-like                      117   4e-28   
ref|XP_003518112.1|  PREDICTED: tetraspanin-6-like                      117   4e-28   
ref|NP_194534.1|  tetraspanin7                                          117   6e-28   
gb|EPS68352.1|  hypothetical protein M569_06417                         117   6e-28   
gb|EPS59240.1|  hypothetical protein M569_15569                         117   8e-28   
gb|AAC34855.1|  senescence-associated protein 5                         117   8e-28   
ref|XP_009421374.1|  PREDICTED: tetraspanin-3-like                      118   9e-28   
ref|XP_010913593.1|  PREDICTED: tetraspanin-8                           116   1e-27   
ref|XP_008465983.1|  PREDICTED: protein TORNADO 2                       116   1e-27   
gb|EMT06510.1|  hypothetical protein F775_29946                         116   2e-27   
ref|XP_009392709.1|  PREDICTED: tetraspanin-3-like                      115   2e-27   
ref|XP_002439201.1|  hypothetical protein SORBIDRAFT_09g002180          115   2e-27   
ref|XP_010907527.1|  PREDICTED: tetraspanin-3-like                      115   2e-27   
ref|XP_008789048.1|  PREDICTED: tetraspanin-3-like                      115   3e-27   
ref|XP_010104140.1|  hypothetical protein L484_014426                   115   3e-27   
ref|XP_011040964.1|  PREDICTED: tetraspanin-6-like                      115   3e-27   
gb|EPS74025.1|  hypothetical protein M569_00725                         115   4e-27   
ref|XP_006412707.1|  hypothetical protein EUTSA_v10027429mg             115   4e-27   
gb|AAS72369.2|  unknown protein                                         115   4e-27   
gb|EAZ37424.1|  hypothetical protein OsJ_21759                          115   5e-27   
ref|XP_010904608.1|  PREDICTED: tetraspanin-7-like                      114   8e-27   
ref|XP_009101498.1|  PREDICTED: protein TORNADO 2-like                  114   9e-27   
emb|CDY69909.1|  BnaCnng65910D                                          114   1e-26   
gb|EYU36212.1|  hypothetical protein MIMGU_mgv1a017682mg                114   1e-26   
dbj|BAJ95987.1|  predicted protein                                      114   1e-26   
ref|XP_002315294.2|  hypothetical protein POPTR_0010s22710g             114   1e-26   
gb|AFW82779.1|  hypothetical protein ZEAMMB73_637871                    114   1e-26   
ref|XP_008792155.1|  PREDICTED: tetraspanin-3-like                      113   2e-26   
ref|NP_001148512.1|  senescence-associated protein                      113   2e-26   
ref|XP_002970689.1|  hypothetical protein SELMODRAFT_231660             113   2e-26   
gb|ACG34584.1|  senescence-associated protein                           113   2e-26   
ref|XP_002969357.1|  hypothetical protein SELMODRAFT_231326             112   2e-26   
ref|XP_006436273.1|  hypothetical protein CICLE_v10032346mg             113   2e-26   
ref|XP_002993319.1|  hypothetical protein SELMODRAFT_187373             112   2e-26   
ref|XP_010663513.1|  PREDICTED: tetraspanin-8                           112   2e-26   
ref|XP_002312022.2|  hypothetical protein POPTR_0008s04120g             113   3e-26   
ref|XP_004960341.1|  PREDICTED: tetraspanin-4-like                      113   3e-26   
gb|ACN33366.1|  unknown                                                 113   3e-26   
ref|NP_001148981.1|  LOC100282601                                       113   3e-26   
ref|XP_003548017.1|  PREDICTED: tetraspanin-6                           112   3e-26   
ref|XP_009405827.1|  PREDICTED: tetraspanin-3-like                      112   3e-26   
ref|XP_006653991.1|  PREDICTED: tetraspanin-3-like                      112   4e-26   
gb|EAZ22262.1|  hypothetical protein OsJ_05917                          112   4e-26   
gb|KDO48445.1|  hypothetical protein CISIN_1g023538mg                   112   4e-26   
ref|XP_004251785.1|  PREDICTED: tetraspanin-8-like                      112   5e-26   
ref|XP_010920922.1|  PREDICTED: tetraspanin-3                           112   5e-26   
ref|XP_011031763.1|  PREDICTED: tetraspanin-6-like                      111   8e-26   
ref|XP_002970024.1|  hypothetical protein SELMODRAFT_231423             111   8e-26   
ref|XP_007052175.1|  Tetraspanin7, putative                             111   1e-25   
ref|XP_010253609.1|  PREDICTED: tetraspanin-6-like                      111   1e-25   
ref|XP_007009791.1|  Tetraspanin-31-A                                   111   1e-25   
ref|XP_002867349.1|  hypothetical protein ARALYDRAFT_328673             110   2e-25   
ref|XP_010099634.1|  hypothetical protein L484_013426                   111   3e-25   
ref|XP_003536360.1|  PREDICTED: tetraspanin-6                           110   3e-25   
ref|XP_007151754.1|  hypothetical protein PHAVU_004G071900g             109   6e-25   
ref|XP_004162695.1|  PREDICTED: uncharacterized protein LOC101225849    108   6e-25   
ref|XP_009333713.1|  PREDICTED: tetraspanin-6                           109   6e-25   
ref|XP_004144706.1|  PREDICTED: uncharacterized protein LOC101213840    108   6e-25   
ref|XP_010032211.1|  PREDICTED: tetraspanin-6                           108   7e-25   
gb|ACJ84657.1|  unknown                                                 107   8e-25   
ref|XP_002534549.1|  conserved hypothetical protein                     108   8e-25   
ref|XP_010456164.1|  PREDICTED: LOW QUALITY PROTEIN: tetraspanin-...    108   1e-24   
ref|XP_006350060.1|  PREDICTED: tetraspanin-8-like                      108   1e-24   
emb|CDX68658.1|  BnaC01g07950D                                          108   1e-24   
ref|XP_008452368.1|  PREDICTED: tetraspanin-8-like                      108   1e-24   
ref|NP_001240229.1|  uncharacterized protein LOC100812912               108   2e-24   
gb|KHN00831.1|  hypothetical protein glysoja_000499                     107   2e-24   
gb|KJB74723.1|  hypothetical protein B456_012G004000                    107   2e-24   
gb|KHG03573.1|  hypothetical protein F383_00113                         107   2e-24   
ref|XP_006477445.1|  PREDICTED: LOW QUALITY PROTEIN: tetraspanin-...    107   2e-24   
ref|XP_008365842.1|  PREDICTED: tetraspanin-6-like                      107   2e-24   
ref|XP_007218782.1|  hypothetical protein PRUPE_ppa009675mg             107   3e-24   
ref|XP_008233340.1|  PREDICTED: tetraspanin-6                           107   3e-24   
gb|KDP25723.1|  hypothetical protein JCGZ_23944                         107   4e-24   
ref|XP_010264737.1|  PREDICTED: tetraspanin-6-like                      107   4e-24   
gb|AFK37296.1|  unknown                                                 106   5e-24   
ref|XP_006440591.1|  hypothetical protein CICLE_v10021645mg             106   5e-24   
gb|ACU19249.1|  unknown                                                 106   6e-24   
ref|NP_001054524.1|  Os05g0126100                                       106   6e-24   
ref|XP_002468706.1|  hypothetical protein SORBIDRAFT_01g050590          106   6e-24   
ref|XP_006440590.1|  hypothetical protein CICLE_v10021645mg             106   6e-24   
ref|XP_006340032.1|  PREDICTED: tetraspanin-6-like                      106   6e-24   
ref|XP_004237551.1|  PREDICTED: tetraspanin-6                           106   8e-24   
gb|KEH21038.1|  tetraspanin family protein                              106   8e-24   
ref|XP_002276217.1|  PREDICTED: tetraspanin-6                           105   9e-24   
ref|XP_009127829.1|  PREDICTED: tetraspanin-9                           105   1e-23   
gb|KFK40515.1|  hypothetical protein AALP_AA2G006000                    105   1e-23   
gb|AAS90676.1|  putative senescence-associated protein                  105   1e-23   
emb|CDY01100.1|  BnaC05g41000D                                          105   1e-23   
ref|XP_009619031.1|  PREDICTED: tetraspanin-6                           105   1e-23   
ref|NP_001132749.1|  hypothetical protein                               103   1e-23   
ref|XP_006653999.1|  PREDICTED: tetraspanin-6-like                      104   3e-23   
ref|XP_008382130.1|  PREDICTED: tetraspanin-6-like                      105   3e-23   
ref|XP_010039115.1|  PREDICTED: tetraspanin-11                          104   3e-23   
ref|XP_009795600.1|  PREDICTED: tetraspanin-6                           104   4e-23   
ref|XP_009146649.1|  PREDICTED: tetraspanin-6                           104   4e-23   
ref|XP_008455318.1|  PREDICTED: tetraspanin-8-like                      104   5e-23   
gb|KFK38574.1|  hypothetical protein AALP_AA3G131100                    103   5e-23   
ref|XP_004973111.1|  PREDICTED: tetraspanin-8-like                      103   5e-23   
gb|AAM61510.1|  senescence-associated protein-like protein              103   5e-23   
ref|XP_004137611.1|  PREDICTED: uncharacterized protein LOC101205414    103   6e-23   
ref|NP_194772.1|  tetraspanin9                                          103   6e-23   
dbj|BAK04424.1|  predicted protein                                      103   6e-23   
ref|XP_006407373.1|  hypothetical protein EUTSA_v10021277mg             103   7e-23   
ref|XP_006302696.1|  hypothetical protein CARUB_v10020806mg             103   7e-23   
dbj|BAK02461.1|  predicted protein                                      103   7e-23   
ref|XP_007143690.1|  hypothetical protein PHAVU_007G093400g             103   1e-22   
ref|XP_010473567.1|  PREDICTED: tetraspanin-10-like isoform X3          102   1e-22   
ref|XP_004515993.1|  PREDICTED: tetraspanin-6-like                      102   1e-22   
ref|XP_003574158.1|  PREDICTED: tetraspanin-10                          102   1e-22   



>ref|XP_009785507.1| PREDICTED: tetraspanin-2 [Nicotiana sylvestris]
Length=269

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            MSLSNNITAFLNF+AFMCSIPI AAG WLASKPDNECIHWLRWPVVF+G+A+MLVSLAGF
Sbjct  1    MSLSNNITAFLNFVAFMCSIPIIAAGTWLASKPDNECIHWLRWPVVFMGLAVMLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYWKKEGLLG+YLVCMAILIILLL LL+LAFVVTRPSGAYSVPGRGY EYRL G+SSW
Sbjct  61   VGAYWKKEGLLGVYLVCMAILIILLLVLLVLAFVVTRPSGAYSVPGRGYSEYRLAGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRNHITSSD+WGKIRACLAD ++CPKLNNEF TA+QFFAAHLSP+Q
Sbjct  121  LRNHITSSDNWGKIRACLADSNVCPKLNNEFITADQFFAAHLSPIQ  166



>ref|XP_009603765.1| PREDICTED: tetraspanin-2-like [Nicotiana tomentosiformis]
Length=269

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            MSLSNNITAFLNF+AFMCSIPI AAG WLASKPDNECIHWLRWPVVF+G+A+MLVSL GF
Sbjct  1    MSLSNNITAFLNFVAFMCSIPIIAAGTWLASKPDNECIHWLRWPVVFMGLAVMLVSLVGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYWKKEGLLG+YLVCMAILIILLL LL+LAFVVTRP+GAY VPGRGY EYRL  +SSW
Sbjct  61   VGAYWKKEGLLGVYLVCMAILIILLLVLLVLAFVVTRPNGAYLVPGRGYSEYRLARFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRNHITSSD+WGKIRACLAD +ICPKLNNEF TA+QFFAAHLSP+Q
Sbjct  121  LRNHITSSDNWGKIRACLADSNICPKLNNEFITADQFFAAHLSPIQ  166



>ref|XP_009631964.1| PREDICTED: tetraspanin-2-like [Nicotiana tomentosiformis]
Length=264

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  143  SLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFA  322
            +LSNNITAFLNFLAFMCSIPI  +G WLASKPDNECIHWLRWP+VFIGIAIMLVSL GF 
Sbjct  3    NLSNNITAFLNFLAFMCSIPIITSGTWLASKPDNECIHWLRWPIVFIGIAIMLVSLTGFV  62

Query  323  GAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWL  502
            GAYWKKEGLLG+YLVCMAILI+LLL LL+LAFVVT PSG+Y VPGR Y EYRL G+S WL
Sbjct  63   GAYWKKEGLLGVYLVCMAILIVLLLLLLVLAFVVTGPSGSYMVPGRAYREYRLQGFSYWL  122

Query  503  RNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            R+HITS+D+WG IRACLAD  ICP+LNN++ TAE FFAAHLSP+Q
Sbjct  123  RDHITSADNWGNIRACLADSGICPRLNNQYVTAEHFFAAHLSPIQ  167



>emb|CDP03178.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   261 bits (668),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITAFLNFLA MCSIPI A+GIWLASKPDNECIHWLRWPVVF+GIA++LVSL GF
Sbjct  1    MAVSNNITAFLNFLALMCSIPIIASGIWLASKPDNECIHWLRWPVVFLGIAVLLVSLTGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYWKKEGLLGLYLVCMAILI+LLL  LILAFVV RPSGAY VPG+GY EYRL G+SSW
Sbjct  61   VGAYWKKEGLLGLYLVCMAILIVLLLVFLILAFVVARPSGAYDVPGKGYQEYRLEGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRNHITSSD+WG IRACLAD  IC KLN E+ T++ FF AHLSP++
Sbjct  121  LRNHITSSDNWGNIRACLADSGICLKLNEEYPTSDLFFNAHLSPIE  166



>ref|XP_004242965.1| PREDICTED: tetraspanin-2-like [Solanum lycopersicum]
Length=269

 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            MSLSNNITAFLNF+AFMCSIPI AAG WLASKPDNECIHWLRWPVVF+G+A+MLVSLAGF
Sbjct  1    MSLSNNITAFLNFVAFMCSIPIIAAGTWLASKPDNECIHWLRWPVVFMGLAVMLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYWKKEGLLG+YLVCMAILII LL LL+LAFVVTRP+GAYSVPG+GY EYRL G+SSW
Sbjct  61   VGAYWKKEGLLGVYLVCMAILIIFLLVLLVLAFVVTRPNGAYSVPGKGYSEYRLAGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRN IT   SWG IRACLA  DICPKLN    TA+QFFAAHLSP++
Sbjct  121  LRNRITDGHSWGNIRACLAVSDICPKLNTHIITADQFFAAHLSPIK  166



>ref|XP_006361826.1| PREDICTED: tetraspanin-2-like [Solanum tuberosum]
Length=269

 Score =   256 bits (655),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            MS+SNNITAFLNF+AFM SIPI AAG WLASKPDNECIHWLRWPVVF+G+ +MLVSLAGF
Sbjct  1    MSMSNNITAFLNFVAFMFSIPIIAAGTWLASKPDNECIHWLRWPVVFMGLVVMLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW+KEGLLG+YLVCMAILIILLL LL+LAFVVTRP+G Y VPG+GY EYRL G+SSW
Sbjct  61   VGAYWEKEGLLGVYLVCMAILIILLLVLLVLAFVVTRPNGEYFVPGKGYSEYRLAGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRN IT  DSWG IRACL   DICPKLN E  TA+QFFA HLSP++
Sbjct  121  LRNRITDGDSWGNIRACLPVSDICPKLNTEIITADQFFATHLSPIK  166



>ref|XP_009779686.1| PREDICTED: tetraspanin-2-like [Nicotiana sylvestris]
Length=264

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  143  SLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFA  322
            +LSNNITAFLNFLAFMCSIPI A+G WLASKPDNECIHWLRWPV+FIGIAIMLVSL GF 
Sbjct  3    NLSNNITAFLNFLAFMCSIPIIASGTWLASKPDNECIHWLRWPVIFIGIAIMLVSLTGFV  62

Query  323  GAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWL  502
            GAYWKKEGLLG+YLVCMAILI+LLL LL+LAFVVT P+G+Y VPGR Y EYRL G+S WL
Sbjct  63   GAYWKKEGLLGVYLVCMAILIVLLLVLLVLAFVVTGPTGSYMVPGRAYREYRLEGFSYWL  122

Query  503  RNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            R+HITS+D+WG IRACLAD  ICP+LNN++ +AEQFFAA LSP+Q
Sbjct  123  RDHITSADNWGNIRACLADSGICPRLNNQYVSAEQFFAADLSPIQ  167



>ref|XP_004234795.1| PREDICTED: tetraspanin-2-like [Solanum lycopersicum]
Length=265

 Score =   244 bits (624),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            MS SNNITAFLNFLAFMCSIPI A+G WLAS PDNECIHWLRWPVVFIGIAIMLVSL GF
Sbjct  1    MSSSNNITAFLNFLAFMCSIPIIASGTWLASNPDNECIHWLRWPVVFIGIAIMLVSLTGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYWKKEGLLG+YLVCMA+LI+LLL LL+LAFVVT P+GAY VPGR Y +YRL G+S W
Sbjct  61   IGAYWKKEGLLGVYLVCMALLIVLLLVLLVLAFVVTGPTGAYMVPGRAYSDYRLEGFSYW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+HI   D+WG IRACLAD  IC KLNN + TAEQFFA  LSP+Q
Sbjct  121  LRDHIVGPDNWGNIRACLADSAICSKLNNHYVTAEQFFAVDLSPIQ  166



>ref|XP_006349548.1| PREDICTED: tetraspanin-2-like [Solanum tuberosum]
Length=265

 Score =   244 bits (623),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            MS SNNITAFLNFLAFMCSIPI A+G WLAS PDNECIHWLRWPVVFIGIAIMLVSL GF
Sbjct  1    MSSSNNITAFLNFLAFMCSIPIIASGTWLASNPDNECIHWLRWPVVFIGIAIMLVSLTGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYWKKEGLLG+YLVCMA+LI+LLL LL+LAFVVT P+G Y VPGR Y +YRL G+S W
Sbjct  61   IGAYWKKEGLLGVYLVCMALLIVLLLVLLVLAFVVTGPTGDYMVPGRAYRDYRLEGFSYW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+HI   D+WG IRACLAD  IC KLNN++ TAEQFFAA +SP+Q
Sbjct  121  LRDHIVGPDNWGNIRACLADSAICSKLNNQYVTAEQFFAADISPIQ  166



>ref|XP_011077968.1| PREDICTED: tetraspanin-2 [Sesamum indicum]
Length=269

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA LNF+A MCSIPI +AGIWLASKPDNECIHWLRWP+VF+GIA ++V+L GF
Sbjct  1    MAVSNNITAILNFVALMCSIPIISAGIWLASKPDNECIHWLRWPLVFLGIAFLVVALTGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYWKKEGLLG+YLVCM ILI+LLL LL+LAFVVTRP G+Y VPG G+ EYRL G+SSW
Sbjct  61   VGAYWKKEGLLGVYLVCMFILIVLLLVLLVLAFVVTRPDGSYPVPGMGFREYRLEGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+HIT +D+WGKIRACLAD  ICPKLN +F +A  FFAAHLSP++
Sbjct  121  LRDHITGNDNWGKIRACLADSQICPKLNQKFISAADFFAAHLSPIE  166



>ref|XP_007012865.1| Tetraspanin2 [Theobroma cacao]
 gb|EOY30484.1| Tetraspanin2 [Theobroma cacao]
Length=269

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M ++NNITA LNF+A +CSIPI AAGIWLASKPDN CIH  RWPVV +G  I+LVSLAGF
Sbjct  1    MGVANNITAVLNFVALLCSIPIIAAGIWLASKPDNNCIHLFRWPVVLLGFLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW KE LL  YL CMAILI LLL LL+ AF+VTRP G+Y VPGRGY EYRL GYSSW
Sbjct  61   VGAYWYKETLLAFYLCCMAILIGLLLILLVFAFIVTRPDGSYDVPGRGYKEYRLDGYSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRNH+  S SW KIRACLAD D+CPKL  ++ TA+QFFAAH++PLQ
Sbjct  121  LRNHVVDSKSWNKIRACLADTDVCPKLTQQYITADQFFAAHITPLQ  166



>gb|EYU27305.1| hypothetical protein MIMGU_mgv1a011848mg [Erythranthe guttata]
Length=269

 Score =   236 bits (603),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNN+TA LNF+A MCSIPI +AGIWLASKPDN+CI WLRWP+VFIG+A +LV+L GF
Sbjct  1    MAVSNNLTALLNFVALMCSIPIISAGIWLASKPDNDCIRWLRWPLVFIGLAFLLVTLTGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYWKKEGLLG+YLVCM ILI+LLL +L+LAFVVTRP+GAY+ PG G+ EYRL G+SSW
Sbjct  61   VGAYWKKEGLLGVYLVCMFILIVLLLVVLVLAFVVTRPNGAYASPGMGFHEYRLEGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+H+TSSD+WG IRACLAD   CPKLN  F +A  FFAAHLSP+Q
Sbjct  121  LRDHVTSSDNWGGIRACLADSQTCPKLNQRFISAADFFAAHLSPVQ  166



>ref|XP_010262176.1| PREDICTED: tetraspanin-2-like [Nelumbo nucifera]
Length=269

 Score =   231 bits (589),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LNFLA +CSIPI  AGIWLASK DNEC+H+ RWPVV IG+ I+LVSLAGF
Sbjct  1    MGVSNNITALLNFLALLCSIPIIGAGIWLASKADNECVHYFRWPVVVIGVLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW ++GLL  YL CMA+LI++LL LL+ AFVVTRP G+Y V GRGY EYRL G+SSW
Sbjct  61   VGAYWNRQGLLAFYLFCMAVLIVILLVLLVFAFVVTRPDGSYDVAGRGYKEYRLDGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRN +T+S +W KIR CLA+ ++C KL  ++ TA+QFFAAH+SPLQ
Sbjct  121  LRNQVTNSANWNKIRTCLANSNVCSKLTQDYSTADQFFAAHISPLQ  166



>ref|XP_011014710.1| PREDICTED: tetraspanin-2 [Populus euphratica]
Length=269

 Score =   228 bits (582),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M ++NNITA LNF+AF+CSIPI AAGIWLASKPDNECIH  RWPVV +G  I+LVSLAGF
Sbjct  1    MGVANNITAILNFIAFLCSIPIIAAGIWLASKPDNECIHLFRWPVVLLGFLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW KE LL  YL CMAILI LLL LL+ AFVVTR  G Y VPGRGY EYRL G+SSW
Sbjct  61   VGAYWYKETLLAFYLCCMAILIGLLLILLVFAFVVTRADGGYDVPGRGYREYRLEGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRNHI  S++W KIR CLA+ D+C KL   + T +QFF AH+SPLQ
Sbjct  121  LRNHIVYSNNWDKIRPCLAETDVCSKLTQNYITVDQFFMAHISPLQ  166



>ref|XP_004287540.1| PREDICTED: tetraspanin-2 [Fragaria vesca subsp. vesca]
Length=269

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SN ITA LNF+A +CSIPI AAGIWLASKPDNECIH +RWPV  +G+ I+LVSLAGF
Sbjct  1    MGVSNKITAVLNFMALLCSIPIMAAGIWLASKPDNECIHSVRWPVFVLGVLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY+ K+GLL LYL CMA LIILLL +LI AF VTRP G+Y+VPGR Y EYRL G+S W
Sbjct  61   IGAYFNKQGLLALYLFCMAALIILLLIVLIFAFTVTRPDGSYAVPGRAYREYRLEGFSKW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+++T S +W KIR CLAD D CPKL   + TA+QFF AH+SPLQ
Sbjct  121  LRDYVTDSSNWQKIRVCLADSDTCPKLTENYITADQFFTAHISPLQ  166



>ref|XP_002308295.1| senescence-associated family protein [Populus trichocarpa]
 gb|ABK93550.1| unknown [Populus trichocarpa]
 gb|EEE91818.1| senescence-associated family protein [Populus trichocarpa]
Length=269

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M ++NNITA LNF+AF+CSIPI AAGIWLASKP+NECIH  RWPVV +G  I+LVSLAGF
Sbjct  1    MGVANNITAVLNFIAFLCSIPIIAAGIWLASKPENECIHLFRWPVVLLGFLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW KE LL  YL CMAILI LLL LL+ AFVVTR  G Y VPGRGY EYRL G+S+W
Sbjct  61   VGAYWYKETLLAFYLCCMAILIGLLLILLVFAFVVTRADGGYDVPGRGYREYRLQGFSAW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRNH+  S +W KIR CLA+ D+C K+   + TA+QFF AH+SPLQ
Sbjct  121  LRNHVVYSKNWDKIRPCLAETDVCSKMTQNYITADQFFMAHISPLQ  166



>ref|XP_008459286.1| PREDICTED: tetraspanin-2 [Cucumis melo]
Length=269

 Score =   224 bits (572),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M LSNNITA LNFLA +CSIPI  AGIWLASKPDNECIH+ RWPVV IG+ I+LVSLAGF
Sbjct  1    MGLSNNITAILNFLALLCSIPIIGAGIWLASKPDNECIHFFRWPVVIIGVLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW ++GLL  YL CMA+LI LLL LL+  FVVTRP G+Y+V GRG+ EYRL G+SSW
Sbjct  61   IGAYWNRQGLLAFYLFCMAVLIGLLLVLLVFTFVVTRPDGSYTVMGRGFKEYRLDGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L++H+T+S +W KIR CLA+ D+CPKLN ++F A+QFFAA +SPLQ
Sbjct  121  LKSHLTNSRNWPKIRTCLAESDVCPKLNQQYFAADQFFAADISPLQ  166



>ref|XP_004141051.1| PREDICTED: uncharacterized protein LOC101204213 [Cucumis sativus]
 ref|XP_004157920.1| PREDICTED: uncharacterized protein LOC101223702 [Cucumis sativus]
 gb|KGN60543.1| hypothetical protein Csa_2G000510 [Cucumis sativus]
Length=269

 Score =   224 bits (572),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M LSNNITA LNFLA +CSIPI  AGIWLASKPDNECIH+ RWPVV IG+ I+LVSLAGF
Sbjct  1    MGLSNNITAILNFLALLCSIPIIGAGIWLASKPDNECIHFFRWPVVLIGVLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW ++GLL  YL CMA+LI LLL LL+  FVVTRP G+Y+V GRG+ EYRL G+SSW
Sbjct  61   IGAYWNRQGLLAFYLFCMALLIGLLLVLLVFTFVVTRPDGSYTVMGRGFKEYRLDGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L++H+T+S +W KIR CLA+ D+CPKLN ++F A+QFFAA +SPLQ
Sbjct  121  LKSHLTNSRNWPKIRTCLAESDVCPKLNQQYFAADQFFAADISPLQ  166



>gb|KJB06764.1| hypothetical protein B456_001G011200 [Gossypium raimondii]
Length=266

 Score =   224 bits (571),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LN +A +CSIPI AAGIWL  KPDN C+H +RWPV+ +G  I+LVSLAGF
Sbjct  1    MGVSNNITAVLNIVALLCSIPIIAAGIWLDQKPDNACVHLIRWPVILLGFLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL  YL CMAILI LLL LL+ AFVVTRP G+Y VPG+GY EYRL GYS+W
Sbjct  61   VGAYRYKETLLAFYLCCMAILIALLLILLVFAFVVTRPDGSYDVPGKGYKEYRLDGYSAW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+H+  + SW KI+ACLAD  +CPKL  +F TA+QFFAAH+SPLQ
Sbjct  121  LRDHVVDNKSWRKIKACLADTGVCPKLTQKFITADQFFAAHISPLQ  166



>gb|KJB06763.1| hypothetical protein B456_001G011200 [Gossypium raimondii]
Length=266

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LN +A +CSIPI AAGIWL  KPDN C+H +RWPV+ +G  I+LVSLAGF
Sbjct  1    MGVSNNITAVLNIVALLCSIPIIAAGIWLDQKPDNACVHLIRWPVILLGFLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL  YL CMAILI LLL LL+ AFVVTRP G+Y VPG+GY EYRL GYS+W
Sbjct  61   VGAYRYKETLLAFYLCCMAILIALLLILLVFAFVVTRPDGSYDVPGKGYKEYRLDGYSAW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+H+  + SW KI+ACLAD  +CPKL  +F TA+QFFAAH+SPLQ
Sbjct  121  LRDHVVDNKSWRKIKACLADTGVCPKLTQKFITADQFFAAHISPLQ  166



>gb|KJB54355.1| hypothetical protein B456_009G031000 [Gossypium raimondii]
Length=269

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M L+N ITA LNF AF+CSIPI AAGIW A KPDN CIH  RWPV+ +G  I+LVSLAGF
Sbjct  1    MGLANYITAVLNFAAFLCSIPIIAAGIWFAQKPDNVCIHLFRWPVIVLGFLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA + K+ LL  YL CMAILI LLL LL+ AFVVTRP G+Y VPG+GY EYR+ GYSSW
Sbjct  61   VGACFYKKTLLAFYLCCMAILIALLLILLVFAFVVTRPDGSYDVPGKGYKEYRVDGYSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRN I  S SW KIR+CLAD D+CPKLN ++ T +QFFAAHLSPLQ
Sbjct  121  LRNRIVDSKSWNKIRSCLADTDVCPKLNQQYITVDQFFAAHLSPLQ  166



>gb|KJB54354.1| hypothetical protein B456_009G031000 [Gossypium raimondii]
Length=269

 Score =   223 bits (569),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M L+N ITA LNF AF+CSIPI AAGIW A KPDN CIH  RWPV+ +G  I+LVSLAGF
Sbjct  1    MGLANYITAVLNFAAFLCSIPIIAAGIWFAQKPDNVCIHLFRWPVIVLGFLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA + K+ LL  YL CMAILI LLL LL+ AFVVTRP G+Y VPG+GY EYR+ GYSSW
Sbjct  61   VGACFYKKTLLAFYLCCMAILIALLLILLVFAFVVTRPDGSYDVPGKGYKEYRVDGYSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRN I  S SW KIR+CLAD D+CPKLN ++ T +QFFAAHLSPLQ
Sbjct  121  LRNRIVDSKSWNKIRSCLADTDVCPKLNQQYITVDQFFAAHLSPLQ  166



>ref|XP_002282397.1| PREDICTED: tetraspanin-2 [Vitis vinifera]
Length=269

 Score =   223 bits (569),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA LNFLA +CSIPI AAGIWLASKPDNECIH  RWPV  +G+ I+LVSLAGF
Sbjct  1    MAVSNNITAVLNFLALLCSIPIIAAGIWLASKPDNECIHLFRWPVALLGVLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW K+GLL  YL CM +LI LLL LL+ AFVV+   G+Y VPGR Y EYRL G+SSW
Sbjct  61   VGAYWNKKGLLAFYLFCMGLLIGLLLILLVFAFVVSHSDGSYVVPGRAYKEYRLEGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRN++T S +W KIR CLA  D+C KL+  + TA+QFF AH+SPLQ
Sbjct  121  LRNYVTKSGNWNKIRTCLAQSDVCSKLSQNYITADQFFMAHISPLQ  166



>ref|XP_010090033.1| hypothetical protein L484_027263 [Morus notabilis]
 gb|EXB38830.1| hypothetical protein L484_027263 [Morus notabilis]
Length=306

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            +SNNITA LNF+AF+CSIPI AAGIWLASKPDNECIH  RWPVV +G  I+LVSLAGF G
Sbjct  4    VSNNITAVLNFIAFLCSIPIIAAGIWLASKPDNECIHSFRWPVVVLGFLILLVSLAGFVG  63

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            AYW K+GLL LYL CMA+LI LLL LL+ AFVVTR  G+Y+VPGR Y EYRL G+S WLR
Sbjct  64   AYWNKQGLLALYLFCMAVLIALLLILLVFAFVVTRRDGSYAVPGRNYKEYRLDGFSDWLR  123

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            + + SS +W KIR CLAD D+C  L  ++  A+QFFAAH+SPLQ
Sbjct  124  DQVASSKNWAKIRTCLADSDVCTTLAQDYINADQFFAAHISPLQ  167



>ref|XP_010047582.1| PREDICTED: tetraspanin-2 [Eucalyptus grandis]
 gb|KCW79534.1| hypothetical protein EUGRSUZ_C00904 [Eucalyptus grandis]
Length=261

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNN+T+ LNF+AF+CS+PI AAGIWLASK DNEC H+ RWPVV +G  ++LVSLAGF
Sbjct  1    MGVSNNVTSVLNFIAFLCSVPIIAAGIWLASKADNECTHYFRWPVVILGTLVLLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW K+GLL  YL CMA+LI LLL +L+ A+VVTR  G YSVPGR Y EY LGGYS+W
Sbjct  61   VGAYWNKQGLLAFYLFCMAMLIGLLLIVLVFAYVVTREDGGYSVPGRDYREYSLGGYSAW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+H+T  ++W KIRACLA+ D+C +L   +  AEQ+FAA +SPLQ
Sbjct  121  LRDHVTDPENWVKIRACLAESDVCTRLAQNYVIAEQYFAARISPLQ  166



>ref|XP_008242412.1| PREDICTED: tetraspanin-2 [Prunus mume]
Length=269

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SN ITA LNF+A +C+IPI AAGIWLASKPDNECIH  RWPV  +G  ++LVSLAGF
Sbjct  1    MGVSNKITAILNFIALLCAIPIMAAGIWLASKPDNECIHSFRWPVFVLGALMLLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA + K+GLL LYL CMA LIIL+L LLI AF VTRP G+YSVPGR Y EYRL G+S W
Sbjct  61   IGACFNKQGLLALYLFCMAALIILILVLLIFAFTVTRPDGSYSVPGRAYREYRLDGFSKW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+++T S +W KIR CLAD D CPKLN ++ +A+QFF AH+SPLQ
Sbjct  121  LRDYVTDSGNWQKIRTCLADSDTCPKLNQQYISADQFFMAHISPLQ  166



>ref|XP_007202447.1| hypothetical protein PRUPE_ppa009984mg [Prunus persica]
 gb|EMJ03646.1| hypothetical protein PRUPE_ppa009984mg [Prunus persica]
Length=269

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SN ITA LNF+A +C+IPI AAGIWLASKPDNECIH  RWPV  +G  ++LVSLAGF
Sbjct  1    MGVSNKITAILNFIALLCAIPIMAAGIWLASKPDNECIHSFRWPVFVLGALMLLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA + K+GLL LYL CMA LIIL+L LLI AF VTRP G+YSVPGR Y EYRL G+S W
Sbjct  61   IGACFNKQGLLALYLFCMAALIILILVLLIFAFTVTRPDGSYSVPGRAYREYRLDGFSKW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+++T S +W KIR CLAD D CPKLN ++ +A+QFF AH+SPLQ
Sbjct  121  LRDYVTDSGTWQKIRTCLADSDTCPKLNQQYISADQFFMAHISPLQ  166



>ref|XP_010526407.1| PREDICTED: tetraspanin-2 [Tarenaya hassleriana]
Length=270

 Score =   219 bits (558),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+++NN+TA LNF+A +CSIPITA+GIWLASKPDNEC+H LRWP+V +G+ I++VS AGF
Sbjct  1    MAVANNLTAILNFIALLCSIPITASGIWLASKPDNECVHLLRWPIVTLGVLILVVSAAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGR Y EYRL  +S+W
Sbjct  61   IGAYWYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYPVPGRAYKEYRLEEFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAA-HLSPLQ  637
            LR+++  S +W KIRACLAD D+CPKL+ E+ TA+QFF++  ++PLQ
Sbjct  121  LRDNVVDSKNWIKIRACLADTDVCPKLSQEYITADQFFSSPDITPLQ  167



>ref|XP_010690424.1| PREDICTED: tetraspanin-2 [Beta vulgaris subsp. vulgaris]
Length=269

 Score =   219 bits (558),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+TA +NF+A +CSIPI A+G+WLASKPDNEC+H  RWPVV +G +I+++SL GF
Sbjct  1    MALSNNLTAIVNFIALLCSIPIIASGLWLASKPDNECVHLFRWPVVVLGFSILVISLMGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW KEGLL LYL CMAILI LLL LLI AFVVTRP G+Y VPGRG  EYR+ G+S+W
Sbjct  61   VGAYWYKEGLLALYLCCMAILITLLLVLLIFAFVVTRPDGSYGVPGRGSKEYRIDGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRNH+T+  +W KIR CL D + C KLN +F  A  FF AH+SPLQ
Sbjct  121  LRNHVTNDGNWFKIRNCLIDTNFCAKLNTQFVAAPDFFLAHISPLQ  166



>ref|XP_006298321.1| hypothetical protein CARUB_v10014386mg [Capsella rubella]
 gb|EOA31219.1| hypothetical protein CARUB_v10014386mg [Capsella rubella]
Length=270

 Score =   216 bits (551),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILIVSATGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYRL G+S W
Sbjct  61   IGAYKYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYRVPGRGYKEYRLEGFSDW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            L+ ++  S +W ++RACLAD ++CPKLN EF TA+QFF ++ ++PLQ
Sbjct  121  LKENVVDSKNWVRLRACLADTNVCPKLNQEFITADQFFSSSKITPLQ  167



>ref|XP_008337694.1| PREDICTED: tetraspanin-2 [Malus domestica]
Length=269

 Score =   216 bits (549),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SN ITA LNF+A +C+IPI +AGIWLASKPDNECI   RWPV  +G+ ++ VSLAGF
Sbjct  1    MGVSNRITATLNFIALLCAIPIMSAGIWLASKPDNECIRSFRWPVFILGLLMLFVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY+ K+GLL LYL CMA LIILLL LLI AF VTRP G+Y+VPGRGY EYRL G+S W
Sbjct  61   IGAYFNKQGLLALYLFCMAALIILLLVLLIFAFTVTRPGGSYAVPGRGYREYRLDGFSKW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+++  S +W KIR CLAD D CPKL  ++ +A+QFF AH+SPLQ
Sbjct  121  LRDYVRDSSNWQKIRNCLADSDTCPKLTQQYMSADQFFFAHISPLQ  166



>ref|XP_006298322.1| hypothetical protein CARUB_v10014386mg [Capsella rubella]
 gb|EOA31220.1| hypothetical protein CARUB_v10014386mg [Capsella rubella]
Length=270

 Score =   216 bits (549),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILIVSATGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYRL G+S W
Sbjct  61   IGAYKYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYRVPGRGYKEYRLEGFSDW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            L+ ++  S +W ++RACLAD ++CPKLN EF TA+QFF ++ ++PLQ
Sbjct  121  LKENVVDSKNWVRLRACLADTNVCPKLNQEFITADQFFSSSKITPLQ  167



>ref|XP_010242186.1| PREDICTED: tetraspanin-2 [Nelumbo nucifera]
Length=357

 Score =   216 bits (550),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNI A LNFLA +CSIPI   GIWLASKPDNEC+H+ RWPVV IG+ I+LVSLAGF
Sbjct  89   MAVSNNIIAILNFLALLCSIPIIGTGIWLASKPDNECVHYFRWPVVLIGVLILLVSLAGF  148

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW ++ LL  Y+ CMA+LI+LLL+LL+LAFVVTRP G+Y VP RGY EYRL G+SSW
Sbjct  149  VGAYWNRQCLLAFYIFCMAVLIVLLLALLVLAFVVTRPDGSYVVPRRGYKEYRLEGFSSW  208

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+H+T S +WGKIR CLA+ ++C KL+ ++ T +QFF AH+SPLQ
Sbjct  209  LRSHVTGSANWGKIRTCLANSNVCSKLSQDYITVDQFFMAHISPLQ  254



>ref|XP_002514142.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48096.1| conserved hypothetical protein [Ricinus communis]
Length=315

 Score =   214 bits (546),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M L+NNITA LNF+AF+CSIPI A+GIWLASKPDNECIH+ RWP+V +G+ I+LVSLAGF
Sbjct  1    MGLANNITAILNFIAFLCSIPIIASGIWLASKPDNECIHYFRWPLVILGVLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW KE LL  YL CMAILI L+L LL+ AFVVTR  G Y+VPGRGY EYR+ G+SSW
Sbjct  61   VGAYWYKETLLAFYLCCMAILIGLILILLVFAFVVTRADGGYTVPGRGYKEYRVEGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+NHI  S +W KIR CL++ D+C KL   + T++QFFAAH+SPLQ
Sbjct  121  LKNHIVDSKNWVKIRNCLSESDVCSKLIQNYITSDQFFAAHISPLQ  166



>gb|KDP33819.1| hypothetical protein JCGZ_07390 [Jatropha curcas]
Length=269

 Score =   213 bits (542),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M ++NNITA LNF+AF+CSIPI A+GIWLASKPDN CIH  RWPVV +GI ++LVSLAGF
Sbjct  1    MGVANNITAVLNFVAFLCSIPIIASGIWLASKPDNGCIHLFRWPVVLLGILVLLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW KE LLG YL CMAILI LLL LL+ AFVVTRP G Y VPGRGY EYRL G+SSW
Sbjct  61   VGAYWYKETLLGFYLCCMAILIGLLLILLVFAFVVTRPDGGYDVPGRGYKEYRLEGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRNH+ +S +W KIR CLA+ D+C KL+  + TA+QFF AH+SPLQ
Sbjct  121  LRNHVVNSKNWVKIRNCLAESDVCAKLSQNYITADQFFTAHISPLQ  166



>ref|XP_008366601.1| PREDICTED: tetraspanin-2-like [Malus domestica]
Length=269

 Score =   211 bits (538),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SN ITA LNF+A +C+IPI ++GIWLASKPDNECI   RWPV  +G  ++LV LAGF
Sbjct  1    MGVSNRITATLNFIALLCAIPIMSSGIWLASKPDNECIRSFRWPVFILGALMLLVCLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY+ K+GLL LYL CMA LIILLL LLI AF VTRP G+Y+VPGR Y EYRL G+S W
Sbjct  61   IGAYFNKQGLLALYLFCMAALIILLLVLLIFAFTVTRPDGSYTVPGRAYREYRLEGFSKW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+++T S +W KIR CLA+ D CPKL  ++ +A+QF  AH+SPLQ
Sbjct  121  LRDYVTDSSTWQKIRTCLAESDTCPKLTQQYMSADQFLFAHISPLQ  166



>ref|XP_004503540.1| PREDICTED: tetraspanin-2-like [Cicer arietinum]
Length=269

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LNF+A + SIPI A+GIWLAS  DN+CI+  RWP+V +GI ++LVSLAGF
Sbjct  1    MGVSNNITATLNFIAILSSIPIIASGIWLASNQDNQCINHFRWPIVILGILVLLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW K+GLL LYL  MA+LI +LL +L+ AFVVTRP+G Y VPGRGY EY L G+SSW
Sbjct  61   VGAYWNKQGLLALYLFTMALLIAILLIILVFAFVVTRPNGIYVVPGRGYKEYSLNGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+ H+T S SW KIR+CLA  D+C KL   + TA+QFF++H+SPLQ
Sbjct  121  LKKHVTGSGSWEKIRSCLAVSDVCIKLTQNYITADQFFSSHISPLQ  166



>ref|XP_009352637.1| PREDICTED: tetraspanin-2 [Pyrus x bretschneideri]
Length=269

 Score =   208 bits (530),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SN ITA LNF+A +C+I I +AGIWLASKPDNECI   RWPV  +G+ ++ VSLAGF
Sbjct  1    MGVSNRITAALNFIALLCAILIMSAGIWLASKPDNECIRSFRWPVFILGVLMLFVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY+ K+GLL LYL CMA LIILLL LLI AF VTRP G+Y+VPGRGY EYRL G+S W
Sbjct  61   IGAYFNKQGLLALYLFCMAALIILLLVLLIFAFTVTRPDGSYAVPGRGYTEYRLDGFSKW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+++  S +  KIR CLAD D CPKL  ++ +A+QFF AH+SPLQ
Sbjct  121  LRDYVRDSSNGQKIRNCLADSDTCPKLTQQYMSADQFFFAHISPLQ  166



>ref|XP_008793244.1| PREDICTED: tetraspanin-2 [Phoenix dactylifera]
Length=271

 Score =   208 bits (529),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 127/168 (76%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SN ITA LNF+  +CS+PI  AGIWLASK DNEC+   RWPV+ +G+ I+LVSLAGF
Sbjct  1    MGVSNKITAVLNFVGLLCSVPIIGAGIWLASKQDNECVELARWPVIILGVLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW ++GLL  YL CMA+LI+LLL  L+ AFVVTRP G+Y +PGR Y EYRL G+SSW
Sbjct  61   VGAYWNRQGLLAAYLFCMAVLIVLLLIFLVFAFVVTRPDGSYPIPGRAYSEYRLYGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNE--FFTAEQFFAAHLSPLQ  637
            LR+++T SD W  IR+CL   D+C KL  +  + TA+Q+F  HLSPLQ
Sbjct  121  LRHYVTDSDRWDHIRSCLTASDVCQKLGRDQPYLTADQYFQTHLSPLQ  168



>emb|CDY21656.1| BnaA09g44070D [Brassica napus]
Length=179

 Score =   203 bits (517),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I+LVS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILLVSACGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VP RGY EYRL G+S+W
Sbjct  61   IGAYQYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPARGYKEYRLEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            LR ++  S  WGKIRACLAD ++CPKL+ +F TA+QFF ++ ++PLQ
Sbjct  121  LRENVVDSKKWGKIRACLADTNVCPKLSQQFITADQFFSSSSITPLQ  167



>ref|XP_009102150.1| PREDICTED: tetraspanin-2-like [Brassica rapa]
 emb|CDY65100.1| BnaAnng20180D [Brassica napus]
Length=180

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSACGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYRL G+S+W
Sbjct  61   IGAYQYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPGRGYKEYRLEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            LR ++  S +W KIRACLAD ++CPKL+ +F TA+QFF ++ ++PLQ
Sbjct  121  LRENVVYSKNWRKIRACLADSNVCPKLSQQFITADQFFSSSSITPLQ  167



>ref|XP_009117532.1| PREDICTED: tetraspanin-2-like [Brassica rapa]
Length=270

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I+LVS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILLVSACGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYRL G+S+W
Sbjct  61   IGAYQYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPGRGYKEYRLEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            LR ++  S  WGKIRACLAD ++CPKL+ +F TA+QFF ++ ++PLQ
Sbjct  121  LRENVVDSKKWGKIRACLADTNVCPKLSQQFITADQFFSSSSITPLQ  167



>gb|KDO57736.1| hypothetical protein CISIN_1g024312mg [Citrus sinensis]
Length=195

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LNF+A +CSIPI A+GIWLASKPDNECIH  RWPVV +G+ ++LVSL GF
Sbjct  1    MGVSNNITAVLNFIALLCSIPIIASGIWLASKPDNECIHLFRWPVVLLGVLVLLVSLCGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW KE LL  YL  MAILI+LLL +L+ AFVVTRP G+Y VPGR Y EYRL  +SSW
Sbjct  61   IGAYWYKETLLAFYLCVMAILIVLLLVVLVFAFVVTRPDGSYYVPGRAYKEYRLDKFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+H+  S +W KIRACLAD D C KL+ ++ TA+QFF+AH+SPLQ
Sbjct  121  LRDHVVDSKNWNKIRACLADTDTCSKLSQQYVTADQFFSAHISPLQ  166



>emb|CDY58324.1| BnaCnng32990D [Brassica napus]
Length=180

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSACGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AF+VTRP G++ VPGRGY EYRL G+SSW
Sbjct  61   IGAYQFKETLLAVYLCCMAILIGLLLVVLIFAFIVTRPDGSFQVPGRGYKEYRLEGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            LR ++  S +W KIRACLAD D+CP L+ +F TA+QFF ++ ++PLQ
Sbjct  121  LRENVVDSKNWRKIRACLADSDVCPNLSQQFITADQFFSSSSITPLQ  167



>ref|XP_009112617.1| PREDICTED: tetraspanin-2-like [Brassica rapa]
Length=264

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN L  +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLVLLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSACGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AF+VTRP G+Y VPGRGY EYRL G+S W
Sbjct  61   IGAYQHKETLLAVYLCCMAILIGLLLVVLIFAFLVTRPGGSYQVPGRGYKEYRLEGFSDW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            LR ++  S +WGKIRACLAD D+CPKL+ +F TA+QFF ++ ++PLQ
Sbjct  121  LRENVVDSRNWGKIRACLADTDVCPKLSQQFITADQFFSSSSITPLQ  167



>ref|NP_179548.1| tetraspanin2 [Arabidopsis thaliana]
 sp|Q9ZUN5.1|TET2_ARATH RecName: Full=Tetraspanin-2 [Arabidopsis thaliana]
 gb|AAD10165.1| putative senescence-associated protein 5 [Arabidopsis thaliana]
 gb|AAR92249.1| At2g19580 [Arabidopsis thaliana]
 gb|AAS99676.1| At2g19580 [Arabidopsis thaliana]
 dbj|BAF00907.1| putative senescence-associated protein 5 [Arabidopsis thaliana]
 gb|AEC06897.1| tetraspanin2 [Arabidopsis thaliana]
Length=270

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSATGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYRL G+S+W
Sbjct  61   IGAYKYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYRVPGRGYKEYRLEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            L+ ++  S +WG++RACLAD ++CPKLN EF TA+QFF ++ ++PLQ
Sbjct  121  LKENVVDSKNWGRLRACLADTNVCPKLNQEFITADQFFSSSKITPLQ  167



>emb|CDY03356.1| BnaC09g09920D [Brassica napus]
Length=289

 Score =   204 bits (519),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ +++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLVLVVSACGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYRL G+S+W
Sbjct  61   IGAYQHKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPGRGYKEYRLEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            LR ++  S +WGKIRACL D ++CPKL+ +F TA+QFF ++ ++PLQ
Sbjct  121  LRENVVDSKNWGKIRACLVDTNVCPKLSQQFITADQFFSSSSITPLQ  167



>ref|XP_002883983.1| hypothetical protein ARALYDRAFT_899924 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60242.1| hypothetical protein ARALYDRAFT_899924 [Arabidopsis lyrata subsp. 
lyrata]
Length=270

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSATGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYRL G+S+W
Sbjct  61   IGAYKYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYRVPGRGYKEYRLEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            L+ ++  S +WG++RACLAD ++CPKLN EF TA+QFF ++ ++PLQ
Sbjct  121  LKENVVDSKNWGRLRACLADTNVCPKLNQEFITADQFFSSSKITPLQ  167



>ref|XP_008387703.1| PREDICTED: tetraspanin-2-like [Malus domestica]
Length=270

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SN ITA LNF+A +C+IPI ++GIWLASKPDNECI   RWPV  +G  ++LV LAGF
Sbjct  1    MGVSNRITATLNFIALLCAIPIMSSGIWLASKPDNECIRSFRWPVFILGALMLLVCLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY+ K+GLL LYL CMA LIILLL LLI AF VTRP G+Y+VPGR Y EYRL G+S W
Sbjct  61   IGAYFNKQGLLALYLFCMAALIILLLVLLIFAFTVTRPDGSYTVPGRAYREYRLEGFSKW  120

Query  500  LRNHITSSDSWGKIRACLA-DGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+++T S +W KIR C     D CPKL  ++ +A+QF  AH+SPLQ
Sbjct  121  LRDYVTDSSTWQKIRTCFGLKSDTCPKLTQQYMSADQFLFAHISPLQ  167



>ref|XP_006408875.1| hypothetical protein EUTSA_v10002073mg [Eutrema salsugineum]
 gb|ESQ50328.1| hypothetical protein EUTSA_v10002073mg [Eutrema salsugineum]
Length=270

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSACGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYRL G+S+W
Sbjct  61   IGAYQYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYPVPGRGYREYRLEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            LR ++  S +WGKIRACLAD  +CPKL  +F TA+QFF ++ ++PLQ
Sbjct  121  LRENVVDSKNWGKIRACLADTKVCPKLTQQFITADQFFSSSSITPLQ  167



>emb|CDY48714.1| BnaA09g09890D [Brassica napus]
Length=285

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSACGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
              AY  KE LL +YL CMAILI LLL +LI AF+VTRP G+Y VPGRGY EYRL G+S W
Sbjct  61   ISAYQHKETLLAVYLCCMAILIGLLLVVLIFAFLVTRPDGSYQVPGRGYKEYRLEGFSDW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            LR ++  S +WGKIRACLAD ++CPKL+ +F TA+QFF ++ ++PLQ
Sbjct  121  LRENVVDSRNWGKIRACLADTNVCPKLSQQFITADQFFSSSSITPLQ  167



>ref|XP_010925419.1| PREDICTED: tetraspanin-2 [Elaeis guineensis]
Length=271

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 131/168 (78%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LNF+  +CS+PI  AGIWLASK DNEC+   RWP++ +G+ I+LVSLAGF
Sbjct  1    MGVSNNITAVLNFVGLLCSVPIIGAGIWLASKQDNECVQLARWPIIILGVLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW ++GLL  YL CMA+LI+LLL  L+ AFVVTRP G+Y VPGR Y EYRL G+SSW
Sbjct  61   VGAYWNRQGLLAAYLFCMAVLIVLLLIFLVFAFVVTRPDGSYPVPGRAYSEYRLSGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNE--FFTAEQFFAAHLSPLQ  637
            LR+H+T SD W +IR+CL+  D+C KL ++  + TA+Q+F  HLSPLQ
Sbjct  121  LRDHVTDSDHWDQIRSCLSASDVCQKLGHDQPYLTADQYFQTHLSPLQ  168



>ref|XP_009102152.1| PREDICTED: tetraspanin-2 [Brassica rapa]
Length=270

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSACGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYRL G+S+W
Sbjct  61   IGAYQYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPGRGYKEYRLEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            LR ++  S +W KIRACLAD ++CPKL+ +F TA+QFF ++ ++PLQ
Sbjct  121  LRENVVYSKNWRKIRACLADSNVCPKLSQQFITADQFFSSSSITPLQ  167



>gb|KHG24338.1| hypothetical protein F383_01681 [Gossypium arboreum]
Length=252

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 117/166 (70%), Gaps = 16/166 (10%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M ++NNITA LNF+ F+CSIPI A GIWLA +PDN CIH LRWPV               
Sbjct  1    MGVANNITAVLNFVTFLCSIPIIAVGIWLAQQPDNGCIHLLRWPV---------------  45

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL  YL CMAI+I LLL LL+ AF+VTRP G+Y VPGRGY +YRL GYSSW
Sbjct  46   -GAYCNKETLLAFYLCCMAIVIGLLLILLVFAFIVTRPDGSYGVPGRGYQDYRLDGYSSW  104

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L NH+  S SW KIRACLAD D+CPKL  +F  A+QFFA HLSPL 
Sbjct  105  LTNHVVDSKSWTKIRACLADTDVCPKLTQQFIAADQFFATHLSPLH  150



>ref|XP_010467909.1| PREDICTED: tetraspanin-2-like isoform X1 [Camelina sativa]
Length=270

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSATGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYR+ G+S+W
Sbjct  61   IGAYKYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPGRGYKEYRVEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAH-LSPLQ  637
            L+ ++  S +W ++RACLAD ++CPKLN EF TA+QF++++ ++PLQ
Sbjct  121  LKENVVDSKNWVRLRACLADTNVCPKLNQEFITADQFYSSNKITPLQ  167



>gb|KDO57734.1| hypothetical protein CISIN_1g024312mg [Citrus sinensis]
Length=269

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LNF+A +CSIPI A+GIWLASKPDNECIH  RWPVV +G+ ++LVSL GF
Sbjct  1    MGVSNNITAVLNFIALLCSIPIIASGIWLASKPDNECIHLFRWPVVLLGVLVLLVSLCGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW KE LL  YL  MAILI+LLL +L+ AFVVTRP G+Y VPGR Y EYRL  +SSW
Sbjct  61   IGAYWYKETLLAFYLCVMAILIVLLLVVLVFAFVVTRPDGSYYVPGRAYKEYRLDKFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+H+  S +W KIRACLAD D C KL+ ++ TA+QFF+AH+SPLQ
Sbjct  121  LRDHVVDSKNWNKIRACLADTDTCSKLSQQYVTADQFFSAHISPLQ  166



>ref|XP_006451442.1| hypothetical protein CICLE_v10009193mg [Citrus clementina]
 ref|XP_006475452.1| PREDICTED: tetraspanin-2-like [Citrus sinensis]
 gb|ESR64682.1| hypothetical protein CICLE_v10009193mg [Citrus clementina]
 gb|KDO57735.1| hypothetical protein CISIN_1g024312mg [Citrus sinensis]
Length=269

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LNF+A +CSIPI A+GIWLASKPDNECIH  RWPVV +G+ ++LVSL GF
Sbjct  1    MGVSNNITAVLNFIALLCSIPIIASGIWLASKPDNECIHLFRWPVVLLGVLVLLVSLCGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW KE LL  YL  MAILI+LLL +L+ AFVVTRP G+Y VPGR Y EYRL  +SSW
Sbjct  61   IGAYWYKETLLAFYLCVMAILIVLLLVVLVFAFVVTRPDGSYYVPGRAYKEYRLDKFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+H+  S +W KIRACLAD D C KL+ ++ TA+QFF+AH+SPLQ
Sbjct  121  LRDHVVDSKNWNKIRACLADTDTCSKLSQQYVTADQFFSAHISPLQ  166



>ref|XP_010467910.1| PREDICTED: tetraspanin-2-like isoform X2 [Camelina sativa]
Length=270

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSATGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYR+ G+S+W
Sbjct  61   IGAYKYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPGRGYKEYRVEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAH-LSPLQ  637
            L+ ++  S +W ++RACLAD ++CPKLN EF TA+QF++++ ++PLQ
Sbjct  121  LKENVVDSKNWVRLRACLADTNVCPKLNQEFITADQFYSSNKITPLQ  167



>ref|XP_010416857.1| PREDICTED: tetraspanin-2 isoform X2 [Camelina sativa]
Length=270

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSATGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYR+ G+S+W
Sbjct  61   IGAYKYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPGRGYKEYRVEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            L+ ++  S +W ++RACLAD ++CPKLN EF TA+QF+ ++ ++PLQ
Sbjct  121  LKENVVDSKNWVRLRACLADTNVCPKLNQEFITADQFYSSSKITPLQ  167



>gb|KCW82491.1| hypothetical protein EUGRSUZ_C03887 [Eucalyptus grandis]
Length=186

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SN +TA LNF+A + SI I  AG WL+SK DN+C H+ RWPV+ +GI ++LVSL GF
Sbjct  1    MGVSNKLTALLNFVALLSSIVIIGAGFWLSSKADNQCTHYFRWPVLILGILLLLVSLCGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W ++G L  YL CMA+LI+L+L LL+ AFVVTRP G+YSVPGR Y EYRLGG+SSW
Sbjct  61   VGAFWNRKGFLVFYLFCMALLIVLILILLVFAFVVTRPDGSYSVPGRAYKEYRLGGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+H+T S +WGKIR+C+A+ D+C KL+ E+ TA+QFFAAH+SPL+
Sbjct  121  LRDHLTDSGNWGKIRSCIAESDVCMKLDQEYVTADQFFAAHISPLE  166



>ref|XP_010489156.1| PREDICTED: tetraspanin-2-like isoform X2 [Camelina sativa]
Length=270

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSATGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYR+ G+S W
Sbjct  61   IGAYKYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPGRGYKEYRVEGFSDW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            L+ ++  S +W ++RACLAD ++CPKLN EF TA+QF+ ++ ++PLQ
Sbjct  121  LKENVVDSKNWVRLRACLADTNVCPKLNQEFITADQFYSSSKITPLQ  167



>ref|XP_010416849.1| PREDICTED: tetraspanin-2 isoform X1 [Camelina sativa]
Length=270

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSATGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYR+ G+S+W
Sbjct  61   IGAYKYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPGRGYKEYRVEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            L+ ++  S +W ++RACLAD ++CPKLN EF TA+QF+ ++ ++PLQ
Sbjct  121  LKENVVDSKNWVRLRACLADTNVCPKLNQEFITADQFYSSSKITPLQ  167



>gb|AFK37963.1| unknown [Medicago truncatula]
Length=269

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LN +A + SIPI A+GIWLASKPDNECI   RWP+V IGI + LV+L GF
Sbjct  1    MGVSNNITAVLNIIAILASIPIIASGIWLASKPDNECIANFRWPIVIIGILVFLVALTGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY+ KEGLL LYL  MA+LI LLL +L+ AFVVTRP G+Y VP RGY E+RL G+SSW
Sbjct  61   IGAYYNKEGLLALYLFAMALLIALLLIILVFAFVVTRPDGSYVVPDRGYKEFRLDGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+ +T S SW KI  CLA  D+C KL   + TA+QFF +H+SPLQ
Sbjct  121  LRHRVTGSGSWRKIMPCLAASDVCIKLTQNYITADQFFNSHISPLQ  166



>ref|XP_010489155.1| PREDICTED: tetraspanin-2-like isoform X1 [Camelina sativa]
Length=270

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSATGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYR+ G+S W
Sbjct  61   IGAYKYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPGRGYKEYRVEGFSDW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            L+ ++  S +W ++RACLAD ++CPKLN EF TA+QF+ ++ ++PLQ
Sbjct  121  LKENVVDSKNWVRLRACLADTNVCPKLNQEFITADQFYSSSKITPLQ  167



>ref|XP_003630634.1| hypothetical protein MTR_8g101600 [Medicago truncatula]
 gb|AET05110.1| tetraspanin family protein [Medicago truncatula]
Length=269

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LN +A + SIPI A+GIWLASKPDNECI   RWP+V IGI + LV+L GF
Sbjct  1    MGVSNNITAVLNIIAILASIPIIASGIWLASKPDNECIANFRWPIVIIGILVFLVALTGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY+ KEGLL LYL  MA+LI LLL +L+ AFVVTRP G+Y VP RGY E+RL G+SSW
Sbjct  61   IGAYYNKEGLLALYLFAMALLIALLLIILVFAFVVTRPDGSYVVPDRGYKEFRLDGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+ +T S SW KI  CLA  D+C KL   + TA+QFF +H+SPLQ
Sbjct  121  LRHRVTGSGSWRKIMPCLAASDVCIKLTQNYITADQFFNSHISPLQ  166



>gb|KFK40333.1| hypothetical protein AALP_AA3G360500 [Arabis alpina]
Length=270

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I++VS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILVVSACGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y +PGRGY EY+L G+S+W
Sbjct  61   IGAYQYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYPIPGRGYKEYKLEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            LR ++  S +W KIRACLAD ++CPKL  EF TA+QFF ++ ++PLQ
Sbjct  121  LRANVVDSKNWRKIRACLADTNVCPKLTQEFITADQFFSSSSITPLQ  167



>ref|XP_003530563.1| PREDICTED: tetraspanin-2 [Glycine max]
 gb|KHN16683.1| hypothetical protein glysoja_002780 [Glycine soja]
Length=269

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LN +A + SIPI A+GIWLASKPDNEC+   RWP+V IGI I+LVSLAGF
Sbjct  1    MGVSNNITAVLNLIATLASIPIIASGIWLASKPDNECVANFRWPIVIIGILILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW K+GLL LYL CMA+LI LLL +L+ AFVVTRP GAY VPGRGY EYRL G+SSW
Sbjct  61   VGAYWNKQGLLALYLFCMALLIALLLLVLVFAFVVTRPDGAYDVPGRGYKEYRLHGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRNH+T S SW KIR CLA  D+C KL  ++ TA+QFF +H+SPLQ
Sbjct  121  LRNHVTGSGSWQKIRPCLAASDVCSKLTQDYITADQFFNSHISPLQ  166



>ref|XP_010049725.1| PREDICTED: tetraspanin-2-like [Eucalyptus grandis]
 gb|KCW82490.1| hypothetical protein EUGRSUZ_C03887 [Eucalyptus grandis]
Length=266

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SN +TA LNF+A + SI I  AG WL+SK DN+C H+ RWPV+ +GI ++LVSL GF
Sbjct  1    MGVSNKLTALLNFVALLSSIVIIGAGFWLSSKADNQCTHYFRWPVLILGILLLLVSLCGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W ++G L  YL CMA+LI+L+L LL+ AFVVTRP G+YSVPGR Y EYRLGG+SSW
Sbjct  61   VGAFWNRKGFLVFYLFCMALLIVLILILLVFAFVVTRPDGSYSVPGRAYKEYRLGGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+H+T S +WGKIR+C+A+ D+C KL+ E+ TA+QFFAAH+SPL+
Sbjct  121  LRDHLTDSGNWGKIRSCIAESDVCMKLDQEYVTADQFFAAHISPLE  166



>ref|XP_009380442.1| PREDICTED: tetraspanin-2-like [Musa acuminata subsp. malaccensis]
Length=269

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 124/168 (74%), Gaps = 4/168 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA  NF+  +CS+P+  AGIWLASK DNEC+   RWPV+ +G+ +MLVSLAGF
Sbjct  1    MGVSNNITALFNFVGLLCSVPVIGAGIWLASKQDNECVRLARWPVIILGVLVMLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW K+GLL  YL CMA LI+LLL+LLI AF VTRP G+Y VPGR Y EYRLGG+S W
Sbjct  61   VGAYWNKQGLLAAYLFCMAALIVLLLALLIFAFAVTRPDGSYPVPGRAYREYRLGGFSVW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKL--NNEFFTAEQFFAAHLSPLQ  637
            LR+++  +D W +IR CL+  D+C K   N  + TA QFF   L+PLQ
Sbjct  121  LRHYV--ADQWPQIRTCLSSSDVCQKFGRNQPYLTAYQFFRTDLTPLQ  166



>gb|AFK45233.1| unknown [Lotus japonicus]
Length=269

 Score =   190 bits (483),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LNF+A + SIPI A+GIWLAS PDN+CI   RWP+V IG+ I+LVSLAGF
Sbjct  1    MGVSNNITAVLNFIAMLSSIPIIASGIWLASNPDNQCITNFRWPIVIIGLLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW K+GLL LYL  MA+LI LLL LL+ AFVVT+P G+Y VPGRGY EY L  +SSW
Sbjct  61   VGAYWNKQGLLALYLFSMALLIALLLILLVFAFVVTKPDGSYDVPGRGYKEYTLDRFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRNH+T S SW KIR CLA  D+C  L   + T +QF  +HLSPLQ
Sbjct  121  LRNHVTGSGSWRKIRPCLAASDVCINLARNYITPDQFLNSHLSPLQ  166



>ref|XP_007160234.1| hypothetical protein PHAVU_002G304100g [Phaseolus vulgaris]
 gb|ESW32228.1| hypothetical protein PHAVU_002G304100g [Phaseolus vulgaris]
Length=269

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LNF+A + SIPI A+GIWLASKPDN+C+   RWP++ +G+ I+LVSLAGF
Sbjct  1    MGVSNNITAVLNFVAMISSIPIIASGIWLASKPDNQCVANFRWPILIMGLLILLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW K+GLL LYL  MA+LI LLL LL+ AF+VTRP G+Y VPGR Y EY L G+SSW
Sbjct  61   VGAYWNKQGLLALYLFSMALLIALLLILLVFAFLVTRPDGSYDVPGRAYKEYNLHGFSSW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
             RN +T S SW KI+ CLA  ++C KL   + TA+QFFA+H+SPLQ
Sbjct  121  FRNRVTGSGSWHKIKPCLAASNVCSKLTLNYITADQFFASHISPLQ  166



>ref|XP_009409323.1| PREDICTED: tetraspanin-2-like [Musa acuminata subsp. malaccensis]
Length=269

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNITA LNF+  +CS+P+  AGIWLASK DNEC+   RWPV+ +G+ ++LVSLAGF
Sbjct  1    MGVSNNITAVLNFVGLLCSVPVIGAGIWLASKQDNECVRLARWPVIILGVLLLLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW K+GLL  YL CMA LI+LLL  L+ AF VTRP G+Y VPGR Y EYRL G+S+W
Sbjct  61   VGAYWDKQGLLAAYLFCMAALIVLLLIFLVFAFAVTRPDGSYPVPGRAYHEYRLAGFSAW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNE--FFTAEQFFAAHLSPLQ  637
            LR++IT  D W +IRACL+  D+C KL  +  + TA+QFF   LSPLQ
Sbjct  121  LRHYIT--DHWIQIRACLSSSDVCQKLGRDQPYLTADQFFQTDLSPLQ  166



>ref|XP_007152918.1| hypothetical protein PHAVU_004G171300g [Phaseolus vulgaris]
 gb|ESW24912.1| hypothetical protein PHAVU_004G171300g [Phaseolus vulgaris]
Length=269

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNNIT  LNF+A + SIPI  AG+WLASKPDNECIH  RW V+ +G+ ++LVSLAGF
Sbjct  1    MGVSNNITVVLNFIALLASIPIIGAGVWLASKPDNECIHNFRWHVLILGLLVLLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW K+GLL  YL CMAILI LLL +L+ +F+VT P G Y VPG+G+ E  L G+S W
Sbjct  61   VGAYWNKQGLLAFYLCCMAILIALLLFILLFSFIVTTPDGTYYVPGKGFKESMLHGFSPW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LRNH+T+S SW KI  CL   ++C KL  ++ +A+QFF +H+SPLQ
Sbjct  121  LRNHVTTSWSWNKITTCLVHSNVCIKLTQDYISADQFFNSHISPLQ  166



>gb|KGN66227.1| hypothetical protein Csa_1G586890 [Cucumis sativus]
Length=183

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA LNF+ F+ SIP+ AAGIWLASKPDNECI  LRWPVV +G  ++L SL GF
Sbjct  1    MAVSNNITAILNFIIFLSSIPVIAAGIWLASKPDNECIQLLRWPVVVLGGLLLLGSLIGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTR-PSGAYSVPGRGYDEYRLGGYSS  496
             GAY  + GLL +YL  MA+LIILLL +LI+AF  TR   G++ V G  + EYRL GYSS
Sbjct  61   IGAYCNRPGLLAVYLFFMAVLIILLLIVLIIAFTATRHDGGSHPVAGTRFQEYRLDGYSS  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            WLR+H+TSS SW  +R CLA  ++C +LN EF + EQFFA  +SPLQ
Sbjct  121  WLRHHVTSSGSWPSVRKCLAVSNVCRQLNREFSSTEQFFATDISPLQ  167



>emb|CDX81936.1| BnaC08g36650D [Brassica napus]
Length=245

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+NN+TA LN LA +CSIPITA+GIWLASKPDNEC++ LRWPVV +G+ I+LVS  GF
Sbjct  1    MALANNLTAILNLLALLCSIPITASGIWLASKPDNECVNLLRWPVVVLGVLILLVSACGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY  KE LL +YL CMAILI LLL +LI AFVVTRP G+Y VPGRGY EYRL G+S+W
Sbjct  61   IGAYQYKETLLAVYLCCMAILIGLLLVVLIFAFVVTRPDGSYQVPGRGYKEYRLEGFSNW  120

Query  500  LRNHITSSDSWGKIRACLADGD  565
            LR ++  S +WGKIRACLAD +
Sbjct  121  LRENVVESKNWGKIRACLADTN  142



>ref|XP_006836243.1| hypothetical protein AMTR_s00101p00124120 [Amborella trichopoda]
 gb|ERM99096.1| hypothetical protein AMTR_s00101p00124120 [Amborella trichopoda]
Length=217

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA LNF+A + SI I A+G+WLAS+ DNECI  +RWP++ IG+ I LVSLAGF
Sbjct  1    MAVSNNITAGLNFVALLSSIAIIASGVWLASRQDNECIRLVRWPIILIGLLIFLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+ + LL +YLV M ILI+LLLS ++ AFVVT PSGAY + GR YDEYRL GYS+W
Sbjct  61   VGAFWRVQCLLAVYLVAMIILIVLLLSFVVFAFVVTGPSGAYPISGRAYDEYRLQGYSAW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+++  + +W ++RACL     C  L  ++ + + F AAHL+PLQ
Sbjct  121  LRHYVADNGNWNRVRACLGGSTACSGLPLKYLSFQDFIAAHLTPLQ  166



>gb|EPS62274.1| hypothetical protein M569_12516 [Genlisea aurea]
Length=268

 Score =   174 bits (441),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 127/168 (76%), Gaps = 6/168 (4%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SN ITA LNF A +CSI +  AGIWL    ++ECIH LRWPV+ +G+A + VSL+GF
Sbjct  1    MAVSNTITAILNFTAVLCSIAVIGAGIWL----NDECIHRLRWPVILLGLAFLAVSLSGF  56

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYWKKE LL +YL+ M +LI+LLL+LL+LAFVVTRPSGAYSVPG G++EYRL G+SSW
Sbjct  57   VGAYWKKETLLAIYLISMFVLIVLLLALLVLAFVVTRPSGAYSVPGVGFEEYRLEGFSSW  116

Query  500  LRNHITSSDSW-GKIRACLADGDICPKLNNE-FFTAEQFFAAHLSPLQ  637
            LR+ +   D+W   I+ CL    IC +LN   + +A  FFAAHLSP++
Sbjct  117  LRDRVAGGDNWAANIKPCLESTQICYRLNRRPYISAADFFAAHLSPIE  164



>ref|XP_004135705.1| PREDICTED: uncharacterized protein LOC101208857 [Cucumis sativus]
Length=270

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA LNF+ F+ SIP+ AAGIWLASKPDNECI  LRWPVV +G  ++L SL GF
Sbjct  1    MAVSNNITAILNFIIFLSSIPVIAAGIWLASKPDNECIQLLRWPVVVLGGLLLLGSLIGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTR-PSGAYSVPGRGYDEYRLGGYSS  496
             GAY  + GLL +YL  MA+LIILLL +LI+AF  TR   G++ V G  + EYRL GYSS
Sbjct  61   IGAYCNRPGLLAVYLFFMAVLIILLLIVLIIAFTATRHDGGSHPVAGTRFQEYRLDGYSS  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            WLR+H+TSS SW  +R CLA  ++C +LN EF + EQFFA  +SPLQ
Sbjct  121  WLRHHVTSSGSWPSVRKCLAVSNVCRQLNREFSSTEQFFATDISPLQ  167



>ref|XP_008450844.1| PREDICTED: tetraspanin-2-like [Cucumis melo]
Length=270

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SN+ITA LNF+ F+ SIP+ AAGIWLASKPDNECI  LRWPVV +G  +++ SL GF
Sbjct  1    MAVSNSITAILNFIIFLSSIPVIAAGIWLASKPDNECIQLLRWPVVVLGGLLLIGSLVGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPS-GAYSVPGRGYDEYRLGGYSS  496
             GAY  + GLL +YL  MA+LIILLL +LI+AF  TR + G++ V G  + EYRL GYSS
Sbjct  61   IGAYCNRPGLLAVYLFFMAVLIILLLIVLIIAFTATRHNGGSHPVAGTRFQEYRLDGYSS  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            WLR+H+TSS SW  +R CLA  D+C KLN EF + EQ+FA  +SPLQ
Sbjct  121  WLRHHVTSSGSWPSVRTCLAVSDVCRKLNREFSSTEQYFATDISPLQ  167



>ref|XP_003529082.1| PREDICTED: tetraspanin-2 [Glycine max]
 gb|KHN40332.1| hypothetical protein glysoja_000830 [Glycine soja]
Length=273

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 127/170 (75%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M + NN++A LNF+A + SIPI +AG+WLASKPDNECIH  RW V+ +G+ ++L+SLAGF
Sbjct  1    MGVGNNMSAVLNFIALLASIPIISAGVWLASKPDNECIHNFRWHVLVLGLLVLLISLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW K+GLL  YL CMAILI LLL LL+ +FVVTRP G Y VPGRG+ E  L G+S W
Sbjct  61   VGAYWNKQGLLAFYLCCMAILISLLLFLLVFSFVVTRPDGTYHVPGRGFKESMLVGFSPW  120

Query  500  LRNHI---TSSDSWGKIRACLADGDICPKLNNEFFTAEQFF-AAHLSPLQ  637
            LRNH+   +S+ SW KI  CLA   +C KL  ++ +A+ FF ++++SPLQ
Sbjct  121  LRNHVFTASSTTSWNKITTCLAHSYVCIKLTQDYASADHFFNSSNISPLQ  170



>gb|EPS60790.1| hypothetical protein M569_14011, partial [Genlisea aurea]
Length=257

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 118/167 (71%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++S N TA LN +  + SIP+ +  IWLASKPDN+CI WLRWP + IG A++L++LAGF
Sbjct  1    MAVSKNFTALLNVVTLISSIPVVSVVIWLASKPDNDCIRWLRWPFLVIGAALLLIALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAY+  +GLL +YLVCM++LI+L+   L++A +VTR  G YSVPG  + EY L GYSSW
Sbjct  61   LGAYFDMKGLLSVYLVCMSMLIVLVSLFLVIASIVTRRRGDYSVPGAAFREYDLEGYSSW  120

Query  500  LRNHITSSD-SWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
             R  +   D +W  IRACL D   C KLN +  TA QF+A+ LSP+Q
Sbjct  121  FREQVVDGDNNWLGIRACLIDSGTCDKLNRKLITASQFYASDLSPIQ  167



>ref|XP_010559299.1| PREDICTED: protein TORNADO 2 [Tarenaya hassleriana]
Length=269

 Score =   159 bits (402),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M LSNN+   +NF+A + S+P+  AGIWLA++ DN C+  L+WPV+ +GI I++V LAGF
Sbjct  1    MPLSNNVIGCINFIAVLLSVPVIGAGIWLATETDNSCVKLLQWPVIILGILILVVGLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILI+LL +L++  F+VT     +  P R Y EYRL  +S W
Sbjct  61   IGGFWRIPWLLVTYLIAMLILIVLLSALVVFVFMVTSRGSGHIEPSRAYVEYRLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR CL+  +ICP+LN  +  A+ FF AHLSP+Q
Sbjct  121  LRRRVKSSFKWDRIRTCLSSTNICPELNQSYRMAQDFFNAHLSPIQ  166



>ref|XP_008343041.1| PREDICTED: protein TORNADO 2-like [Malus domestica]
Length=188

 Score =   156 bits (395),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 113/166 (68%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWLA++PDN C+  L+WPV+ +GI  ++V++AGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGAGIWLATEPDNSCVKLLQWPVIILGILFLVVAIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M +LIILL +L++  ++VT     +  P R Y EYRL  YS W
Sbjct  61   VGAFWRIPWLLISYLIAMLVLIILLAALVVFIYMVTIRGSGHLEPSRSYLEYRLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + +   W +IRACL+  ++C +LN  +  A+ FF AH++PLQ
Sbjct  121  LRRRVRNPFKWARIRACLSSTNMCDELNQRYRMAQDFFNAHITPLQ  166



>ref|XP_003571711.1| PREDICTED: tetraspanin-2-like [Brachypodium distachyon]
Length=269

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 114/169 (67%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA +  +A +C++P+ A+G+W AS    EC    RWPV  +G  I+L +LAGF
Sbjct  1    MAVSNNITACVTLMALICALPVIASGVWFASAQGEECARLARWPVAILGGLILLTALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW +  LL  YL  MA LI+LL++LL  AF VTR SGAY V GR YDEYRL G+S W
Sbjct  61   VGAYWNRRRLLAFYLFAMAALIVLLIALLAFAFAVTRGSGAYPVLGRNYDEYRLDGFSMW  120

Query  500  LRNHITSS-DSWGKIRACLADGDICPKLNNE--FFTAEQFFAAHLSPLQ  637
            LR +++     W  IR+CLA  D C KL  +  F TA+QF+ ++L+PLQ
Sbjct  121  LRGYVSDDPGRWEGIRSCLAVSDTCKKLARQASFVTADQFYQSNLTPLQ  169



>ref|XP_008783967.1| PREDICTED: protein TORNADO 2-like [Phoenix dactylifera]
Length=186

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LS+ + A +NF+A + SIP+ AAGIWL+ + DN C+  L+WPV+ +GIAI++V+ AGF
Sbjct  1    MALSSTVIASINFVAMLLSIPVIAAGIWLSVQTDNSCVKLLQWPVIVLGIAILVVAFAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YLV M +LI+LL SL+I  +VVT    A+  PGR Y EYRL  YS W
Sbjct  61   VGAFWRMPWLLLFYLVAMFVLILLLASLVIFIYVVTNRGEAHLAPGRVYLEYRLEDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  +  S  W +I+ CL+    C +LN  +  A+ FF A +SPL+
Sbjct  121  LRQRVQGSHKWDRIKKCLSSTSTCAELNQTYREAQDFFNARISPLE  166



>gb|KJB65127.1| hypothetical protein B456_010G082000, partial [Gossypium raimondii]
Length=224

 Score =   155 bits (391),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = +2

Query  275  VFIGIAIMLVSLAGFAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVP  454
            V +G  I+LVSLAGF GAY  KE  L  YL CMAILI LLL LL+ AF+VTRP G+Y VP
Sbjct  1    VLLGFLILLVSLAGFVGAYRNKETPLAFYLCCMAILIGLLLILLVFAFIVTRPDGSYGVP  60

Query  455  GRGYDEYRLGGYSSWLRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPL  634
            GRGY EYRL GYSSWL NH+  S SW KIR  LAD D+CPKL  +F TA+QFFA HLSPL
Sbjct  61   GRGYQEYRLDGYSSWLTNHVVDSKSWNKIRDSLADTDVCPKLTQQFITADQFFATHLSPL  120

Query  635  Q  637
            Q
Sbjct  121  Q  121



>ref|XP_008448672.1| PREDICTED: protein TORNADO 2-like [Cucumis melo]
Length=269

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+ A +NF+A + SIP+  AGIWLA++PDN C+  L+WPV+ +GI I LV+LAGF
Sbjct  1    MALSNNVIAAINFIALLLSIPVIGAGIWLATEPDNACVQVLQWPVIILGIVIFLVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YLV M +LIILL SL+I  F VT     ++ P R Y EY L  +S W
Sbjct  61   IGAFWRVSWLLMFYLVAMLVLIILLGSLVIFVFSVTMRGSGHAEPSRAYLEYHLDEFSLW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  + SS  W +IR CL+    C +LN  +  A+ FF AH++P Q
Sbjct  121  LQRRVRSSHKWERIRNCLSSSTTCAELNQNYRFAQDFFNAHITPFQ  166



>ref|XP_006838537.1| hypothetical protein AMTR_s00002p00197500 [Amborella trichopoda]
 gb|ERN01106.1| hypothetical protein AMTR_s00002p00197500 [Amborella trichopoda]
Length=193

 Score =   154 bits (389),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNN+ A +NF A + SIPI   GIWLA++PDN C+  L+WPV+ +GI +++V+LAGF
Sbjct  1    MAMSNNVIAAINFAAMLLSIPIIGTGIWLATEPDNACVKLLQWPVIILGILVLIVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+ + LL  YLV M ILI LL++L++  ++VT     + VP R Y EYRL  YS W
Sbjct  61   VGAFWRVQWLLLFYLVAMLILIALLVALVVFTYMVTDKGEGHLVPSRAYLEYRLEDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  +     W +IR CL+  + C +LN  +  A+ FF + L+PLQ
Sbjct  121  LRMRVQGPFKWDRIRNCLSSSNFCAELNQSYHFAQDFFNSPLNPLQ  166



>ref|XP_006437550.1| hypothetical protein CICLE_v10032405mg [Citrus clementina]
 gb|ESR50790.1| hypothetical protein CICLE_v10032405mg [Citrus clementina]
Length=270

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 112/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWLA++ DN C+  L+WPV+ +GI I++V+LAGF
Sbjct  1    MALSNNVIGAINFVAVLLSIPVIGAGIWLATEADNSCVKLLQWPVIILGILILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL LYLV M ILIILL  L++  ++VT     +  P R Y EYRL  +S W
Sbjct  61   IGGFWRIPWLLILYLVAMLILIILLACLVVFIYMVTIKGSGHLAPSRAYLEYRLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + S   W +I++CL+   +CP+LN  +  A+ FF AH++PLQ
Sbjct  121  LRRRVRSPYKWDRIKSCLSSTQMCPELNQSYRMAQDFFNAHITPLQ  166



>ref|NP_001130594.1| uncharacterized protein LOC100191693 precursor [Zea mays]
 gb|ACF78875.1| unknown [Zea mays]
 gb|ACG27669.1| senescence-associated protein 5 [Zea mays]
 gb|AFW71319.1| Senescence-associated protein 5 [Zea mays]
Length=270

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 116/169 (69%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA +  LA +C++P+ A+G+W AS    EC    RWPV  +G  ++L +LAGF
Sbjct  1    MAVSNNITACVTLLALICAVPVIASGVWFASAQGEECARLARWPVAILGGLLLLAALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW + GLL  YL  MA L++LL++LL  AF VTR SGAY V GR YD+YRL G+S W
Sbjct  61   VGAYWNRRGLLAFYLFAMASLVVLLIALLAFAFAVTRGSGAYPVLGRAYDDYRLDGFSMW  120

Query  500  LRNHITSS-DSWGKIRACLADGDICPKLNNE--FFTAEQFFAAHLSPLQ  637
            LR +++     W K+RACLA  D C KL  +  F +A+QF+ +HLSPLQ
Sbjct  121  LRGYVSDDPGRWDKVRACLAVSDTCKKLARQAAFTSADQFYQSHLSPLQ  169



>ref|XP_004148762.1| PREDICTED: uncharacterized protein LOC101210867 [Cucumis sativus]
 ref|XP_004164676.1| PREDICTED: uncharacterized protein LOC101223573 [Cucumis sativus]
 gb|KGN55744.1| hypothetical protein Csa_3G009500 [Cucumis sativus]
Length=269

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+ A +NF+A + SIP+  AGIWLA++PDN C+  L+WPV+ +GI I LV+LAGF
Sbjct  1    MALSNNVIAAINFIALILSIPVIGAGIWLATEPDNACVQVLQWPVIILGIVIFLVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M +LIILL SL+I  F VT     ++ P R Y EY L  +S W
Sbjct  61   IGAFWRVSWLLMFYLIAMLVLIILLGSLIIFVFSVTMRGSGHAEPSRAYLEYHLDEFSLW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  + SS  W +IR CL+    C +LN  +  A+ FF AH++P Q
Sbjct  121  LQRRVRSSHKWERIRNCLSSSTTCAELNQNYRFAQDFFNAHITPFQ  166



>ref|XP_004300405.1| PREDICTED: protein TORNADO 2 [Fragaria vesca subsp. vesca]
Length=269

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 112/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+ A +NF+A + SIPI  AGIWLA++PDN C+  L+WPV+ +GI  ++V++AGF
Sbjct  1    MALSNNVIAAINFVAMLLSIPIIGAGIWLATEPDNSCVKILQWPVITLGILFLVVAIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M ILI+LL  L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   VGAFWRIPWLLVSYLIAMLILIVLLACLVVFIYMVTMRGSGHLEPSRSYLEYHLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + +   W +IRACL+  ++C +LN  +  A+ FF AHL+PLQ
Sbjct  121  LRRRVRAPFKWDRIRACLSSTNMCAELNQSYRMAQDFFNAHLNPLQ  166



>ref|XP_006656179.1| PREDICTED: tetraspanin-2-like [Oryza brachyantha]
Length=272

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 120/170 (71%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA +NFLA +C++P+ A GIW ASK   EC    RWPV  +G  ++LV+LAGF
Sbjct  1    MAVSNNITACVNFLALVCAVPVVATGIWFASKQGEECARVARWPVAILGGLLLLVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW ++GLL  YL  MA LI LLL+LL+ AF VTR SGAY  PGRGYD+YRL GYS+W
Sbjct  61   VGAYWNRQGLLAAYLFAMAALITLLLALLVFAFAVTRGSGAYPAPGRGYDDYRLEGYSTW  120

Query  500  LRNHITSS-DSWGKIRACLADGDICPKLNNE---FFTAEQFFAAHLSPLQ  637
            LR+++      W  IRACLA  D C KL  E   F T EQF+ +HL+PLQ
Sbjct  121  LRDYVAGDPRRWEGIRACLAASDTCRKLAQESVFFITPEQFYQSHLTPLQ  170



>ref|XP_008796279.1| PREDICTED: protein TORNADO 2-like [Phoenix dactylifera]
Length=269

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LS+ + A +NF+A + SIP+ AAGIWL+ + DN C+  L+WPV+ +GIAI++V+ AGF
Sbjct  1    MALSSTVIASINFVAMLLSIPVIAAGIWLSVQTDNSCVKLLQWPVIVLGIAILVVAFAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YLV M +LI+LL SL+I  +VVT    A+  PGR Y EYRL  YS W
Sbjct  61   VGAFWRMPWLLLFYLVAMFVLILLLASLVIFIYVVTNRGEAHLAPGRVYLEYRLEDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  +  S  W +I+ CL+    C +LN  +  A+ FF A +SPL+
Sbjct  121  LRQRVQGSHKWDRIKKCLSSTSTCAELNQTYREAQDFFNARISPLE  166



>emb|CDP13039.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWLA++PDN C+  L+WPV+ +G+ I++V+LAGF
Sbjct  1    MALSNNVIGCINFVAMLLSIPIIGAGIWLATEPDNSCVKLLQWPVIILGVLILIVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL LYL+ M +LI+LL  L++  ++VT          R Y EY L  +S W
Sbjct  61   IGGFWRIPWLLILYLIAMLVLIVLLACLVVFIYMVTIRGSGRPATNRAYLEYHLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR+CL+   +C +LN  +   + FF AHLSPLQ
Sbjct  121  LRRRVQSSYKWDRIRSCLSSSSMCAELNQSYRMPQDFFNAHLSPLQ  166



>ref|XP_010933474.1| PREDICTED: protein TORNADO 2 [Elaeis guineensis]
Length=269

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSN I A +NF+A + SIP+ AAGIWL++  DN C+  L+WPV+ +GI +++V+LAGF
Sbjct  1    MALSNVIMAAINFMAMLLSIPVIAAGIWLSTDTDNSCLKLLQWPVIALGIVLLVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YLV M +LI+LL SL+I  + VT   GA+  P R + EYRL  +S W
Sbjct  61   VGAFWRIPWLLLFYLVAMLVLILLLASLVIFIYAVTNTGGAHLAPSRAFLEYRLEDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  +  S  W +I+ACL+    C +LN  +  A+ FF A LSPLQ
Sbjct  121  LRQRVEGSHKWDRIKACLSSTSTCAELNQTYREAQDFFNARLSPLQ  166



>ref|XP_010088251.1| hypothetical protein L484_003211 [Morus notabilis]
 gb|EXB32998.1| hypothetical protein L484_003211 [Morus notabilis]
Length=239

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI   GIWL S+ DN C+  L+WPV+ +GI I++V+LAGF
Sbjct  1    MALSNNVIGAINFVAVLLSIPIIGTGIWLNSQADNACVKILQWPVIILGILILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YLV M ILI+LL  L++  ++VT     +  P R Y EYRL  +S W
Sbjct  61   VGAFWRIPWLLVTYLVAMLILIVLLACLVVFVYMVTLRGSGHLEPSRAYLEYRLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR CL+   +C +LN  +  A+ FF AH++PLQ
Sbjct  121  LRRRVRSSYKWERIRTCLSSTSMCAELNQSYRMAQDFFNAHINPLQ  166



>ref|XP_009384122.1| PREDICTED: protein TORNADO 2 [Musa acuminata subsp. malaccensis]
Length=269

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 106/166 (64%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L + + A +NFLA + S+P+   GIWLA + DN C+  L+WPV+ IGI I+LV+LAGF
Sbjct  1    MALDDTVIAGINFLAVLLSVPVIGIGIWLAMQTDNSCVQLLQWPVIVIGIVILLVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YLV M ++I+LL SL+I  + VT     +  P R Y EYRL  YS W
Sbjct  61   VGAFWRMPRLLLFYLVAMLVVILLLASLVIFIYAVTVNGSGHPAPNRAYLEYRLEDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  +  S  W +I+ CL+   +C +LN  +  AE FF A +SPLQ
Sbjct  121  LRRRVEGSYKWNRIKKCLSSTTVCAELNQTYRLAEDFFGARMSPLQ  166



>ref|XP_006484810.1| PREDICTED: protein TORNADO 2-like [Citrus sinensis]
Length=271

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LS+N+   +NF+A + SIP+  AG+WLA++PDN C+  L+WPV+ +G+ I++VSLAGF
Sbjct  1    MALSSNVMGAINFVAILLSIPVIGAGVWLATEPDNSCVKLLQWPVIVLGVLILVVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL LYLV M ILIILL  L++  ++VT     +  P R Y EYRL  YS W
Sbjct  61   IGGFWRIPWLLILYLVAMLILIILLACLVVFIYMVTSKGSGHLPPSRAYLEYRLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAH-LSPLQ  637
            LR  + SS  W +I++CL+   +C +LN  +  A+ FF AH ++PLQ
Sbjct  121  LRRRVRSSYKWDRIKSCLSSTQMCAELNQSYTMAQDFFNAHDITPLQ  167



>ref|XP_006437239.1| hypothetical protein CICLE_v10032401mg [Citrus clementina]
 gb|ESR50479.1| hypothetical protein CICLE_v10032401mg [Citrus clementina]
Length=271

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LS+N+   +NF+A + SIP+  AG+WLA++PDN C+  L+WPV+ +G+ I+++SLAGF
Sbjct  1    MALSSNVMGAINFVAILLSIPVIGAGVWLATEPDNSCVKLLQWPVIVLGVLILVISLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL LYLV M ILIILL  L++  ++VT     +  P R Y EYRL  YS W
Sbjct  61   IGGFWRIPWLLILYLVAMLILIILLACLVVFIYMVTSKGSGHLPPSRAYFEYRLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAH-LSPLQ  637
            LR  + SS  W +I++CL+   +C +LN  +  A+ FF AH ++PLQ
Sbjct  121  LRRRVRSSYKWDRIKSCLSSTQMCAELNQSYTMAQDFFNAHDITPLQ  167



>ref|XP_010227584.1| PREDICTED: tetraspanin-2-like [Brachypodium distachyon]
Length=288

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 115/175 (66%), Gaps = 12/175 (7%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLAS--KPDNECIH-WLRWPVVFIGIAIMLVSLAGF  319
            SN+ITA +NFLA +C+IPI   GIWLAS  +   EC     RWPV  +G  + LV++AGF
Sbjct  5    SNSITACINFLALLCTIPIVITGIWLASSKQGGEECARLQARWPVAILGGLLFLVAVAGF  64

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
            AGAYW ++GLL  YL  M  LI LLL+LL+ AF VTR SGAY VPGR Y EYRL G+S+W
Sbjct  65   AGAYWNRKGLLAAYLFAMGGLITLLLALLVFAFAVTRGSGAYEVPGRAYQEYRLEGFSAW  124

Query  500  LRNHITSSDS----WGKIRACLADGDICPKLNNE-----FFTAEQFFAAHLSPLQ  637
            LR ++   +     WG+IRACLA  D C KL  E     F   +QF+ + LSPLQ
Sbjct  125  LRGYVLDGEGDPRRWGRIRACLAASDTCRKLAGERGSAFFVAPQQFYQSDLSPLQ  179



>ref|XP_009340177.1| PREDICTED: protein TORNADO 2-like [Pyrus x bretschneideri]
Length=269

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 112/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWLA++PDN C+  ++WPV+ +GI  ++V++AGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGAGIWLATEPDNSCVKLIQWPVIILGILFLVVAIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M +LIILL +L++  ++VT     +  P R Y EYRL  YS W
Sbjct  61   VGAFWRIPWLLISYLIAMLVLIILLAALVVCIYMVTIRGSGHLEPSRSYLEYRLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + +   W +IR CL+  ++C +LN  +  A+ FF AH++PLQ
Sbjct  121  LRRRVRNPFKWARIRTCLSSTNMCDELNQRYRMAQDFFNAHITPLQ  166



>ref|XP_008786324.1| PREDICTED: protein TORNADO 2-like [Phoenix dactylifera]
Length=269

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSN I A +NF+A + SIP+ AAGIWL+++ DN C+  L+WPV+ +GI +++V+LAGF
Sbjct  1    MALSNTIIAAINFMAMLLSIPVIAAGIWLSTQTDNSCVKLLQWPVISLGIVMLVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YLV M +LI+LL SL+I  + VT   GA+  P R + EYRL  +S W
Sbjct  61   VGAFWRIPWLLLFYLVAMLVLILLLASLVIFIYAVTNTGGAHLAPSRAFLEYRLEDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L   +  S  W +I+ACL+    C +LN  +  A+ FF A +SPLQ
Sbjct  121  LPQRVEGSQKWDRIKACLSSTSTCAELNQTYREAQDFFNARISPLQ  166



>gb|EYU44074.1| hypothetical protein MIMGU_mgv1a011737mg [Erythranthe guttata]
Length=272

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AG+WLA++ DN C+  L++PV+ IG+ I++V++AGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGAGVWLATEADNSCVKILQYPVIVIGVLILVVAIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M +LIILL  L+   ++VT     +  P R Y EY L  YS W
Sbjct  61   IGGFWRISWLLIFYLIAMLVLIILLACLVGFIYMVTVNGSGHPAPSRAYLEYDLDSYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IRACL+   +C +LN  +  A+ FF AH++PLQ
Sbjct  121  LRRRVQSSYKWDRIRACLSSSSMCAELNQSYRMAQDFFDAHITPLQ  166



>gb|EYU34536.1| hypothetical protein MIMGU_mgv1a022692mg [Erythranthe guttata]
Length=272

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AG+WLA++ DN C+  L++PV+ IG+ I++V++AGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGAGVWLATEADNSCVKILQYPVIVIGVLILVVAIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M +LIILL  L+   ++VT     +  P R Y EY L  YS W
Sbjct  61   IGGFWRISWLLIFYLIAMLVLIILLACLVGFIYMVTVNGSGHPAPSRAYLEYDLDSYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IRACL+   +C +LN  +  A+ FF AH++PLQ
Sbjct  121  LRRRVQSSYKWDRIRACLSSSSMCAELNQSYRMAQDFFDAHITPLQ  166



>ref|XP_002451779.1| hypothetical protein SORBIDRAFT_04g007710 [Sorghum bicolor]
 gb|EES04755.1| hypothetical protein SORBIDRAFT_04g007710 [Sorghum bicolor]
Length=269

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 114/169 (67%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA +  LA +C++P+ A+GIW AS    EC    RWPV  +G  ++L +LAGF
Sbjct  1    MAVSNNITACVTLLALICAVPVIASGIWFASAQGEECARLARWPVAILGGLLLLAALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW +  LL  YL  MA L++LL++LL+ AF VTR SGAY V GR YD+Y L G+S W
Sbjct  61   VGAYWNRRRLLAFYLFAMASLVVLLIALLVFAFAVTRGSGAYPVLGRAYDDYHLDGFSMW  120

Query  500  LRNHITSS-DSWGKIRACLADGDICPKLNNE--FFTAEQFFAAHLSPLQ  637
            LR +++     W KIRACLA  D C KL  +  F  AEQF+ +HLSPLQ
Sbjct  121  LRGYVSDDPGRWEKIRACLAVSDTCKKLARQAAFTNAEQFYQSHLSPLQ  169



>ref|XP_006484564.1| PREDICTED: protein TORNADO 2-like isoform X1 [Citrus sinensis]
 ref|XP_006484565.1| PREDICTED: protein TORNADO 2-like isoform X2 [Citrus sinensis]
Length=270

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWLA++ DN C+  L+WPV+ +GI I++V+LAGF
Sbjct  1    MALSNNVIGAINFVAVLLSIPVIGAGIWLATEADNSCVKLLQWPVIILGILILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL LYLV M ILIILL  L++  ++VT     +  P R Y EYRL  +S W
Sbjct  61   IGGFWRIPWLLILYLVAMLILIILLACLVVFIYMVTIKGSGHLAPSRAYLEYRLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + S   W +I++ L+   +CP+LN  +  A+ FF AH++PLQ
Sbjct  121  LRRRVRSPYKWDRIKSWLSSTQMCPELNQSYRMAQDFFNAHITPLQ  166



>ref|XP_006484560.1| PREDICTED: protein TORNADO 2-like [Citrus sinensis]
Length=270

 Score =   151 bits (381),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWLA++ DN C+  L+WPV+ +GI I++V+LAGF
Sbjct  1    MALSNNVIGAINFVAVLLSIPVIGAGIWLATEADNSCVKLLQWPVIILGILILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL LYLV M ILIILL  L++  ++VT     +  P R Y EYRL  +S W
Sbjct  61   IGGFWRIPWLLILYLVAMLILIILLACLVVFIYMVTIKGSGHLAPSRAYLEYRLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + S   W +I++ L+   +CP+LN  +  A+ FF AH++PLQ
Sbjct  121  LRRRVRSPYKWDRIKSWLSSTQMCPELNQSYRMAQDFFNAHITPLQ  166



>ref|XP_011070272.1| PREDICTED: protein TORNADO 2 [Sesamum indicum]
Length=271

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LS+N+   +NF+A + SIPI  AGIWLA++ DN C+  L+WPV+ +G+ I++V+LAGF
Sbjct  1    MALSSNVIGAINFVAMILSIPIIGAGIWLATEADNSCVKILQWPVIILGVLILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M + I+LL  L++  ++VT     +  P R Y EY L  +S W
Sbjct  61   IGGFWRIPWLLIFYLIAMLVAIVLLACLVVFVYMVTIRGSGHPAPSRAYLEYSLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR+CL+   +C +LN  +  A+ FF AH+SPLQ
Sbjct  121  LRRRVRSSYKWDRIRSCLSSSSMCAELNQSYRMAQDFFNAHISPLQ  166



>ref|XP_009611576.1| PREDICTED: protein TORNADO 2-like [Nicotiana tomentosiformis]
Length=271

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWLA + DN C+  L+WPV+ +G+ I++V+LAGF
Sbjct  1    MALSNNVIGCINFVAMLLSIPVIGAGIWLAMETDNSCVKILQWPVIILGVLILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILI+LL  L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   IGGFWRIPTLLIFYLIAMLILIVLLACLVVFIYMVTIRGSGHMEPSRAYLEYHLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR+CL+   +C +LN  +  A+ FF A LSPLQ
Sbjct  121  LRRRVQSSYKWDRIRSCLSSTTMCAQLNQSYRMAQDFFNAPLSPLQ  166



>ref|XP_003516791.1| PREDICTED: protein TORNADO 2 [Glycine max]
Length=269

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWL ++P + C+  L+WP++ +G+ I +V+LAGF
Sbjct  1    MALSNNVIGAINFVAVLLSIPIIGAGIWLTTEPADSCVKILQWPIIILGVLIFVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M +LI+LL+SL++  + VT        P R Y EYR+  +S W
Sbjct  61   IGAFWRIPMLLVFYLIAMLVLIVLLVSLVVFTYAVTLRGRGNIEPNRSYLEYRMDDFSIW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W  IR+CL   +IC  L+ ++ TA++FF AHL+P+Q
Sbjct  121  LRRRVRSSSKWDGIRSCLRSSNICADLDQQYRTAQEFFNAHLTPIQ  166



>gb|KHN25514.1| hypothetical protein glysoja_047080 [Glycine soja]
Length=269

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWL ++P + C+  L+WP++ +G+ I +V+LAGF
Sbjct  1    MALSNNVIGAINFVAVLLSIPIIGAGIWLTTEPADSCVKILQWPIIILGVLIFVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M +LI+LL+SL++  + VT        P R Y EYR+  +S W
Sbjct  61   IGAFWRIPMLLVFYLIAMLVLIVLLVSLVVFTYAVTLRGRGNIEPNRSYLEYRMDDFSIW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W  IR+CL   +IC  L+ ++ TA++FF AHL+P+Q
Sbjct  121  LRRRVRSSSKWDGIRSCLRSSNICADLDQQYRTAQEFFNAHLTPIQ  166



>ref|XP_009371218.1| PREDICTED: protein TORNADO 2-like [Pyrus x bretschneideri]
Length=269

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI   GIWLA++PDN C+  L+WPV+ +GI  ++V++AGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGTGIWLATEPDNSCVKLLQWPVIILGILFLVVAIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M +LIILL +L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   VGAFWRIPWLLICYLIAMLVLIILLAALVVFIYMVTIRGSGHLEPSRSYLEYHLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + S   W +IR CL+  ++C +LN  +  A+ FF AH++PLQ
Sbjct  121  LRRRVRSPFKWERIRTCLSSTNMCAELNQSYSMAQDFFNAHITPLQ  166



>ref|XP_007210528.1| hypothetical protein PRUPE_ppa009969mg [Prunus persica]
 gb|EMJ11727.1| hypothetical protein PRUPE_ppa009969mg [Prunus persica]
Length=269

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWLA++PDN C+  L+WPV+ +GI  ++V +AGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGAGIWLATEPDNSCVKILQWPVIILGILFLVVGIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M +LI+LL +L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   VGAFWRIPWLLISYLIAMLVLIVLLAALVVFIYMVTIRGSGHLEPSRSYLEYHLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + S   W +IR+CL+  ++C +LN  +  A+ FF AH++PLQ
Sbjct  121  LRRRVRSPWKWDRIRSCLSSTNMCGELNQSYRMAQDFFNAHITPLQ  166



>ref|XP_009804150.1| PREDICTED: protein TORNADO 2 [Nicotiana sylvestris]
Length=271

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWLA + DN C+  L+WPV+ +G+ I++V+LAGF
Sbjct  1    MALSNNVIGCINFVAMLLSIPVIGAGIWLAMETDNSCVKILQWPVIILGVVILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILI+LL  L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   IGGFWRIPALLIFYLIAMLILIVLLACLVVFIYMVTIRGSGHMEPSRAYLEYHLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            +R  + +S  W +IR+CL+   +C +LN  +  A+ FF A LSPLQ
Sbjct  121  IRRRVQTSYKWDRIRSCLSSTTMCAQLNQSYRMAQDFFNAPLSPLQ  166



>ref|XP_010055315.1| PREDICTED: protein TORNADO 2 [Eucalyptus grandis]
 gb|KCW71781.1| hypothetical protein EUGRSUZ_E00275 [Eucalyptus grandis]
Length=269

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWL+++ DN C+  L+WPV+ +G+ I++V+LAGF
Sbjct  1    MALSNNVIGAINFVAVLLSIPVIGAGIWLSTEADNACVKILQWPVIILGVLILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G  W+ + LL  YLV M ++I+LL  L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   IGGIWRIQWLLIFYLVAMLVMIVLLGCLVVFVYMVTVRGHGHPEPSRAYLEYDLNDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            +R  + SS  W KIR+CL+   +C +LN  +  A+ FF A +SPLQ
Sbjct  121  MRRRVKSSFKWDKIRSCLSSTSMCAELNQSYRMAQDFFDARISPLQ  166



>ref|XP_009630198.1| PREDICTED: protein TORNADO 2-like [Nicotiana tomentosiformis]
Length=271

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWLA + DN C+  L+WPV+ +G+ I++V+LAGF
Sbjct  1    MALSNNVIGCINFVAMLLSIPVIGAGIWLAMETDNSCVKILQWPVIILGVLILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILI+LL  L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   IGGFWRIPTLLIFYLIAMLILIVLLACLVVFIYMVTIRGSGHMEPSRAYLEYHLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR+CL+   +C +LN  +  A+ FF A +SPLQ
Sbjct  121  LRRRVQSSYKWDRIRSCLSSTTMCAQLNQSYRMAQDFFNAPISPLQ  166



>ref|XP_002304338.1| senescence-associated family protein [Populus trichocarpa]
 gb|EEE79317.1| senescence-associated family protein [Populus trichocarpa]
Length=269

 Score =   149 bits (375),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWLA++PDN C+  L+WPV+ +G+ I+ V+LAGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPVIGAGIWLATEPDNSCVKILQWPVIILGMLILKVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILIILL  L +  ++VT     +  P R Y EYRL  +S W
Sbjct  61   VGGFWRIPWLLIFYLIAMLILIILLACLTVFIYMVTVRGSGHLAPSRAYLEYRLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR CL+  + C +LN  +  A+ FF AH+SPLQ
Sbjct  121  LRRRVHSSYKWDRIRGCLSSSNTCAELNQSYHMAQDFFNAHISPLQ  166



>ref|XP_011028172.1| PREDICTED: protein TORNADO 2 [Populus euphratica]
Length=269

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWLA++PDN C+  L+WPV+ +G+ I+ V+LAGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPVIGAGIWLATEPDNSCVKILQWPVIILGLLILKVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILIILL  L +  ++VT     +  P R Y EYRL  +S W
Sbjct  61   VGGFWRIPWLLIFYLIAMLILIILLACLTVFIYMVTVRGSGHLAPSRAYLEYRLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR CL+  + C +LN  +  A+ FF AH+SPLQ
Sbjct  121  LRRRVHSSYKWDRIRGCLSSSNTCSELNQSYHMAQDFFNAHISPLQ  166



>ref|XP_006647076.1| PREDICTED: tetraspanin-2-like [Oryza brachyantha]
Length=270

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 114/169 (67%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA +  +A +C++P+ A+G+W AS    EC    RWPV  +G  I+L +LAGF
Sbjct  1    MAVSNNITACVTLMALICAVPVIASGVWFASAQGEECARLARWPVAILGGLILLAALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW +  LL  YL  MA LI LL++LL+ AF VTR SGAY V GR YDEY L G+S W
Sbjct  61   VGAYWNRRRLLAFYLFAMASLIALLVALLVFAFAVTRGSGAYPVVGRAYDEYHLDGFSMW  120

Query  500  LRNHITSSDS-WGKIRACLADGDICPKLNNE--FFTAEQFFAAHLSPLQ  637
            LR +++   + W +I+ACL   D C KL  +  F TA+QF+ +HLSPLQ
Sbjct  121  LRGYVSDDPARWERIKACLVVSDTCKKLARQAGFLTADQFYQSHLSPLQ  169



>gb|KDO37999.1| hypothetical protein CISIN_1g047660mg [Citrus sinensis]
Length=171

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 107/166 (64%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +N +A + SIP+  AGIWLA++ DN C+  L+WPV+ +GI I++V+LA F
Sbjct  1    MALSNNVIRPINLVAILLSIPVIGAGIWLATEADNSCVKLLQWPVIILGILILVVALARF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL LYLV M ILIILL  L++  ++V      Y  P R Y EYRL  +S W
Sbjct  61   IGGFWRIHWLLILYLVAMLILIILLACLVVFIYMVMIKGSGYLAPSRAYLEYRLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L   + S   W +I++ L+   +CP+LN  +  A+ FF AH++PLQ
Sbjct  121  LCRRVRSPYKWDRIKSYLSSTQMCPELNQSYRMAQDFFNAHITPLQ  166



>ref|XP_008373579.1| PREDICTED: protein TORNADO 2 [Malus domestica]
Length=269

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI   GIWLA++PDN C+  L+WPV+ +GI  ++V++AGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGTGIWLATEPDNSCVKLLQWPVIILGILFLVVAIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M +LIILL +L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   VGAFWRIPWLLICYLIAMLVLIILLAALVVFIYMVTIRGSGHLEPSRSYLEYHLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + S   W +IR CL+  ++C +LN  +  A+ FF AH++P Q
Sbjct  121  LRRRVRSPFKWERIRTCLSSTNMCAELNQSYSMAQDFFNAHITPXQ  166



>ref|XP_004951448.1| PREDICTED: tetraspanin-2-like [Setaria italica]
Length=268

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 114/169 (67%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA +  LA +C++P+ A+GIW AS   +EC    RWPV  +G  ++L +LAGF
Sbjct  1    MAVSNNITACVTLLALICAVPVIASGIWFASAQGDECARLARWPVAILGGLLLLAALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW +  LL  YL  MA LI+LL++LL+ AF VTR SGAY V GR YD+Y L G+S W
Sbjct  61   VGAYWNRRRLLAFYLFAMAALIVLLIALLVFAFAVTRGSGAYPVLGRAYDDYHLDGFSMW  120

Query  500  LRNHITSS-DSWGKIRACLADGDICPKLNNE--FFTAEQFFAAHLSPLQ  637
            LR +++     W KI+ACL   D C KL  +  F  AEQF+ +HLSPLQ
Sbjct  121  LRGYVSDDPGRWEKIKACLVVSDTCKKLARQAAFVNAEQFYQSHLSPLQ  169



>ref|XP_010687692.1| PREDICTED: tetraspanin-8-like [Beta vulgaris subsp. vulgaris]
Length=267

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 109/167 (65%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M  SN++   LNF+ F+ SIPI   GIWLA K   +C  +L  PV+ +G+ +MLVS+AG 
Sbjct  1    MKCSNSLVGVLNFITFLLSIPILGGGIWLAHKATTDCEKYLERPVIALGVFLMLVSIAGL  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL+ M +LI++L    I AFVVT      +V GRGY EYRLG YS+W
Sbjct  61   IGACCRVNWLLWVYLLVMFLLILILFCFTIFAFVVTNKGAGDAVGGRGYKEYRLGDYSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAE-QFFAAHLSPLQ  637
            L+  + S+ +W +IR+CL DG +C KL+ E  TA  +FFA HLSP++
Sbjct  121  LQKRVESNKNWNRIRSCLIDGKVCQKLSQETNTASTEFFAKHLSPIE  167



>gb|KJB25297.1| hypothetical protein B456_004G184300 [Gossypium raimondii]
Length=269

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWLA++PDN C+  L+WPV+ +G+ I++V+LAGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGAGIWLANQPDNSCVKILQWPVIVLGVLILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YLV M ILIILL  L++  ++VT     +  P R Y EY L  +S W
Sbjct  61   IGGFWRIPWLLIAYLVGMLILIILLACLVVFVYMVTMRGSGHLEPSRAYLEYHLEDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  + SS  W +I+ CL+  DIC +LN  +  A  FF +HL+P++
Sbjct  121  LQRRVRSSFKWERIKICLSSTDICTQLNQTYTMAIDFFNSHLTPIE  166



>ref|XP_008781378.1| PREDICTED: tetraspanin-8 [Phoenix dactylifera]
Length=270

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 105/164 (64%), Gaps = 0/164 (0%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LNFL F+ SIPI  +GIWLA++   +C  +L+ PV+ +G+ +M+VSLAG  G
Sbjct  4    LSNNLIGILNFLTFLLSIPILGSGIWLATRGSTDCEKFLQGPVIAVGVFLMVVSLAGLVG  63

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL +YL CM +LI+LL    + AFVVT       V GRGY EYRLG YS+WL+
Sbjct  64   ACCRVSWLLWVYLFCMFLLIVLLFCFTVFAFVVTNKGAGEVVSGRGYKEYRLGDYSNWLQ  123

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
              + +  +W KIR+CL D  +C +L  +  T +QF    LSP+Q
Sbjct  124  KRVNNGKNWAKIRSCLQDSKVCQRLQAKNQTLDQFIQGSLSPIQ  167



>ref|XP_008238234.1| PREDICTED: protein TORNADO 2 [Prunus mume]
Length=269

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWLA++PDN C+  L+WPV+ +GI  ++V +AGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGAGIWLATEPDNSCVKILQWPVIILGILFLVVGIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M +LI+LL +L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   VGAFWRIPWLLISYLIAMLVLIVLLAALVVFIYMVTVKGSGHLEPSRSYLEYHLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + S   W +IR+CL+  ++C +LN  +  A+ FF A ++PLQ
Sbjct  121  LRRRVRSPWKWDRIRSCLSSTNMCGELNQSYRMAQDFFNARITPLQ  166



>gb|KHG02386.1| hypothetical protein F383_25371 [Gossypium arboreum]
Length=261

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWLA++PDN C+  L+WPV+ +G+ I++V+LAGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGAGIWLANQPDNSCVKILQWPVIVLGVLILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YLV M ILIILL  L++  ++VT     +  P R Y EY L  +S W
Sbjct  61   IGGFWRIPWLLIAYLVGMLILIILLACLVVFVYMVTMRGSGHLEPSRAYLEYHLEDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  + SS  W +I+ CL+  DIC +LN  +  A  FF +HL+P++
Sbjct  121  LQRRVRSSFKWERIKICLSSTDICTQLNQTYTMAIDFFNSHLTPIE  166



>ref|XP_002518412.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43799.1| conserved hypothetical protein [Ricinus communis]
Length=269

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWLA +PDN C+  L+WPV+ +GI I++V+LAGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGAGIWLAMEPDNSCVRILQWPVIILGILILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILIILL  L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   VGGFWRIPWLLIFYLIAMLILIILLACLVVFIYMVTLRGSGHLAPSRTYLEYHLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR+CL+   +C +LN  +  A+ FF A ++PLQ
Sbjct  121  LRQRVQSSYKWDRIRSCLSSSSMCAELNQSYRMAQDFFNARITPLQ  166



>dbj|BAJ90218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=269

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 114/169 (67%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA +  +A +C++P+ A+G+W AS    EC    RWPV  +G  I+L +LAGF
Sbjct  1    MAVSNNITACVTLMALICAVPVIASGVWFASAQGEECARLARWPVAILGGLILLAALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW +  LL  YL  M  LI LL++LL+ AF VTR SGAY V GR YDEYRL G+S W
Sbjct  61   VGAYWNRRRLLAFYLFAMGALIALLIALLVFAFAVTRGSGAYPVLGREYDEYRLDGFSMW  120

Query  500  LRNHITSSDS-WGKIRACLADGDICPKLNNE--FFTAEQFFAAHLSPLQ  637
            LR +++   + W  IR+C+A  D C KL  +  F TA+QF+ +HL+PLQ
Sbjct  121  LRGYVSDDPARWEGIRSCIAVSDTCKKLARQASFVTADQFYQSHLTPLQ  169



>ref|XP_010911362.1| PREDICTED: protein TORNADO 2-like, partial [Elaeis guineensis]
Length=166

 Score =   143 bits (360),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSN I A +NF+A + SIPI AAGIWL+ + DN C+  L+WPV+ +G+ I++V+ AGF
Sbjct  1    MALSNTIIAAINFVAMLLSIPIIAAGIWLSMQTDNSCVGLLQWPVIVLGVVILVVAFAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YLV M +LI+L+ SL++  + VT P GA+  P R Y EYRL  YS W
Sbjct  61   VGAFWRIPWLLLFYLVAMFVLILLVASLVVFIYTVTNPGGAHPAPSRAYLEYRLEDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +I+ CL     C +LN  +  A+ FF A ++PL+
Sbjct  121  LRRRVESSHKWDRIKKCLGSTSTCAELNQTYREAQDFFNARINPLE  166



>ref|XP_007156422.1| hypothetical protein PHAVU_003G284700g [Phaseolus vulgaris]
 gb|ESW28416.1| hypothetical protein PHAVU_003G284700g [Phaseolus vulgaris]
Length=269

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI AAGIWL ++P + C+  L+WPV+ +G+ I++V++AG 
Sbjct  1    MALSNNVIGAINFVALLLSIPIIAAGIWLTTEPADSCVKVLQWPVIILGVLILVVAIAGC  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YLV M +LI+LL+SL++  + VT        P R Y EYR+  +S W
Sbjct  61   VGAFWRMPSLLVFYLVAMFVLIVLLVSLVVFTYAVTLRGHGNIEPNRSYLEYRIDDFSLW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS+ W  +R CL   +IC +L+  + T + FF AHL+P++
Sbjct  121  LRRRVRSSNRWDNVRRCLMSSNICAELDQRYRTPQDFFNAHLTPIE  166



>gb|EMS47667.1| hypothetical protein TRIUR3_32517 [Triticum urartu]
Length=172

 Score =   143 bits (360),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 114/170 (67%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA LNFLA +C+IP+ A G+W ASK   EC    RWPV  +G  ++LV+LAGF
Sbjct  1    MAVSNNITACLNFLALICTIPVVATGLWFASKQGAECARLARWPVAILGGLLLLVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW ++GLL  YL  MA LI LLL+LL+ AF VT  SGAY VPGR Y EYRL G+S W
Sbjct  61   VGAYWNRQGLLAAYLFAMAALITLLLALLVFAFAVTHGSGAYDVPGRAYREYRLEGFSGW  120

Query  500  LRNHITSS-DSWGKIRACLADGDICPKLNNE---FFTAEQFFAAHLSPLQ  637
            +R ++      W  IRACLA  D C KL  E   F   EQF+ + LSPLQ
Sbjct  121  MRGYVAGDPRRWEGIRACLAASDTCKKLTMETAFFIAPEQFYQSDLSPLQ  170



>gb|EMT16464.1| hypothetical protein F775_32677 [Aegilops tauschii]
Length=274

 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 115/170 (68%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA LNFLA +C+IP+ A G+W ASK   EC    RWPV  +G+ ++LV+LAGF
Sbjct  1    MAVSNNITACLNFLALICTIPVVATGLWFASKQGAECARLARWPVAILGVLLLLVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW ++GLL  YL  MA LI LLL+LL+ AF VT  SGAY VPGR Y EYRL G+S W
Sbjct  61   VGAYWNRQGLLAAYLFAMAALITLLLALLVFAFAVTHGSGAYDVPGRAYREYRLEGFSGW  120

Query  500  LRNHITSS-DSWGKIRACLADGDICPKLNNE---FFTAEQFFAAHLSPLQ  637
            LR ++      W  IRACLA  D C KL  E   F   EQF+ + LSPLQ
Sbjct  121  LRGYVAGDPRRWEGIRACLAASDTCKKLTMETAFFIAPEQFYQSDLSPLQ  170



>ref|NP_001046313.2| Os02g0219700 [Oryza sativa Japonica Group]
 dbj|BAD17193.1| putative senescence-associated protein [Oryza sativa Japonica 
Group]
 gb|EAY85039.1| hypothetical protein OsI_06396 [Oryza sativa Indica Group]
 dbj|BAH01286.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF08227.2| Os02g0219700 [Oryza sativa Japonica Group]
Length=270

 Score =   145 bits (367),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 113/169 (67%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA +  +A +C++P+ A+G+W AS    EC    RWPV  +G  I+L +LAGF
Sbjct  1    MAVSNNITACVTLMALICAVPVIASGVWFASAQGEECARLARWPVAILGGLILLAALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW +  LL  YL  MA LI LL++LL+ AF VTR SGAY V GR YDEY L G+S W
Sbjct  61   VGAYWNRRRLLAFYLFAMASLIALLIALLVFAFAVTRGSGAYPVLGRAYDEYHLDGFSMW  120

Query  500  LRNHITSSDS-WGKIRACLADGDICPKLNNE--FFTAEQFFAAHLSPLQ  637
            LR +++   + W +I+ACL   D C KL  +  F TA+QF+ + LSPLQ
Sbjct  121  LRGYVSDDPARWERIKACLVVSDTCKKLARQAGFLTADQFYQSRLSPLQ  169



>gb|EAZ01413.1| hypothetical protein OsI_23447 [Oryza sativa Indica Group]
Length=272

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 119/170 (70%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA +NFLA +C++P+ A G+W ASK  ++C    RWP+  +G A++LV+LAGF
Sbjct  1    MAVSNNITACVNFLALVCAVPVVATGVWFASKQGDDCARVARWPLAILGAALLLVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
            AGAYW + GLL  YL  MA LI LLL+LL+ AF VTRPSGAY    R YD+YRL GYS+W
Sbjct  61   AGAYWNRRGLLAAYLFAMAALITLLLALLVFAFAVTRPSGAYPAFARAYDDYRLDGYSTW  120

Query  500  LRNHITSS-DSWGKIRACLADGDICPKLNNE---FFTAEQFFAAHLSPLQ  637
            LR+ I      W  IRACLA  D C KL  E   F T EQF+ +HL+PLQ
Sbjct  121  LRDRIAGDPRRWEGIRACLAASDTCRKLAQESVFFITPEQFYQSHLTPLQ  170



>gb|KDP20689.1| hypothetical protein JCGZ_21160 [Jatropha curcas]
Length=269

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWLA + DN C+  L+WPV+ +GI I++V++AGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGAGIWLAMETDNSCVKILQWPVIILGILILVVAIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILIILL  L++  ++VT     +  P R Y EY L  +S W
Sbjct  61   VGGFWRIPWLLIFYLIAMLILIILLACLVVFIYMVTIRGSGHLEPNRAYLEYHLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR+CL+  D C +LN  F  A+ FF AH++PLQ
Sbjct  121  LRRRVQSSYKWDRIRSCLSSTDNCAELNQRFRMAQDFFNAHITPLQ  166



>ref|XP_006352863.1| PREDICTED: protein TORNADO 2-like [Solanum tuberosum]
Length=271

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWLA +PDN C+  L+WPV+ +G+ I++V+LAGF
Sbjct  1    MALSNNVIGCINFVAMLLSIPVIGAGIWLAMEPDNSCVKILQWPVIILGVLILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILIILL  L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   IGGFWRIPALLIFYLIAMLILIILLACLVVFIYMVTIRGSGHMEPSRTYLEYHLEDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR CL+   +C +LN  +  A+ FF A LSPLQ
Sbjct  121  LRRRVQSSFKWDRIRTCLSSTSMCAQLNQSYKMAQDFFNAPLSPLQ  166



>ref|XP_004245901.1| PREDICTED: protein TORNADO 2 [Solanum lycopersicum]
Length=271

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWLA +PDN C+  L+WPV+ +G+ I++V+LAGF
Sbjct  1    MALSNNVIGCINFVAMLLSIPVIGAGIWLAMEPDNSCVKILQWPVIILGVLILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILIILL  L++  ++VT     +  P R Y EY L  YS W
Sbjct  61   IGGFWRIPALLIFYLIAMLILIILLACLVVFIYMVTIRGSGHMEPSRTYLEYHLEDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR CL+   +C +LN  +  A+ FF A LSPLQ
Sbjct  121  LRRRVQSSFKWDRIRTCLSSTSMCAQLNQSYKMAQDFFNAPLSPLQ  166



>ref|NP_001057919.1| Os06g0572400 [Oryza sativa Japonica Group]
 dbj|BAD61836.1| putative senescence-associated protein [Oryza sativa Japonica 
Group]
 dbj|BAD61940.1| putative senescence-associated protein [Oryza sativa Japonica 
Group]
 dbj|BAF19833.1| Os06g0572400 [Oryza sativa Japonica Group]
 dbj|BAG91861.1| unnamed protein product [Oryza sativa Japonica Group]
Length=272

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 119/170 (70%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA +NFLA +C++P+ A G+W ASK  ++C    RWP+  +G A++LV+LAGF
Sbjct  1    MAVSNNITACVNFLALVCAVPVVATGVWFASKQGDDCARVARWPLAILGAALLLVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
            AGAYW + GLL  YL  MA LI LLL+LL+ AF VTRPSGAY    R YD+YRL GYS+W
Sbjct  61   AGAYWNRRGLLAAYLFAMAALITLLLALLVFAFAVTRPSGAYPAFARAYDDYRLDGYSTW  120

Query  500  LRNHITSS-DSWGKIRACLADGDICPKLNNE---FFTAEQFFAAHLSPLQ  637
            LR+ +      W  IRACLA  D C KL  E   F T EQF+ +HL+PLQ
Sbjct  121  LRDRVAGDPRRWEGIRACLAASDTCRKLAQESVFFITPEQFYQSHLTPLQ  170



>ref|XP_007039476.1| Tetraspanin family protein [Theobroma cacao]
 gb|EOY23977.1| Tetraspanin family protein [Theobroma cacao]
Length=269

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWLA++PDN C+  L+WPV+ +G+ I++V++AGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPIIGAGIWLANQPDNSCVKILQWPVIVLGVLILVVAIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YLV M ILIILL  L++  ++VT     +  P R Y EY L  +S W
Sbjct  61   IGGFWRIPWLLIAYLVGMLILIILLACLVVFIYMVTIRGSGHLAPSRAYLEYHLEDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  + SS  W +I+ CL+  ++C +LN  +  A  FF AHL+P++
Sbjct  121  LQRRVRSSYKWERIKVCLSSTEMCAQLNQSYTMAIDFFNAHLTPIE  166



>ref|XP_002970026.1| hypothetical protein SELMODRAFT_440948 [Selaginella moellendorffii]
 gb|EFJ29150.1| hypothetical protein SELMODRAFT_440948 [Selaginella moellendorffii]
Length=268

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M LSN +T  LNFL    +IP+  AGIWL+ + D  C+ +L+ PV+ IG+ I++VSLAGF
Sbjct  1    MGLSNYLTGILNFLTLALAIPVIGAGIWLSQRHDTVCMRFLQGPVIAIGVFILVVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G+ ++   LL +YL  M +LI+LLL+  I AF VT     +++ G+GY EYRLG YS+W
Sbjct  61   IGSCFRVSWLLWIYLFVMFLLIMLLLAFTIFAFAVTNRGAGHALSGKGYKEYRLGDYSTW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L   + ++ +W KI++CLAD  +C  L+NE+ T   F AA L+PL+
Sbjct  121  LERRVKNTGNWNKIKSCLADAKVCRDLDNEYPTEAAFSAARLTPLE  166



>ref|XP_007039477.1| Tetraspanin family protein, putative [Theobroma cacao]
 gb|EOY23978.1| Tetraspanin family protein, putative [Theobroma cacao]
Length=319

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 115/192 (60%), Gaps = 0/192 (0%)
 Frame = +2

Query  62   FFFLFPNHYELLNSpplttatpppatMSLSNNITAFLNFLAFMCSIPITAAGIWLASKPD  241
            F F+  +H +     P  ++  P   M+ SN I   +NF+  + SIPI  AGIWLA++PD
Sbjct  22   FLFIIRSHSQATKPSPERSSQNPVTKMAASNTIVGTINFITLLLSIPIIGAGIWLANEPD  81

Query  242  NECIHWLRWPVVFIGIAIMLVSLAGFAGAYWKKEGLLGLYLVCMAiliilllsllilAFV  421
            N C+  L+WP++ +GI+I +V+L GF G  W+   LL +YLV M ILI+L   L++L ++
Sbjct  82   NSCVKILQWPLIILGISISVVALLGFVGGCWRITWLLIVYLVAMFILIVLFACLVVLIYL  141

Query  422  VTRPSGAYSVPGRGYDEYRLGGYSSWLRNHITSSDSWGKIRACLADGDICPKLNNEFFTA  601
            VT     +  PGR Y E+ L  +S WLR  + S   W +IRACL   D+C +LN  +  A
Sbjct  142  VTNKGSGHPAPGRTYLEHDLDDFSGWLRRKVASPYKWNRIRACLNSTDMCSELNQRYRIA  201

Query  602  EQFFAAHLSPLQ  637
            + FF A L+ +Q
Sbjct  202  QDFFNARLTSIQ  213



>ref|XP_010695565.1| PREDICTED: protein TORNADO 2 [Beta vulgaris subsp. vulgaris]
Length=269

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 104/166 (63%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NFL  + +IPI   GIWLAS P+N CI  L+WPV+ IG   ++V+LAGF
Sbjct  1    MALSNNVIGAINFLGILLAIPIIGTGIWLASDPENSCIKILQWPVIIIGALTLIVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M I+IILL SL++  F+VT     +  P R Y EYRL  +S +
Sbjct  61   VGGFWRNAPLLIFYLIGMLIMIILLASLVVFVFMVTSRGAGHPAPSRAYLEYRLDSFSGF  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  +     W  I++CL+    CP+LN  +  A+ FF A LSP+Q
Sbjct  121  LRRRVHGPFKWALIKSCLSSTSFCPELNQTYTMAQDFFNAPLSPVQ  166



>ref|XP_003549518.1| PREDICTED: tetraspanin-8 [Glycine max]
 gb|KHN17536.1| hypothetical protein glysoja_005733 [Glycine soja]
Length=270

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            +  SNN+   LNFL F+ SIPI  AG+WL+ +   EC  WL  PV+ +G+ +MLVSLAG 
Sbjct  2    VRFSNNVIGLLNFLTFLLSIPILVAGVWLSKQGATECERWLEKPVIALGVFLMLVSLAGL  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL LYL+ M +LI+LL +  I AFVVT       V  RGY EYRLG YS+W
Sbjct  62   VGACCRVSWLLWLYLLVMFVLIVLLFAFTIFAFVVTNKGAGEVVSNRGYKEYRLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + ++ +W +I +CL  G +C +  ++F   T  QF+  HLS LQ
Sbjct  122  LQKKVNNTKTWNRISSCLHSGKVCTEFQSKFLNDTVTQFYTEHLSALQ  169



>ref|XP_002993321.1| hypothetical protein SELMODRAFT_272321 [Selaginella moellendorffii]
 gb|EFJ05646.1| hypothetical protein SELMODRAFT_272321 [Selaginella moellendorffii]
Length=268

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M LSN +T  LNFL    +IP+  AGIWL+ + D  C+ +L+ PV+ IG+ I++VSLAGF
Sbjct  1    MGLSNYLTGILNFLTLALAIPVIGAGIWLSQRHDTVCMRFLQGPVIAIGVFILVVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G+ ++   LL +YL  M +LI+LLL+  I AF VT     +++ G+GY EYRLG YS+W
Sbjct  61   IGSCFRVSWLLWIYLFVMFLLIVLLLAFTIFAFAVTNRGAGHALSGKGYKEYRLGDYSTW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L   + ++ +W +I++CLAD  +C  L+NE+ T   F AA L+PL+
Sbjct  121  LERRVKNTGNWNRIKSCLADAKVCRDLDNEYPTEAAFSAARLTPLE  166



>ref|XP_002278741.1| PREDICTED: protein TORNADO 2 [Vitis vinifera]
 emb|CAN69080.1| hypothetical protein VITISV_042237 [Vitis vinifera]
 emb|CBI33877.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+N +   +NF+A + SIPI   GIWL+++PDN C+  L+WPV+ +G+ I++V+LAGF
Sbjct  1    MALNNTVIGAINFVAMLLSIPIIGTGIWLSTEPDNSCVKILQWPVIILGVLILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILIILL SL++  ++VT     +  P R Y EY L  YS W
Sbjct  61   IGGFWRIPWLLLFYLIAMLILIILLASLVVFIYMVTVRGHGHIEPSRAYLEYHLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR CL+  ++C +LN  +  A+ FF AH+SP+Q
Sbjct  121  LRRRVRSSYKWDRIRTCLSSTNMCAELNQRYRMAQDFFNAHISPIQ  166



>ref|XP_006660645.1| PREDICTED: tetraspanin-8-like [Oryza brachyantha]
Length=279

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 1/165 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPD-NECIHWLRWPVVFIGIAIMLVSLAGFA  322
            LSNN+   LN + F+ S+P+  AGIWL ++ D  EC  +L  PV+ +G+ +MLVS+AG  
Sbjct  5    LSNNLIGILNAVTFLLSVPVLGAGIWLGTRADGTECERYLSAPVIALGVFLMLVSVAGLV  64

Query  323  GAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWL  502
            GA  +   LL  YLV M +LI+++L   + AF VT      +V G+GY EY+LG YS+WL
Sbjct  65   GACCRVNCLLWFYLVAMFVLIVVVLCFTVFAFAVTNKGAGEAVSGKGYKEYKLGDYSNWL  124

Query  503  RNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            R  + +S +W +IR+CL D  +C  L  E +T +QFF A LSPL+
Sbjct  125  RKRVENSKNWNRIRSCLQDSKVCKTLQQEKWTQDQFFKASLSPLE  169



>gb|KHG15651.1| Tetraspanin-31 [Gossypium arboreum]
 gb|KHG16980.1| Tetraspanin-31 [Gossypium arboreum]
Length=272

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 106/166 (64%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LNF+ F+ SIPI  AGIWL+ +   EC  +L  PV+ IG+ +MLVSLAG  G
Sbjct  5    LSNNLVGILNFITFLLSIPILGAGIWLSREGVTECERFLDKPVIVIGVFLMLVSLAGLIG  64

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL LYLV M +LI+L +   I AF VT      ++ G+GY EYRLG YS+WL+
Sbjct  65   ACCRVTWLLWLYLVVMFLLIVLGIVFTIFAFAVTNKGAGEALSGKGYKEYRLGDYSNWLQ  124

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
              +TS  +W KI++CLAD  +C    +++   +A +F+  HLS +Q
Sbjct  125  KRVTSQKNWNKIKSCLADSKVCTDFRDKYLNASASEFYQTHLSAVQ  170



>ref|XP_003542315.2| PREDICTED: tetraspanin-8-like [Glycine max]
Length=305

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 106/168 (63%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            +  SNN+   LNFL F+ SIPI  AG+WL+ +   EC  WL  PV+ +G+ +MLVSLAG 
Sbjct  37   VRFSNNVIGLLNFLTFLLSIPILVAGVWLSKQGATECERWLEKPVIALGVFLMLVSLAGL  96

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL LYL+ M +LI+LL +  I AFVVT       V  RGY EYRLG YS+W
Sbjct  97   VGACCRVSWLLWLYLLVMFVLIVLLFAFTIFAFVVTNKGAGEVVSNRGYKEYRLGDYSNW  156

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + ++ +W +IR+CL  G +C +  ++F   T  +F++ +LS LQ
Sbjct  157  LQKRVNNTKTWNRIRSCLQSGKVCTEFQSKFLNDTVTEFYSENLSALQ  204



>gb|ACU20029.1| unknown [Glycine max]
Length=270

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 106/168 (63%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            +  SNN+   LNFL F+ S+PI  AG+WL+ +   EC  WL  PV+ +G+ +MLVSLAG 
Sbjct  2    VRFSNNVIGLLNFLTFLLSVPILVAGVWLSKQGATECERWLEKPVIALGVFLMLVSLAGL  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL LYL+ M +LI+LL +  I AFVVT       V  RGY EYRLG YS+W
Sbjct  62   VGACCRVSWLLWLYLLVMFVLIVLLFAFTIFAFVVTNKGAGEVVSNRGYKEYRLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + ++ +W +IR+CL  G +C +  ++F   T  +F++ +LS LQ
Sbjct  122  LQKRVNNTKTWNRIRSCLQSGKVCTEFQSKFLNDTVTEFYSENLSALQ  169



>ref|XP_004966042.1| PREDICTED: tetraspanin-2-like [Setaria italica]
Length=274

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 114/170 (67%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNE-CIHWLRWPVVFIGIAIMLVSLAG  316
            M++SNNITA +NFL  +C++PI A G+WLAS+   + C    RWPV  +G  ++LV+LAG
Sbjct  1    MAVSNNITACINFLVLLCTVPIAATGVWLASRHGGDGCARLARWPVAALGALLLLVALAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            F GAY  + GLL  YL  MA LI LLL+L++LAF VT  SGAY VPGR YD+YRL GYS 
Sbjct  61   FLGAYRNRRGLLACYLFAMAGLITLLLALIVLAFAVTHGSGAYPVPGRAYDDYRLEGYSP  120

Query  497  WLRNHITSS-DSWGKIRACLADGDICPKL--NNEFFTAEQFFAAHLSPLQ  637
            WLR ++    + W  IRAC+A    C KL  +  F   EQF+  HLSP+Q
Sbjct  121  WLRRYVAGDPERWEGIRACVAGSGTCRKLATDRSFIVPEQFYMTHLSPIQ  170



>ref|XP_007154836.1| hypothetical protein PHAVU_003G151800g [Phaseolus vulgaris]
 gb|ESW26830.1| hypothetical protein PHAVU_003G151800g [Phaseolus vulgaris]
Length=267

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 107/168 (64%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            +  SNN+   LNFL F+ SIPI   G+WL+ +   EC  WL  PV+ +G+ +M+VSLAG 
Sbjct  2    VRFSNNVIGLLNFLTFLLSIPILVGGVWLSKQGTTECERWLEKPVIALGVFLMIVSLAGL  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL LYL+ M +LI+LL +  I AFVVT      +V GRGY EYRLG YS+W
Sbjct  62   IGACCRVSWLLWLYLLVMFLLIVLLFAFTIFAFVVTNKGAGETVSGRGYKEYRLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + ++++W +I++CL  G +C +   +F   T  +F++ +LS +Q
Sbjct  122  LQKRVNNANTWNRIKSCLQSGKVCTEFQTKFLNDTVNEFYSENLSAIQ  169



>ref|XP_009414630.1| PREDICTED: tetraspanin-8 [Musa acuminata subsp. malaccensis]
Length=270

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 106/166 (64%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            +  SNN+   LN + F+ SIPI +AGIWLA +   +C  +L+WPV+ +G+ ++LVSLAG 
Sbjct  2    VRFSNNLIGVLNIITFVLSIPILSAGIWLARRATTDCEKFLQWPVIALGVFLLLVSLAGV  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL  YL+ M ILIILL    + AFVVT      +V GRG+ EYRLG YS+W
Sbjct  62   VGACCRNSCLLWFYLLVMFILIILLFCFTVFAFVVTNKGAGEAVSGRGFKEYRLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  + S  +W +I++CL DG +C  L  +  T +QF   +LSP+Q
Sbjct  122  LQKRVDSDKNWRRIKSCLQDGKVCRSLQEKNQTWDQFVNYNLSPIQ  167



>gb|AGV54443.1| senescence-associated protein [Phaseolus vulgaris]
Length=267

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 107/168 (64%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            +  SNN+   LNFL F+ SIPI   G+WL+ +   EC  WL  PV+ +G+ +M+VSLAG 
Sbjct  2    VRFSNNVIGLLNFLTFLLSIPILVGGVWLSKQGTTECERWLEKPVIALGVFLMIVSLAGL  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL LYL+ M +LI+LL +  I AFVVT      +V GRGY EYRLG YS+W
Sbjct  62   IGACCRVSWLLWLYLLVMFLLIVLLFAFTIFAFVVTNKGAGETVSGRGYKEYRLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + ++++W +I++CL  G +C +   +F   T  +F++ +LS +Q
Sbjct  122  LQKRVNNANTWNRIKSCLQSGKVCTEFQTKFLNDTVNEFYSENLSAIQ  169



>dbj|BAK03335.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 114/170 (67%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNITA LNFLA +C+IP+ A G+W ASK   EC    RWPV  +G  ++LV+LAGF
Sbjct  1    MAVSNNITACLNFLALICTIPVVATGLWFASKQGAECARLARWPVAILGGLLLLVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GAYW ++GLL  YL  MA LI LLL+LL+ AF VT  SGAY VPGR Y EYRL G+S W
Sbjct  61   VGAYWNRQGLLAAYLFAMAALITLLLALLVFAFAVTHGSGAYVVPGRAYREYRLEGFSGW  120

Query  500  LRNHITSS-DSWGKIRACLADGDICPKLNNE---FFTAEQFFAAHLSPLQ  637
            LR ++      W  IRACLA  D C KL  E   F   EQF+ + LSPLQ
Sbjct  121  LRGYVAGDPRRWDGIRACLAASDTCRKLTVEAAFFIAPEQFYQSDLSPLQ  170



>ref|XP_010047035.1| PREDICTED: tetraspanin-8-like [Eucalyptus grandis]
 gb|KCW78784.1| hypothetical protein EUGRSUZ_C00218 [Eucalyptus grandis]
Length=272

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 107/168 (64%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            + LSNN+   LN + F+ SIPI  AGIWL+++   +C  +L  PV+ +G+ +MLVSLAG 
Sbjct  2    VRLSNNLVGVLNLVTFLLSIPILGAGIWLSNRASTDCEKFLERPVIALGVFLMLVSLAGL  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL+ M +LI+LL    + AFVVT       + GRGY EYRLG YS W
Sbjct  62   VGACCRVSWLLWVYLLVMFLLIVLLFCFTVFAFVVTNKGAGEVLGGRGYKEYRLGDYSHW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  ++S+ +W KI++CL+DG +C     ++   T E+F+  HLS LQ
Sbjct  122  LQKRVSSTKNWNKIKSCLSDGKVCSSFQEKYLNDTIEKFYTEHLSALQ  169



>gb|KJB23553.1| hypothetical protein B456_004G104300 [Gossypium raimondii]
Length=272

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 106/166 (64%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LNF+ F+ SIPI  AGIWL+ +   EC  +L  PV+ IG+ +MLVSLAG  G
Sbjct  5    LSNNLVGILNFITFLLSIPILGAGIWLSREGVTECERFLDKPVIVIGVFLMLVSLAGLIG  64

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL LYLV M +LI+L +   I AF VT      ++ G+GY EYRLG YS+WL+
Sbjct  65   ACCRVTWLLWLYLVVMFLLIVLGIVFTIFAFAVTNKGAGEALSGKGYKEYRLGDYSNWLQ  124

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
              +T   +W KI++CLAD  +C   ++++   +A +F+  HLS +Q
Sbjct  125  KRVTGQKNWNKIKSCLADSKVCTDFHDKYLNTSASEFYQTHLSSVQ  170



>gb|KJB53853.1| hypothetical protein B456_009G008000 [Gossypium raimondii]
Length=271

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 105/166 (63%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LN + F+ SIPI  AGIWL  +   EC  +L  PV+ IG+ +MLVSLAG  G
Sbjct  5    LSNNLVGILNLITFLLSIPILGAGIWLRREGVTECEQFLDTPVIIIGVFLMLVSLAGLIG  64

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL LYLV M +LI+L +   I AFVVT       + G+GY EYRLG YS+WL+
Sbjct  65   ACCRVTWLLWLYLVVMFLLIVLGIVFTIFAFVVTNKGAGQVLSGKGYKEYRLGDYSNWLQ  124

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFFTAE--QFFAAHLSPLQ  637
              +T + +W KI++CLAD  +C   ++++  A   +F+ AHLS +Q
Sbjct  125  KRVTDNKNWNKIKSCLADSKVCTDFHDKYLNASLPEFYQAHLSAVQ  170



>ref|XP_002460242.1| hypothetical protein SORBIDRAFT_02g025180 [Sorghum bicolor]
 gb|EER96763.1| hypothetical protein SORBIDRAFT_02g025180 [Sorghum bicolor]
Length=271

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 107/165 (65%), Gaps = 1/165 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPD-NECIHWLRWPVVFIGIAIMLVSLAGFA  322
            LSNN+   LNF+ F+ SIPI  AGIWL  + D  EC  +L  PV+ +G+ +++VSLAG  
Sbjct  5    LSNNLIGILNFITFLLSIPILGAGIWLGQRADGTECERYLSAPVIAVGVFLLVVSLAGLV  64

Query  323  GAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWL  502
            GA  +   LL +YL+ M +LI++L    + AFVVT      +V GRGY EYRLG YS+WL
Sbjct  65   GACCRVTWLLWVYLLAMFVLILVLFCFTVFAFVVTNKGAGEAVSGRGYKEYRLGDYSNWL  124

Query  503  RNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            +  + ++ +W KIR+CL D  +C KL ++  T  QF ++ LSP++
Sbjct  125  QKRVENTKNWDKIRSCLEDSKVCKKLQDKNETFTQFISSDLSPIE  169



>ref|XP_004172817.1| PREDICTED: uncharacterized LOC101210475 [Cucumis sativus]
Length=270

 Score =   141 bits (355),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 108/168 (64%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            + LSNN+   LNF+ F+ SIPI A GIWL+ +  ++C  +L  PV+ IG+ ++LVSLAGF
Sbjct  2    VKLSNNLVGILNFITFLLSIPIIAGGIWLSRQGTSDCEKFLDTPVIVIGVFLLLVSLAGF  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL  M +LI+LL    I AF VT       +  RGY EYRLG YS+W
Sbjct  62   IGACCRVRWLLWIYLFVMFLLILLLFVFTIFAFAVTNKGAGKVLSNRGYKEYRLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+N + ++  W +IR+CL DG +C ++N +F   T EQF+  HLS +Q
Sbjct  122  LQNRVRNNKDWNRIRSCLVDGKVCNEVNQKFVGETVEQFYLEHLSSIQ  169



>ref|XP_010927974.1| PREDICTED: tetraspanin-8-like [Elaeis guineensis]
Length=272

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 101/166 (61%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            + +SNN+   LN +  + SIPI  AGIWL  +   +C  +L  PV+F+G+ ++LVSLAG 
Sbjct  2    VRVSNNLVGLLNIVTLLLSIPILGAGIWLGHRAHTDCEKFLERPVIFLGVFLLLVSLAGL  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA      LL LYL+ M +LI++L    + AFVVT P     V GRGY EYRLG YS W
Sbjct  62   VGACCGVSWLLWLYLLVMFLLIVVLFCFTVFAFVVTNPGAGEVVSGRGYKEYRLGDYSHW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  +    +W KIR+CL +G +C ++     T ++F   HLSP+Q
Sbjct  122  LQKRVDDDGNWRKIRSCLQEGKVCQRMEERNQTLDEFINNHLSPIQ  167



>ref|XP_006437533.1| hypothetical protein CICLE_v10033400mg [Citrus clementina]
 gb|ESR50773.1| hypothetical protein CICLE_v10033400mg [Citrus clementina]
Length=166

 Score =   137 bits (346),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIP+  AGIWLA++ DN C+  L+WPV+ +GI I++V+LAGF
Sbjct  1    MALSNNVIGAINFVAVLLSIPVIGAGIWLATEADNSCVKLLQWPVIILGILILVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL LYLV M ILIILL  L++  ++VT     +  P R Y EYRL  +S W
Sbjct  61   IGGFWRIPWLLILYLVAMLILIILLACLVVFIYMVTIKGSGHLAPSRAYLEYRLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNN  586
            LR  + S   W +I++CL+   +CP+LN+
Sbjct  121  LRRRVRSPYKWDRIKSCLSSTQMCPELNH  149



>ref|XP_002992066.1| hypothetical protein SELMODRAFT_162119 [Selaginella moellendorffii]
 gb|EFJ06915.1| hypothetical protein SELMODRAFT_162119 [Selaginella moellendorffii]
Length=275

 Score =   140 bits (354),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M  SN +T  +NF   + SIPI  AGIWLASK D EC+ +L+WPV+ IG+ I++VS+AGF
Sbjct  1    MGASNYVTGIINFCTLVLSIPIIGAGIWLASKGDTECVRFLQWPVIAIGVFILVVSIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G   +   LL  YL  M +LI+LLL    LAFVVT     +++  RGY +YRLG YS+W
Sbjct  61   IGGCCRVAWLLWFYLFAMFLLILLLLIFTALAFVVTNRGAGHALSNRGYKDYRLGDYSTW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+ ++    +W +I +CL D  +C  L+ ++ T ++F+AA+LSP+Q
Sbjct  121  LQRYVEKPRNWRRIGSCLRDSRVCNDLDGDYNTRDRFYAANLSPIQ  166



>ref|XP_002964102.1| hypothetical protein SELMODRAFT_266767 [Selaginella moellendorffii]
 gb|EFJ34435.1| hypothetical protein SELMODRAFT_266767 [Selaginella moellendorffii]
Length=275

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M  SN +T  +NF   + SIPI  AGIWLASK D EC+ +L+WPV+ IG+ I++VS+AGF
Sbjct  1    MGASNYVTGIINFCTLVLSIPIIGAGIWLASKGDTECVRFLQWPVIAIGVFILVVSIAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G   +   LL  YL  M +LI+LLL    LAFVVT     +++  RGY +YRLG YS+W
Sbjct  61   IGGCCRVAWLLWFYLFAMFLLILLLLIFTALAFVVTNRGAGHALSNRGYKDYRLGDYSTW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+ ++    +W +I +CL D  +C  L+ ++ T ++F+AA+LSP+Q
Sbjct  121  LQRYVEKPRNWRRIGSCLRDSRVCNDLDGDYNTRDRFYAANLSPIQ  166



>ref|XP_008443811.1| PREDICTED: tetraspanin-8-like [Cucumis melo]
Length=270

 Score =   140 bits (353),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 106/168 (63%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            + LSNN+   LNF+ F+ SIPI A GIWL+ +  ++C  +L  PV+ IG+ ++LVSLAGF
Sbjct  2    VKLSNNLVGILNFITFLLSIPIIAGGIWLSRQGTSDCEKFLDTPVIVIGVFLLLVSLAGF  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL  M +LI+LL    I AF VT       +  RGY EYRLG YS+W
Sbjct  62   IGACCRVRWLLWIYLFVMFLLILLLFVFTIFAFAVTNKGAGKVLSNRGYKEYRLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+N + ++  W +IR+CL DG +C + N  F   T EQF+  HLS +Q
Sbjct  122  LQNRVRNNKDWNRIRSCLVDGKVCAEFNQTFASETVEQFYQEHLSSIQ  169



>ref|XP_007132173.1| hypothetical protein PHAVU_011G072100g [Phaseolus vulgaris]
 gb|ESW04167.1| hypothetical protein PHAVU_011G072100g [Phaseolus vulgaris]
Length=285

 Score =   140 bits (354),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 107/171 (63%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNFL F+ S+PI   GIWL+S+ +N +C+ +L+WP++ IG++IM+VSLAG
Sbjct  1    MRTSNHLIGVLNFLTFLLSVPILGGGIWLSSRANNTDCLKFLQWPLIIIGVSIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   L+ LYLV M  +I +L+  +I A+VVT       V  R Y EY L  YS 
Sbjct  61   FAGACYRNTFLMRLYLVVMFAVIAVLIGFIIFAYVVTDKGSGRRVMNRAYLEYSLEDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKL----NNEFFTAEQFFAAHLSPLQ  637
            WL   + S   WGKI +C+ D  +C K+    N    TAE F+  HL+P+Q
Sbjct  121  WLEERVASDSYWGKIGSCIRDSKVCAKMGRTINEVPETAEMFYLRHLTPIQ  171



>ref|XP_006453500.1| hypothetical protein CICLE_v10009180mg [Citrus clementina]
 ref|XP_006474089.1| PREDICTED: tetraspanin-8-like [Citrus sinensis]
 gb|ESR66740.1| hypothetical protein CICLE_v10009180mg [Citrus clementina]
 gb|KDO62353.1| hypothetical protein CISIN_1g024170mg [Citrus sinensis]
Length=271

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 107/166 (64%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LN L F+ SIPI  AGIWL++K   EC  +L  PV+ +G+ +M+VSLAG  G
Sbjct  4    LSNNLIGILNILTFLLSIPILWAGIWLSNKGVTECEKFLDKPVIILGVFLMIVSLAGLIG  63

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL +YLV M +LI+LL    I+AFVVT       + GRGY EYRLG YS WL+
Sbjct  64   ACCRVSWLLWVYLVVMFLLIVLLFCFTIMAFVVTNKGAGEVLSGRGYKEYRLGDYSDWLQ  123

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
              + ++ +W KI++CL D  +C   ++++   T EQF++ HLS +Q
Sbjct  124  KRVNNTKNWNKIKSCLIDSKVCSSFHDKYLNDTVEQFYSEHLSSVQ  169



>gb|AFD63133.1| senescence-associated protein [Vitis quinquangularis]
Length=272

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 107/166 (64%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LNF+ F+ S+PI  AGIWL+ +   +C  +L  PV+ +G+ +M+VSLAG  G
Sbjct  4    LSNNLVGILNFITFLLSVPILGAGIWLSHRASTDCEKFLEKPVIALGVFLMVVSLAGLIG  63

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL +YL+ M +LI+LL    I AFVVT       + G+GY EYRLG YS+WL+
Sbjct  64   ACCRVSWLLWVYLLVMFLLIVLLFCFTIFAFVVTNKGAGEVLSGKGYKEYRLGDYSNWLQ  123

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
              + ++ +W +I++CL DG +C  L+ +    T EQF+A  LSP+Q
Sbjct  124  KRVNNTKNWNRIKSCLQDGKVCQSLSQDKVGETVEQFYAEQLSPIQ  169



>ref|XP_004512520.1| PREDICTED: protein TORNADO 2-like [Cicer arietinum]
Length=269

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 109/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNNI   +N +A + SIPI  AGIWL ++P + C+ +L+WPV+ +G+ I++VSLAGF
Sbjct  1    MAMSNNIIGAINLVAIVLSIPIIGAGIWLTNEPADTCVKFLQWPVIILGVLILIVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G++W+   LL  YLV M +LIILL+ L++  ++VT        P R Y EYRL  +S +
Sbjct  61   IGSFWRVSCLLIFYLVSMLVLIILLVCLVVFVYMVTVRGHGNIEPNRAYLEYRLDDFSGF  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W  IR+CL+  ++C +LN  +  A  FF A L+P+Q
Sbjct  121  LRRRVRSSFKWDTIRSCLSSTNMCAELNQSYRMAMDFFNARLTPMQ  166



>gb|AGT16475.1| senescence-associated protein [Saccharum hybrid cultivar R570]
Length=272

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 1/165 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPD-NECIHWLRWPVVFIGIAIMLVSLAGFA  322
            LSNN+   LNF+ F+ SIPI  AGIWL  + D  EC  +L  PV+ +G+ +++VSLAG  
Sbjct  5    LSNNLIGILNFVTFLLSIPILGAGIWLGHRADGTECERYLSAPVIALGVFLLVVSLAGLV  64

Query  323  GAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWL  502
            GA  +   LL +YL+ M +LI++L    + AFVVT      +V GRGY EYRLG YS+WL
Sbjct  65   GACCRVTWLLWVYLLAMFVLIVVLFCFTVFAFVVTNKGAGEAVSGRGYKEYRLGDYSNWL  124

Query  503  RNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            +  + ++ +W +IR+CL D  +C KL  +  T  QF A+ LSP++
Sbjct  125  QKRVENTKNWDRIRSCLQDSKVCKKLQEKNETFTQFMASDLSPIE  169



>gb|KJB26992.1| hypothetical protein B456_004G273300 [Gossypium raimondii]
Length=265

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 106/166 (64%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LNF+ F+ SIPI  AGIWL+ K   EC  ++  P++ +G+ +M+VSLAGF G
Sbjct  5    LSNNLLGILNFVTFLLSIPILVAGIWLSRKAITECERFIDKPIIIVGVFLMVVSLAGFVG  64

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A    + LL LYLV M ILI+L ++  I AFVVT       + G+GY EYRLG YS+WL+
Sbjct  65   ACCHVKWLLWLYLVVMFILIVLGIAGTIFAFVVTNKGAGRVLSGKGYKEYRLGDYSNWLQ  124

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
              ++  ++W KI++CL D  +C   +N+    +  +F+  HLS +Q
Sbjct  125  KRVSDENNWFKIKSCLVDSKVCSDFHNQHMNESVTEFYKVHLSAIQ  170



>gb|KHG17865.1| Tetraspanin-31 [Gossypium arboreum]
Length=271

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 105/166 (63%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LN + F+ SIPI  AGIWL  +   EC  +L  PV+ IG+ +MLVSLAG  G
Sbjct  5    LSNNLVGILNLITFLLSIPILGAGIWLRREGVTECEQFLDTPVIIIGVFLMLVSLAGLIG  64

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL LYLV M +LI+L ++  I AFVVT       + G+GY EYRLG YS+WL+
Sbjct  65   ACCRVTWLLWLYLVVMFLLIVLGIAFTIFAFVVTNKGAGQVLSGKGYKEYRLGDYSNWLQ  124

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFFTAE--QFFAAHLSPLQ  637
              +  + +W KI++CLAD  +C   ++++  A   +F+ AHLS +Q
Sbjct  125  KRVNDNKNWNKIKSCLADSKVCTDFHDKYLNASLPEFYQAHLSAVQ  170



>ref|XP_002271684.1| PREDICTED: tetraspanin-8 [Vitis vinifera]
Length=272

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 107/166 (64%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LNF+ F+ S+PI  AGIWL+ +   +C  +L  PV+ +G+ +M+VSLAG  G
Sbjct  4    LSNNLVGILNFITFLLSVPILGAGIWLSHRASTDCEKFLEKPVIALGVFLMVVSLAGLIG  63

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL +YL+ M +LI+LL    I AFVVT       + G+GY EYRLG YS+WL+
Sbjct  64   ACCRVSWLLWVYLLVMFLLIVLLFCFTIFAFVVTNKGAGEVLSGKGYKEYRLGDYSNWLQ  123

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
              + ++ +W +I++CL DG +C  L+ +    T +QF+A  LSP+Q
Sbjct  124  KRVNNTKNWNRIKSCLQDGKVCQSLSQDKVGETVQQFYAEQLSPIQ  169



>ref|XP_010273156.1| PREDICTED: protein TORNADO 2-like [Nelumbo nucifera]
Length=269

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 104/166 (63%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNN+   +N +A + SIPI  AGIWLA++ DN C+  L+WPV+ + I I++V+ AGF
Sbjct  1    MAMSNNVIGSINLVAMLLSIPIIGAGIWLATETDNSCVKILQWPVIILAILILVVAAAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M +LIILL +L+I  + VT     +  P R Y EY L  YS W
Sbjct  61   IGGFWRIPWLLFFYLIFMLVLIILLAALVIFIYSVTARGSGHLAPNRAYLEYHLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +I+ CL+   IC  LN  F  A+ FF A +SP+Q
Sbjct  121  LRRRVQSSYKWNRIKNCLSSTSICAGLNQSFHLAQDFFNAPISPIQ  166



>ref|XP_004151158.1| PREDICTED: uncharacterized protein LOC101210475 [Cucumis sativus]
 gb|KGN65268.1| hypothetical protein Csa_1G287020 [Cucumis sativus]
Length=270

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 108/168 (64%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            + LSNN+   LNF+ F+ SIPI A GIWL+ +  ++C  +L  PV+ IG+ ++LVSLAGF
Sbjct  2    VKLSNNLVGILNFITFLLSIPIIAGGIWLSRQGTSDCEKFLDTPVIVIGVFLLLVSLAGF  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL  M +LI+LL    I AF VT       +  RGY EYRLG YS+W
Sbjct  62   IGACCRVRWLLWIYLFVMFLLILLLFVFTIFAFAVTNKGAGKVLSNRGYKEYRLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+N + ++  W +IR+CL DG +C +++ +F   T EQF+  HLS +Q
Sbjct  122  LQNRVRNNKDWNRIRSCLVDGKVCNEVSQKFVGETVEQFYLEHLSSIQ  169



>ref|XP_004309857.1| PREDICTED: tetraspanin-8-like [Fragaria vesca subsp. vesca]
Length=267

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 106/168 (63%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M LSNN+  FLNFL F+ SIP+  AG+WL+ +   EC  +L  PV+ +G+ +MLVSLAGF
Sbjct  1    MRLSNNLVGFLNFLTFLLSIPMVVAGVWLSKQGATECEKFLDKPVIILGVFLMLVSLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA ++   LL +YL+ M +LI++L    I AF +T       + G+GY EY+LG YS W
Sbjct  61   IGACFRVSWLLWVYLLVMFLLIVVLFGYTIFAFAITNKGAGNVLSGKGYKEYKLGDYSHW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + S+ +W KI++CL D  +C    +++   T  +F+  +LS LQ
Sbjct  121  LQKRVNSTKNWNKIKSCLIDSKVCSNFQDKYLNDTLTEFYEENLSALQ  168



>emb|CAN83511.1| hypothetical protein VITISV_035079 [Vitis vinifera]
Length=272

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 107/166 (64%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LNF+ F+ S+PI  AGIWL+ +   +C  +L  PV+ +G+ +M+VSLAG  G
Sbjct  4    LSNNLVGILNFITFLLSVPILGAGIWLSHRASTDCEKFLEKPVIALGVFLMVVSLAGLIG  63

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL +YL+ M +LI+LL    I AFVVT       + G+GY EYRLG YS+WL+
Sbjct  64   ACCRVSWLLWVYLLVMFLLIVLLFCFTIFAFVVTNKGAGEVLSGKGYKEYRLGDYSNWLQ  123

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
              + ++ +W +I++CL DG +C  L+ +    T +QF+A  LSP+Q
Sbjct  124  KRVNNTKNWNRIKSCLQDGKVCQSLSQDKVGETVQQFYAEQLSPIQ  169



>ref|XP_002528212.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34169.1| conserved hypothetical protein [Ricinus communis]
Length=271

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 104/166 (63%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+  FLNF+ F+ SIPI  AGIWL +   +EC  +L  PV+ +G+ +MLVSLAG  G
Sbjct  4    LSNNLVGFLNFITFLLSIPILGAGIWLRNHGTSECERFLDTPVIVLGVFLMLVSLAGLVG  63

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL LYL+ M ILI+LL    I AFVVT       + GRGY EYRLG YS+WL+
Sbjct  64   ACCRVSWLLWLYLLVMFILIVLLFCFTIFAFVVTNKGAGQVLSGRGYKEYRLGDYSNWLQ  123

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
              + ++ +W KI++CLAD  +C   N ++   T    +  HLS +Q
Sbjct  124  KRVNNTKNWNKIKSCLADSKVCSDFNQKYLNDTLTILYTRHLSAVQ  169



>ref|XP_004505953.1| PREDICTED: tetraspanin-3-like [Cicer arietinum]
Length=285

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 108/171 (63%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNFL F+ SIPI   GIWL+S+ +N +C+ +L+WP++ IG++IM+VSLAG
Sbjct  1    MRTSNHLIGVLNFLTFLLSIPILGGGIWLSSRANNTDCLKFLQWPLIIIGVSIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   LL LYLV M ++I +L+  +I A+VVT       V  RGY +Y L  YS 
Sbjct  61   FAGACYRNTFLLRLYLVVMFLIIAVLIGFIIFAYVVTDKGSGRRVMNRGYLDYYLDDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL   + S D WGKI +C+ D  +C K+   +     + + F A  L+P+Q
Sbjct  121  WLEERVKSDDYWGKISSCIRDSKVCSKMGRNYNGFPESVDMFVARKLTPVQ  171



>gb|AFK47947.1| unknown [Lotus japonicus]
Length=185

 Score =   135 bits (341),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M++SNN+   +NF+A + SIPI  AGIWL +   + C+ +L+WPV+ +G+ I++V+LAG 
Sbjct  1    MAMSNNVIGAVNFVAVLLSIPIIGAGIWLMNGAADSCVSFLQWPVIILGVLILVVALAGC  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+++   LL +YL+ M IL+IL++ L +  ++VT        P R Y EYRL  +S +
Sbjct  61   IGAFFRISWLLIIYLIAMLILVILVICLAVFVYMVTIRGHGLMEPNRAYLEYRLDDFSGF  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W  IR+CL+  ++C +LN  F  A+ FF A L+P+Q
Sbjct  121  LRRRVRSSFKWDHIRSCLSQTNMCAELNQSFRMAQDFFNARLTPMQ  166



>ref|XP_008807036.1| PREDICTED: tetraspanin-7-like [Phoenix dactylifera]
Length=272

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 100/166 (60%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            + +SNN+   LN +  + SIPI  AGIWL  +   +C  +L  PV+ +G+ ++LVSLAG 
Sbjct  2    VRVSNNLVGLLNIVTLLLSIPILGAGIWLGHRAHTDCEKFLERPVIALGVFLLLVSLAGL  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA      LL LYL+ M +LI+LL    + AFVVT P     V GRGY EYRLG YS W
Sbjct  62   VGACCSVSWLLWLYLLVMFLLIVLLFCFTVFAFVVTNPGAGEVVSGRGYKEYRLGDYSHW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  +    +W KIR+CL +G +C +L     T ++F   HLSP+Q
Sbjct  122  LQKRVEDDGNWRKIRSCLREGKVCQRLGERNQTLDEFINNHLSPIQ  167



>ref|NP_001063223.1| Os09g0425900 [Oryza sativa Japonica Group]
 gb|AAO72638.1| senescence-associated protein-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD33608.1| putative senescence-associated protein 5 [Oryza sativa Japonica 
Group]
 dbj|BAF25137.1| Os09g0425900 [Oryza sativa Japonica Group]
 gb|EAZ09160.1| hypothetical protein OsI_31430 [Oryza sativa Indica Group]
 gb|EAZ44794.1| hypothetical protein OsJ_29427 [Oryza sativa Japonica Group]
 dbj|BAG97608.1| unnamed protein product [Oryza sativa Japonica Group]
Length=276

 Score =   138 bits (347),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 104/165 (63%), Gaps = 1/165 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPD-NECIHWLRWPVVFIGIAIMLVSLAGFA  322
            LSN++   LN + F+ S+P+   GIWLA++ D  EC  +   PV+  G+ ++LVSLAG  
Sbjct  5    LSNSLLGILNAVTFLLSVPVLGGGIWLATRADGTECERYFSAPVIAFGVFLLLVSLAGLV  64

Query  323  GAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWL  502
            GA  +   LL  YLV M +LI++L    + AFVVT      +V GRGY EYRLG YS+WL
Sbjct  65   GACCRVNCLLWFYLVAMFVLIVVLFCFTVFAFVVTNKGAGEAVSGRGYKEYRLGDYSNWL  124

Query  503  RNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            +  + +S +W +IR+CL D  +C KL ++ +   QFF A LSPL+
Sbjct  125  QKRMENSKNWNRIRSCLQDSKVCKKLQDKNWDRTQFFKADLSPLE  169



>ref|XP_010526324.1| PREDICTED: tetraspanin-8-like [Tarenaya hassleriana]
Length=273

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            +  SNN+   LNF+ F+ SIPI A GIWL+ K   EC  +L  PV+ +G+ +M+VS+AG 
Sbjct  2    VRCSNNLVGILNFIVFLLSIPILAGGIWLSQKGSTECERFLDKPVIALGVFLMIVSIAGL  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL  M ILI+L+    + AFVVT      SV GRGY EYRLG YS+W
Sbjct  62   VGACCRVTWLLWVYLFVMFILILLVFCFTVFAFVVTNKGAGQSVSGRGYKEYRLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + S+++W +IR+CL D  +C +  ++F   T    +  HLS LQ
Sbjct  122  LQKRVNSANNWNRIRSCLVDSKVCSEFESKFAHDTVNDLYREHLSALQ  169



>gb|EMS60689.1| hypothetical protein TRIUR3_10720 [Triticum urartu]
Length=215

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 105/167 (63%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPD-NECIHWLRWPVVFIGIAIMLVSLAG  316
            + LSN +   LN + F+ S+PI A GIWL ++ D  EC  +L  PV+ +G+ +MLVS+AG
Sbjct  2    VRLSNTMIGILNAVTFLLSVPILAGGIWLRARADGTECERYLAAPVIVLGVFLMLVSVAG  61

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
              GA  +   LL  YLV M +LI++LL + + AFVVT      +V GRG+ EYRLG YS+
Sbjct  62   LVGACCRVTCLLWFYLVAMFLLIVVLLGITVFAFVVTHKDTGEAVSGRGFKEYRLGDYST  121

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            WL+  + +  +W +IR CL D  +C  L +   T +QF ++ LSP+Q
Sbjct  122  WLQRRVENDRNWNRIRGCLQDAKVCKSLEDRRETLDQFMSSDLSPIQ  168



>ref|XP_010240868.1| PREDICTED: protein TORNADO 2-like [Nelumbo nucifera]
Length=269

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+  NN    +NF+A + SIPI  AGIWLA++ DN C+  L+WPV+ +GI +++V+LAGF
Sbjct  1    MATINNAVGAINFVAMLLSIPIIGAGIWLATETDNSCVKILQWPVIILGILMLVVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G++W+   LL  YL+ M ILIILL SL+I  ++VT     +  PGR Y EY L  YS W
Sbjct  61   IGSFWRIPWLLIFYLIVMLILIILLASLVIFIYMVTVKGSGHLAPGRVYLEYHLNDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + +S  W +IR CL+   +C +LN  +  A+ FF A +SP+Q
Sbjct  121  LRQRVQASFKWNRIRNCLSSTSMCSELNQRYHFAQDFFNARISPIQ  166



>gb|EMT05126.1| hypothetical protein F775_30220 [Aegilops tauschii]
Length=273

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 105/167 (63%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPD-NECIHWLRWPVVFIGIAIMLVSLAG  316
            + LSN +   LN + F+ S+PI A GIWL ++ D  EC  +L  PV+ +G+ +MLVS+AG
Sbjct  2    VRLSNTMIGILNAITFLLSVPILAGGIWLRARADGTECERYLAAPVIVLGVFLMLVSIAG  61

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
              GA  +   LL  YLV M +LI++LL + + AFVVT      +V GRG+ EYRLG YS+
Sbjct  62   LVGACCRVTCLLWFYLVAMFLLIVVLLGITVFAFVVTHKGTGEAVSGRGFKEYRLGDYST  121

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            WL+  + +  +W +IR CL D  +C  L +   T +QF ++ LSP+Q
Sbjct  122  WLQRRVENDRNWNRIRGCLQDAKVCKSLEDRRDTVQQFMSSDLSPIQ  168



>ref|XP_003606498.1| hypothetical protein MTR_4g061010 [Medicago truncatula]
 gb|AES88695.1| tetraspanin family protein [Medicago truncatula]
Length=285

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 106/171 (62%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNFL F+ SIPI   GIWL+S+ +N +C+ +L+WP++ IG++IM+VSLAG
Sbjct  1    MRTSNHLIGVLNFLTFLLSIPILGGGIWLSSRANNTDCLKFLQWPLIIIGVSIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   LL  YLV M  +I +L+  +I A+VVT       V  RGY +Y L  YS 
Sbjct  61   FAGACYRNTFLLRFYLVVMFFVIGVLIGFIIFAYVVTDKGSGRRVMNRGYLDYYLEDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL   + S + WGKI +C+ D   C KL   F     TA+ FF   L+P+Q
Sbjct  121  WLEERVASDEYWGKISSCIRDSKACRKLARNFNDVPETADMFFERKLNPIQ  171



>gb|ACJ84677.1| unknown [Medicago truncatula]
Length=258

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 105/171 (61%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNFL F+ SIPI   GIWL+S+  N +C+ +L+WP++ IG++IM+VSLAG
Sbjct  1    MRTSNHLIGVLNFLTFLLSIPILGGGIWLSSRASNTDCLKFLQWPLIIIGVSIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   LL  YLV M  +I +L+  +I A+VVT       V  RGY +Y L  YS 
Sbjct  61   FAGACYRNTFLLRFYLVVMFFVIGVLIGFIIFAYVVTDKGSGRRVMNRGYLDYYLEDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL   + S + WGKI +C+ D   C KL   F     TA+ FF   L+P+Q
Sbjct  121  WLEERVASDEYWGKISSCIRDSKACRKLARNFNDVPETADMFFERKLNPIQ  171



>ref|XP_010525757.1| PREDICTED: tetraspanin-8 [Tarenaya hassleriana]
 ref|XP_010525758.1| PREDICTED: tetraspanin-8 [Tarenaya hassleriana]
Length=272

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 101/165 (61%), Gaps = 2/165 (1%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGA  328
            SNN+   LNF+ F+ SIPI A GIWL+ K   EC  +L  PV+ +G+ +M+VS+AG  GA
Sbjct  5    SNNLVGILNFVIFLLSIPILAGGIWLSQKGSTECERFLDKPVIALGVFLMIVSIAGLVGA  64

Query  329  YWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRN  508
              +   LL +YL  M +LI+L+    + AFVVT      ++  RGY EYRLG YS+WL+ 
Sbjct  65   CCRVTWLLWVYLFVMFVLILLVFCFTVFAFVVTNKGAGETLANRGYKEYRLGDYSNWLQK  124

Query  509  HITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
             + S  +W KIR+CL D  +C K  ++F     + F+  HLS LQ
Sbjct  125  RVNSGKNWNKIRSCLVDSKVCSKFESKFVGEAVDDFYKEHLSALQ  169



>ref|XP_008223564.1| PREDICTED: tetraspanin-8-like [Prunus mume]
Length=267

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 106/168 (63%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNN+   LNF+ F+ SIPI  AG+WL+ +   EC  +L  PV+ +G+ +MLVSLAG 
Sbjct  1    MKISNNLVGLLNFITFLLSIPIVVAGVWLSKQGSTECEKFLDKPVIILGVFLMLVSLAGL  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL+ M +LI++L +  I AFVVT       + G+GY EYRLG YS+W
Sbjct  61   IGACCRVSWLLWVYLLVMFLLIVVLFAFTIFAFVVTNKGAGKVLSGKGYKEYRLGDYSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + S+ +W KI++CL D  +C   ++++   T  + +  +LS LQ
Sbjct  121  LQKRVNSTKNWNKIKSCLIDSKVCSTFHDKYVNDTITELYKENLSALQ  168



>gb|AFK38592.1| unknown [Medicago truncatula]
Length=285

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 105/171 (61%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNFL F+ SIPI   GIWL+S+  N +C+ +L+WP++ IG++IM+VSLAG
Sbjct  1    MRTSNHLIGVLNFLTFLLSIPILGGGIWLSSRASNTDCLKFLQWPLIIIGVSIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   LL  YLV M  +I +L+  +I A+VVT       V  RGY +Y L  YS 
Sbjct  61   FAGACYRNTFLLRFYLVVMFFVIGVLIGFIIFAYVVTDKGSGRRVMNRGYLDYYLEDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL   + S + WGKI +C+ D   C KL   F     TA+ FF   L+P+Q
Sbjct  121  WLEERVASDEYWGKISSCIRDSKACRKLARNFNDVPETADMFFERKLNPIQ  171



>tpg|DAA61555.1| TPA: hypothetical protein ZEAMMB73_727484 [Zea mays]
Length=211

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 103/165 (62%), Gaps = 1/165 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPD-NECIHWLRWPVVFIGIAIMLVSLAGFA  322
            LSNN+   LNF+ F+ S+PI  AGIWL  + D  EC  +L  PV+ +G  ++ VSLAG  
Sbjct  5    LSNNLIGVLNFVTFLLSVPILGAGIWLGHRADGTECERYLSAPVIALGAFLLAVSLAGLV  64

Query  323  GAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWL  502
            GA  +   LL  YL+ M +LI++L    + AFVVT      +V GRGY EYRLG YS+WL
Sbjct  65   GACCRVTWLLWAYLLAMFVLILVLFCFTVFAFVVTNRGAGEAVSGRGYKEYRLGDYSNWL  124

Query  503  RNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            +  + ++ +W +IR+CL D  +C  L ++  T  QF ++ LSP++
Sbjct  125  QKRVENTRNWDRIRSCLQDSKVCKSLQDKNETVAQFMSSSLSPIE  169



>ref|XP_006368392.1| senescence-associated family protein [Populus trichocarpa]
 gb|ERP64961.1| senescence-associated family protein [Populus trichocarpa]
Length=269

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LS+N+   +NF+A + SIPI  AGIWLA +PDN C+  L+WPV+ +GI I++V+LAGF
Sbjct  1    MALSSNVIGAINFVAMLLSIPIIGAGIWLAMEPDNSCVKILQWPVIILGILILIVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILIILL  L++  ++VT     +  P R Y EYRL  +S W
Sbjct  61   VGGFWRIPWLLISYLIAMLILIILLACLVVFIYMVTVRGSGHLEPSRAYLEYRLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR CL+  ++C +LN  +  A+ FF AH+SPLQ
Sbjct  121  LRRRVQSSYKWDRIRGCLSSTNMCAELNQSYRMAQDFFNAHISPLQ  166



>ref|XP_008375950.1| PREDICTED: tetraspanin-8-like [Malus domestica]
Length=266

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 105/168 (63%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNN+   LNF+ F+ SIPI  AG+WL  +   EC  +L  PV+ +G+ +MLVSLAG 
Sbjct  1    MRISNNLVGLLNFITFLLSIPIVVAGVWLTKQGSTECEKFLDKPVIILGVFLMLVSLAGL  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL+ M +LI++L ++ I AF VT       + G+GY EYRLG YS W
Sbjct  61   IGACCRVSWLLWVYLLVMFLLIVVLFAVTIFAFAVTNKGAGKVLSGKGYKEYRLGDYSQW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + S+ +W KI++CL D  +C    +++   T + F++ +LS LQ
Sbjct  121  LQKRVNSTKNWNKIKSCLIDSKVCSTFKDKYANDTLQTFYSENLSALQ  168



>gb|KHN34762.1| hypothetical protein glysoja_032938 [Glycine soja]
Length=270

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            +  SNN+   LNFL F+ SIPI  AG+WL+ +   EC      PV+ +G+ +MLVSLAG 
Sbjct  2    VRFSNNVIGLLNFLTFLLSIPILVAGVWLSKQGATECERCREKPVIALGVFLMLVSLAGL  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL LYL+ M +LI+LL +  I AFVVT       V  RGY EYRLG YS+W
Sbjct  62   VGACCRVSWLLWLYLLVMFVLIVLLFAFTIFAFVVTNKGAGEVVSNRGYKEYRLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + ++ +W +IR+CL  G +C +  ++F   T  +F++ +LS LQ
Sbjct  122  LQKRVNNTKTWNRIRSCLQSGKVCTEFQSKFLNDTVTEFYSENLSALQ  169



>ref|XP_011018553.1| PREDICTED: protein TORNADO 2-like [Populus euphratica]
Length=269

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LS+N+   +NF+A + SIPI  AGIWLA +PDN C+  L+WPV+ +GI I++V+LAGF
Sbjct  1    MALSSNVIGAINFVAMLLSIPIIGAGIWLAMEPDNSCVKILQWPVIILGILILIVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M ILIILL  L++  ++VT     +  P R Y EY L  +S W
Sbjct  61   VGAFWRIPWLLISYLIAMLILIILLACLVVFIYMVTARGSGHLEPSRAYLEYHLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR CL+  ++C +LN  +  A+ FF AH+SPLQ
Sbjct  121  LRRRVQSSYKWDRIRGCLSSTNMCAELNQSYRMAQDFFNAHISPLQ  166



>gb|KHN05715.1| hypothetical protein glysoja_024681 [Glycine soja]
Length=285

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 107/171 (63%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNFL F+ SIPI   GIWL+S+ +N +C+ +L+WP++ IG++IM+VSLAG
Sbjct  1    MRTSNHLIGLLNFLTFLLSIPILGGGIWLSSRANNTDCLKFLQWPLIIIGVSIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   L+ LYLV M ++I +L+  +I A+VVT       V  R Y EY L  YS 
Sbjct  61   FAGACYRNTFLMRLYLVVMFLVIAVLIGFIIFAYVVTDKGSGRRVMNRAYLEYYLEDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKL----NNEFFTAEQFFAAHLSPLQ  637
            WL   + S   WGKI +C+ D  +C ++    N    T + F+  HL+P+Q
Sbjct  121  WLEERVASESYWGKIASCIRDSKVCGRMGRTVNGMPQTPDMFYLTHLTPIQ  171



>ref|XP_010914059.1| PREDICTED: tetraspanin-8-like [Elaeis guineensis]
Length=270

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 102/164 (62%), Gaps = 0/164 (0%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            +SNN+   LNFL F+ SIPI   GIWLA++   +C  +L+ PV+ +G+ +M+VSLAG  G
Sbjct  4    VSNNLIGILNFLTFLLSIPIVGGGIWLATRGSTDCEKFLQGPVIAVGVFLMVVSLAGLVG  63

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL +YL  M +LI+LL    + AFVVT       V  RGY EYRLG YS+WL+
Sbjct  64   ACCRVTWLLWVYLFVMFLLIVLLFCFTVFAFVVTNKGAGEVVSNRGYKEYRLGDYSNWLQ  123

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
              + +S +W +I +C+ D  +C  L  +  T +QF   +LSP+Q
Sbjct  124  KRVNNSKTWARIHSCIQDSKVCQSLQEKNQTFQQFANDNLSPIQ  167



>ref|XP_006592227.1| PREDICTED: tetraspanin-3 [Glycine max]
Length=322

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 107/171 (63%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNFL F+ SIPI   GIWL+S+ +N +C+ +L+WP++ IG++IM+VSLAG
Sbjct  38   MRTSNHLIGLLNFLTFLLSIPILGGGIWLSSRANNTDCLKFLQWPLIIIGVSIMVVSLAG  97

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   L+ LYLV M ++I +L+  +I A+VVT       V  R Y EY L  YS 
Sbjct  98   FAGACYRNTFLMRLYLVVMFLVIAVLIGFIIFAYVVTDKGSGRRVMNRAYLEYYLEDYSG  157

Query  497  WLRNHITSSDSWGKIRACLADGDICPKL----NNEFFTAEQFFAAHLSPLQ  637
            WL   + S   WGKI +C+ D  +C ++    N    T + F+  HL+P+Q
Sbjct  158  WLEERVASESYWGKIASCIRDSKVCGRMGRTVNGMPQTPDMFYLTHLTPIQ  208



>ref|XP_002877422.1| hypothetical protein ARALYDRAFT_905722 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53681.1| hypothetical protein ARALYDRAFT_905722 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   +NFL F+ SIPI   GIWL+S+ ++ +C+ +L+WP++ IGI+IM+VSLAG
Sbjct  1    MRTSNHLIGLVNFLTFLLSIPILGGGIWLSSRANSTDCLRFLQWPLIVIGISIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++ + L+ LYLV M ++I  L+  +I A+ VT      +V  RGY +Y L  YS 
Sbjct  61   FAGACYRNKFLMWLYLVAMLLIIAALIGFIIFAYAVTDKGSGRTVLNRGYLDYYLQDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL++ ++    WGKI +CL D   C K+   F     TA+ FF   LSP++
Sbjct  121  WLKDRVSDDSYWGKISSCLRDSGACRKIGRNFNGVPETADMFFLRRLSPVE  171



>ref|XP_006845476.1| hypothetical protein AMTR_s00019p00136590 [Amborella trichopoda]
 gb|ERN07151.1| hypothetical protein AMTR_s00019p00136590 [Amborella trichopoda]
Length=177

 Score =   132 bits (333),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 104/166 (63%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LNF+ F+ SIPI   GIWL+ +   +C  +L  P++ +G+ +M+VSLAG  G
Sbjct  4    LSNNLIGILNFITFLLSIPILGGGIWLSHRASTDCEKFLDGPIIALGVFLMVVSLAGLVG  63

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            +  K   LL  YL+ M +LI+LL    I AFVVT       V G+GY EY+LG YS+WL+
Sbjct  64   SCCKVTWLLWFYLLVMFLLIVLLFCFTIFAFVVTNKGVGEVVSGKGYKEYKLGDYSNWLQ  123

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFFTAEQ--FFAAHLSPLQ  637
              ++++ +W KI++CL+D  +C  L  +     +  F+A HLSP+Q
Sbjct  124  KRVSNTKNWNKIKSCLSDAKVCKSLAEDEKNEPEAIFYAKHLSPIQ  169



>ref|XP_010429337.1| PREDICTED: tetraspanin-8-like isoform X1 [Camelina sativa]
 ref|XP_010429338.1| PREDICTED: tetraspanin-8-like isoform X2 [Camelina sativa]
Length=273

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 102/165 (62%), Gaps = 2/165 (1%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGA  328
            SNN+   LNFL F+ SIPI A GIWL+ K   EC  +L  PV+ +G+ +M+V++AG  G+
Sbjct  5    SNNLVGILNFLVFLLSIPILAGGIWLSQKGSTECERFLDKPVIALGVFLMVVAIAGLIGS  64

Query  329  YWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRN  508
              +   LL +YL  M +LI+L+  + + AFVVT      ++ G+GY EYRLG YS WL+N
Sbjct  65   CCRVTWLLWVYLFVMFLLILLVFCITVFAFVVTNKGAGEAIAGKGYKEYRLGDYSDWLQN  124

Query  509  HITSSDSWGKIRACLADGDICPKLNNEFFT--AEQFFAAHLSPLQ  637
             + +  +W KIR+CL +  +C KL  +F       F+  HL+ LQ
Sbjct  125  RVNNGKNWNKIRSCLVESKVCSKLEAKFIDVPVNNFYQEHLTALQ  169



>ref|NP_190146.1| tetraspanin3 [Arabidopsis thaliana]
 sp|Q9M1E7.1|TET3_ARATH RecName: Full=Tetraspanin-3 [Arabidopsis thaliana]
 gb|AAK62405.1|AF386960_1 putative protein [Arabidopsis thaliana]
 emb|CAB75489.1| putative protein [Arabidopsis thaliana]
 gb|AAP13420.1| At3g45600 [Arabidopsis thaliana]
 gb|AEE78049.1| tetraspanin3 [Arabidopsis thaliana]
Length=285

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   +NFL F+ SIPI   GIWL+S+ ++ +C+ +L+WP++ IGI+IM+VSLAG
Sbjct  1    MRTSNHLIGLVNFLTFLLSIPILGGGIWLSSRANSTDCLRFLQWPLIVIGISIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++ + L+ LYLV M ++I  L+  +I A+ VT      +V  RGY +Y L  YS 
Sbjct  61   FAGACYRNKFLMWLYLVVMLLIIAALIGFIIFAYAVTDKGSGRTVLNRGYLDYYLEDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL++ ++    WGKI +CL D   C K+   F     TA+ FF   LSP++
Sbjct  121  WLKDRVSDDSYWGKISSCLRDSGACRKIGRNFNGVPETADMFFLRRLSPVE  171



>gb|KJB21099.1| hypothetical protein B456_003G183100 [Gossypium raimondii]
Length=269

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 106/166 (64%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWL+++P + C+  L WP++ +G+ I++++LAGF
Sbjct  1    MALSNNVIGAINFVAMLLSIPILGAGIWLSNQPADSCLKILLWPIITLGVLILVMALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YLV M +LIILL  L+I  ++VT     + VP R Y EY L  +S W
Sbjct  61   VGAFWRIPWLLMAYLVGMLVLIILLACLVIFMYMVTIRGSGHIVPNRAYLEYHLEDFSIW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  +  S  W +I  CL+   ICP LN  +  A  FF A+L+ ++
Sbjct  121  LQRRVRGSYKWERIETCLSTTQICPDLNQTYTMAMDFFRAYLTLIE  166



>ref|XP_006294776.1| hypothetical protein CARUB_v10023828mg [Capsella rubella]
 gb|EOA27674.1| hypothetical protein CARUB_v10023828mg [Capsella rubella]
Length=276

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 103/165 (62%), Gaps = 2/165 (1%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGA  328
            SNN+   LNF+ F+ SIPI A GIWL+ K   EC  +L  PV+ +G+ +M+V++AG  G+
Sbjct  5    SNNLVGILNFIVFLLSIPILAGGIWLSQKGSTECERFLDKPVIALGVFLMVVAIAGLVGS  64

Query  329  YWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRN  508
              +   LL +YL  M +LI+L+  + + AFVVT      ++ G+GY EY+LG YS WL+ 
Sbjct  65   CCRVTWLLWVYLFVMFLLILLVFCITVFAFVVTNKGAGEAIAGKGYKEYKLGDYSDWLQK  124

Query  509  HITSSDSWGKIRACLADGDICPKLNNEFFTA--EQFFAAHLSPLQ  637
             + +  +W KIR+CL D  +C KL  +F  A    F++ HL+ LQ
Sbjct  125  RVNNGKNWNKIRSCLVDSKVCTKLEAKFINAPVNDFYSEHLTALQ  169



>ref|XP_010417125.1| PREDICTED: tetraspanin-8 [Camelina sativa]
Length=273

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 102/165 (62%), Gaps = 2/165 (1%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGA  328
            SNN+   LNFL F+ SIPI A GIWL+ K   EC  +L  PV+ +G+ +M+V++AG  G+
Sbjct  5    SNNLVGILNFLVFLLSIPILAGGIWLSQKGSTECERFLDKPVIALGVFLMVVAIAGLIGS  64

Query  329  YWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRN  508
              +   LL +YL  M +LI+L+  + + AFVVT      ++ G+GY EYRLG YS WL+N
Sbjct  65   CCRVTWLLWVYLFVMFLLILLVFCITVFAFVVTNKGAGEAIAGKGYKEYRLGDYSDWLQN  124

Query  509  HITSSDSWGKIRACLADGDICPKLNNEFFT--AEQFFAAHLSPLQ  637
             + +  +W KIR+CL +  +C KL  +F       F+  HL+ LQ
Sbjct  125  RVNNGKNWNKIRSCLVESKVCSKLEAKFIDVPVNSFYQEHLTALQ  169



>ref|XP_009396242.1| PREDICTED: tetraspanin-7-like [Musa acuminata subsp. malaccensis]
Length=268

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 102/166 (61%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            +  SN++   LN +  + SIPI   GIWL+ + + +C  +L  P+V +G+ + LVSLAGF
Sbjct  2    VRFSNSLIGVLNVITLVLSIPIIGGGIWLSQRANTDCEKFLERPLVALGVFLFLVSLAGF  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL LYLV M +LI+LL+   + AFVVT       V GRG+ EYRLG YS W
Sbjct  62   VGACCRNSCLLWLYLVVMFLLILLLVCFTVFAFVVTNKGAGEVVSGRGFKEYRLGDYSDW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  +  + +W +IR+CL  G +C  L N+  T +QF   +LSP+Q
Sbjct  122  LQRRVEKASNWRRIRSCLQQGKVCESLQNKNQTWDQFIKDNLSPIQ  167



>ref|XP_010268396.1| PREDICTED: tetraspanin-8-like [Nelumbo nucifera]
Length=270

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            + +SNN+   LNF+ F+ SIPI  AGIWLA++  ++C  +L  PV+ +G+ +M+VSLAG 
Sbjct  2    VRVSNNLIGILNFVTFLLSIPILGAGIWLANRASSDCEKFLEKPVIALGVFLMVVSLAGL  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA ++   LL LYL+ M +LI+LL    I AFVVT       + G+GY +Y+LG YS+W
Sbjct  62   IGACFRVSWLLWLYLLVMFLLIVLLFCFTIFAFVVTNKGAGEVLSGKGYKDYKLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFT-AEQFFAAHLSPLQ  637
            L+  + ++++W KI++CL D  +C  LN+      E+F+A HLS +Q
Sbjct  122  LQKRVNNNNNWRKIKSCLMDSHVCKSLNDTTSEPMEEFYARHLSSIQ  168



>ref|XP_010514887.1| PREDICTED: tetraspanin-3-like [Camelina sativa]
Length=285

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   +NFL F+ SIPI   GIWL+S+ ++ +C+ +L+WP++ IGI+IM+VSLAG
Sbjct  1    MRTSNHLIGLVNFLTFLLSIPILGGGIWLSSRANSTDCLRFLQWPLIVIGISIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++ + L+ LYLV M ++I  L+  +I A+ VT      +V  RGY +Y +  YS 
Sbjct  61   FAGACYRNKFLMWLYLVVMLLIIAALIGFIIFAYAVTDKGSGRTVLNRGYLDYYIQDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL++ ++    WGKI +CL D   C K+   F     TA+ FF   LSP++
Sbjct  121  WLKDRVSDDSYWGKISSCLKDSGACRKIGKNFNGVPETADMFFLRRLSPVE  171



>gb|ABK24499.1| unknown [Picea sitchensis]
Length=282

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 110/165 (67%), Gaps = 2/165 (1%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGA  328
            +N+I   +NFL F+ SIPI  AGIWLA++   +C+ +L+WP++ IG AIML+SLAGF GA
Sbjct  5    TNSIVGLINFLTFLLSIPIVGAGIWLATRHSGDCLRFLQWPIIIIGAAIMLLSLAGFMGA  64

Query  329  YWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRN  508
             ++   L+ LYL  M +L++  L  +I AF V      +SVPG G++EY+L  +S+WL++
Sbjct  65   CFRVTSLMWLYLFFMFLLLLAYLVFIIFAFAVAGKGHGHSVPGTGFEEYKLHDFSTWLQD  124

Query  509  HITSSDSWGKIRACLADGDICPKLNNE--FFTAEQFFAAHLSPLQ  637
             + SS SW  IR+C+ D  +C KL  +  + ++  F+  HL+P+Q
Sbjct  125  RVRSSGSWNNIRSCVRDAGVCRKLGQKSMYESSAGFYQEHLTPIQ  169



>ref|XP_010043700.1| PREDICTED: tetraspanin-3 [Eucalyptus grandis]
 gb|KCW85684.1| hypothetical protein EUGRSUZ_B02462 [Eucalyptus grandis]
Length=283

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 103/169 (61%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNFL F+ SIPI   GIWL+S+  + +C+ +L+WP++ IG+AIM++SLAG
Sbjct  1    MRASNHLIGLLNFLTFLLSIPILGGGIWLSSRASSTDCMKFLQWPLIIIGVAIMVISLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   L+GLYL CM  +I  L+  +I A+ VT       V GR Y +Y L  YS 
Sbjct  61   FAGACYRNTFLMGLYLFCMFFVIAALIGFIIFAYAVTDKGSGRPVTGRAYQDYYLQSYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKL--NNEFFTAEQFFAAHLSPLQ  637
            WL+  + S   W KI +C+ D   C K+  N    T   F++  L+P+Q
Sbjct  121  WLKERVASESYWTKISSCIRDSKACKKIAVNGVPETESMFYSRKLNPIQ  169



>ref|XP_007013955.1| Tetraspanin8 [Theobroma cacao]
 gb|EOY31574.1| Tetraspanin8 [Theobroma cacao]
Length=271

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 101/166 (61%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LN + F+ SIPI   GIWL+ +   EC  +L  P++ IG+ +M+VSLAG  G
Sbjct  5    LSNNLVGILNLVTFILSIPILGTGIWLSREGVTECERFLDKPLIVIGVFLMVVSLAGLIG  64

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL LYLV M +LI+L +   I AF VT       + G+GY EYRLG YS+WL+
Sbjct  65   ACCRVTWLLWLYLVVMFLLIVLGIVFTIFAFAVTNKGAGEVLSGKGYKEYRLGDYSNWLQ  124

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
              +T   +W KI++CL D  +C    +++   T E F++ HLS +Q
Sbjct  125  KRVTDQKNWNKIKSCLVDSKVCTDFRDKYLNDTVEAFYSEHLSAVQ  170



>ref|XP_003558742.1| PREDICTED: protein TORNADO 2 [Brachypodium distachyon]
Length=270

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 108/167 (65%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L++ + A +N  A + SIP+ AAGIWL+++ DN C++ L+WP++ +GIAI+ V LAGF
Sbjct  1    MALNHVVAAAINLAAALLSIPVIAAGIWLSTQTDNACVNLLQWPLIGLGIAILAVGLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA W+   LL  YLV M IL + L SL++  F+VT  S    VP R + EY L  YS W
Sbjct  61   VGALWRLPRLLLAYLVAMLILALSLASLVVFVFLVTTGSSGRPVPSRAFLEYDLDDYSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAH-LSPLQ  637
            LR  + S+  W  I+ CLA   ICP LN  + TAE FFAA  LSP++
Sbjct  121  LRQRLDSASRWDGIKTCLASTPICPSLNQTYATAEGFFAARWLSPVE  167



>ref|XP_010425983.1| PREDICTED: tetraspanin-3-like [Camelina sativa]
Length=285

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   +NFL F+ SIPI   GIWL+S+ ++ +C+ +L+WP++ IGI+IM+VSLAG
Sbjct  1    MRTSNHLIGLVNFLTFLLSIPILGGGIWLSSRANSTDCLRFLQWPLIVIGISIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++ + L+ LYLV M ++I  L+  +I A+ VT      +V  RGY +Y +  YS 
Sbjct  61   FAGACYRNKFLMWLYLVVMLLIIAALIGFIIFAYAVTDKGSGRTVLNRGYLDYYIQDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL++ ++    WGKI +CL D   C K+   F     TA+ FF   LSP++
Sbjct  121  WLKDRVSDDGYWGKISSCLRDSRACSKIGRNFNGVPETADMFFLRRLSPVE  171



>gb|ABK93187.1| unknown [Populus trichocarpa]
Length=269

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LS+N+   +NF+A + SIPI  AGIWLA +PDN C+  L+WP++ +GI I++V+LAGF
Sbjct  1    MALSSNVIGAINFVAMLLSIPIIGAGIWLAMEPDNSCVKILQWPIIILGILILIVALAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G +W+   LL  YL+ M ILIILL  L++  ++VT     +  P R Y EYRL  +S W
Sbjct  61   VGGFWRIPWLLISYLIAMLILIILLACLVVFIYMVTVRGSGHLEPSRAYLEYRLDDFSGW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W +IR CL+  ++C +LN  +  A+ FF AH+SPLQ
Sbjct  121  LRRRVQSSYKWDRIRGCLSSTNMCAELNQSYRMAQDFFNAHISPLQ  166



>ref|XP_010472376.1| PREDICTED: tetraspanin-8-like [Camelina sativa]
Length=273

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 101/165 (61%), Gaps = 2/165 (1%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGA  328
            SNN+   LNFL F+ SIPI A GIWL+ K   EC  +L  PV+ +G+ +M+V++AG  G+
Sbjct  5    SNNLVGILNFLVFLLSIPILAGGIWLSQKGSTECERFLDKPVIALGVFLMVVAIAGLIGS  64

Query  329  YWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRN  508
              +   LL  YL  M +LI+L+  + + AFVVT      ++ G+GY EYRLG YS WL+N
Sbjct  65   CCRVTWLLWFYLFVMFLLILLVFCITVFAFVVTNKGAGEAIAGKGYKEYRLGDYSDWLQN  124

Query  509  HITSSDSWGKIRACLADGDICPKLNNEFFT--AEQFFAAHLSPLQ  637
             + +  +W KIR+CL +  +C KL  +F       F+  HL+ LQ
Sbjct  125  RVNNGKNWDKIRSCLIESKVCSKLEAKFIDVPVNNFYQEHLTALQ  169



>ref|XP_010503176.1| PREDICTED: tetraspanin-3 [Camelina sativa]
Length=285

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   +NFL F+ SIPI   GIWL+S+ ++ +C+ +L+WP++ IGI+IM+VSLAG
Sbjct  1    MRTSNHLIGLVNFLTFLLSIPILGGGIWLSSRANSTDCLRFLQWPLIVIGISIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++ + L+ LYLV M ++I  L+  +I A+ VT      +V  RGY +Y +  YS 
Sbjct  61   FAGACYRNKFLMWLYLVVMLLIIAALIGFIIFAYAVTDKGSGRTVLNRGYLDYYIQDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL++ ++    WGKI +CL D   C K+   F     TA+ FF   LSP++
Sbjct  121  WLKDRVSDDGYWGKISSCLRDSGACRKIGRNFNGVPETADMFFLRRLSPVE  171



>gb|ABK24102.1| unknown [Picea sitchensis]
Length=272

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 100/164 (61%), Gaps = 0/164 (0%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            + N +T  +N +A + SIPI   GIWL+ K DNEC+ +L+ PV+ IG+ + LV L+GF G
Sbjct  2    IKNKVTGAINCIAMLLSIPIIGTGIWLSGKQDNECVKFLQGPVIAIGVLLFLVGLSGFIG  61

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A+W    LL LYLV M IL++LL++L+I  F VT     +++P R Y +Y L  +S WLR
Sbjct  62   AFWNIRCLLVLYLVFMFILLVLLMALVIFVFRVTDKGHGHTLPNRAYRQYNLYDFSGWLR  121

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
              + SS  W  IR CL+    C +L   F  A+ FF   + PL+
Sbjct  122  RRVQSSGRWNHIRNCLSSSTTCSRLKQRFTFAQDFFNGRIGPLE  165



>ref|XP_009387449.1| PREDICTED: tetraspanin-7-like [Musa acuminata subsp. malaccensis]
Length=273

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 102/166 (61%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            +  SNN+   LN + F+ SIPI +AGIWL  +   +C  +L+ PV+ +G+ ++LVSLAG 
Sbjct  2    VRCSNNMIGVLNIITFVLSIPILSAGIWLGRRATTDCEKFLQGPVIALGVFLLLVSLAGV  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G   +   LL LYL  M ILI+LL    + AFVVT      +V GRG+ EYRLG YS+W
Sbjct  62   VGGCCRNSCLLWLYLFVMFILIVLLFCFTVFAFVVTNKGAGEAVSGRGFKEYRLGDYSNW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  + ++ +W + ++CL DG +C  L     T EQF   +LSP+Q
Sbjct  122  LQKRVENNKNWKRFKSCLQDGKVCQSLQQNNQTWEQFINDNLSPIQ  167



>ref|XP_009336391.1| PREDICTED: tetraspanin-8-like [Pyrus x bretschneideri]
Length=266

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 105/168 (63%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNN+   LNF+ F+ SIPI  AG+WL+ +   EC  +L  PV+ +G+ +MLVSLAG 
Sbjct  1    MRVSNNLVGLLNFITFLLSIPIVWAGVWLSKQGSTECEKFLDKPVIILGVFLMLVSLAGL  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL+ M +LI++L ++ I AF VT       +  RGY EY+LG YS W
Sbjct  61   IGACCRVSWLLWVYLLVMFLLIVVLFAVTIFAFAVTNKGAGKVISNRGYKEYKLGDYSQW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + S+ +W KI++CL D  +C    +++   T + F++ +LS LQ
Sbjct  121  LQKRVNSTKNWNKIKSCLIDSKVCSTFRDKYVNDTIQTFYSENLSALQ  168



>dbj|BAJ99995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 102/167 (61%), Gaps = 1/167 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPD-NECIHWLRWPVVFIGIAIMLVSLAG  316
            + LSN +   LN + F+ S+PI A GIWL ++ D  EC  +L  P + +G+ +MLVS+AG
Sbjct  2    VRLSNTVIGILNAVTFLLSVPILAGGIWLRARADGTECERYLAAPFIVLGVFLMLVSVAG  61

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
              GA  +   LL  YLV M +LI++LL   + AFVVT      +V GRG+ EYRLG YS+
Sbjct  62   LVGACCRVTCLLWFYLVAMFLLIVVLLGFTVFAFVVTHKGTGEAVSGRGFKEYRLGDYST  121

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            WL+  +    +W +I+ CL D  +C  L +   T +QF A+ LSP+Q
Sbjct  122  WLQRRLEDDKNWNRIKGCLQDAKVCKSLEDRKETLDQFMASDLSPIQ  168



>ref|XP_006291625.1| hypothetical protein CARUB_v10017776mg [Capsella rubella]
 gb|EOA24523.1| hypothetical protein CARUB_v10017776mg [Capsella rubella]
Length=285

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   +NFL F+ SIPI   GIWL+S+ ++ +C+ +L+WP++ IGI+IM+VSLAG
Sbjct  1    MRTSNHLIGLVNFLTFLLSIPILGGGIWLSSRANSTDCLRFLQWPLIVIGISIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++ + L+ LYLV M ++I  L+  +I A+ VT      +V  RGY +Y L  YS 
Sbjct  61   FAGACYRNKFLMWLYLVVMLLIIAALIGFIIFAYAVTDKGSGRTVLNRGYLDYYLQDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPK----LNNEFFTAEQFFAAHLSPLQ  637
            WL++ ++    WGKI +CL D   C K    LN    TA+ FF   LSP++
Sbjct  121  WLKDRVSDDGYWGKISSCLRDSGACRKIGRNLNGVPETADMFFLRRLSPVE  171



>ref|NP_001061921.1| Os08g0443800 [Oryza sativa Japonica Group]
 dbj|BAD10042.1| putative senescence-associated protein [Oryza sativa Japonica 
Group]
 dbj|BAF23835.1| Os08g0443800 [Oryza sativa Japonica Group]
 dbj|BAG99002.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 98/165 (59%), Gaps = 1/165 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAGFA  322
            LSNN+   LN +  + S PI + GIW+A++ D  EC   L  P + +G  +M VSLAG  
Sbjct  5    LSNNVIGALNLVTLLLSAPILSGGIWMATRGDGGECDRHLSSPAIALGAVLMAVSLAGLV  64

Query  323  GAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWL  502
            GA  +   LL +YL+ M  LI+ LL     AF VT      +V GRGY EYRLG YS+WL
Sbjct  65   GACCRVTWLLWVYLLAMFALIVALLGFTAFAFAVTNRGAGEAVSGRGYREYRLGDYSTWL  124

Query  503  RNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            R H+ SS +W KIR+CLA  D+C  L +   T  QF A  LSP+Q
Sbjct  125  RRHVGSSKNWDKIRSCLAGADVCRSLQDRNETWAQFVADDLSPVQ  169



>gb|KFK32704.1| hypothetical protein AALP_AA6G278100 [Arabis alpina]
Length=272

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 101/165 (61%), Gaps = 2/165 (1%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGA  328
            SNN+   LNF+ F+ S+PI A GIWL+ K   EC  +L  PV+ +G+ +M+V++AG  G+
Sbjct  5    SNNLVGILNFVVFLLSVPILAGGIWLSQKGSTECERFLDKPVIALGVFLMVVAIAGLIGS  64

Query  329  YWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRN  508
              +   LL  YL  M +LI+L+ S+ + AFVVT      +V G+GY EYRLG YS+WL+N
Sbjct  65   CCRVTWLLWTYLFVMFLLILLVFSITVFAFVVTNKGAGETVSGKGYKEYRLGDYSNWLQN  124

Query  509  HITSSDSWGKIRACLADGDICPKLNNEFFT--AEQFFAAHLSPLQ  637
             +    +W KIR+CL D  +C KL  +        F+  HL+ LQ
Sbjct  125  RVNDDKNWNKIRSCLVDSKVCSKLEAKLVDVPVTNFYQEHLTALQ  169



>ref|NP_001131638.1| Senescence-associated protein 5 isoform 1 [Zea mays]
 gb|ACF80140.1| unknown [Zea mays]
 gb|ACG41457.1| senescence-associated protein 5 [Zea mays]
 gb|AFW76474.1| Senescence-associated protein 5 isoform 1 [Zea mays]
 gb|AFW76475.1| Senescence-associated protein 5 isoform 2 [Zea mays]
 gb|AFW76476.1| Senescence-associated protein 5 isoform 3 [Zea mays]
Length=274

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 113/170 (66%), Gaps = 4/170 (2%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNE-CIHWLRWPVVFIGIAIMLVSLAG  316
            M++SNNITA +NFL  +C+IPI A G+WLAS+   E C    RWP+  +G  ++LV+LAG
Sbjct  1    MAVSNNITACINFLVLLCTIPIAATGLWLASRHGGEDCARLARWPIAVLGALLLLVALAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGAYW + GLL  YL  MA LI LLL+LL+ AF V   SGAY  PGR Y +YRL GYSS
Sbjct  61   FAGAYWNRRGLLACYLFAMAALITLLLALLVFAFAVAHDSGAYPAPGRAYQDYRLQGYSS  120

Query  497  WLRNHITSS-DSWGKIRACLADGDICPKL--NNEFFTAEQFFAAHLSPLQ  637
            WLR ++      W  +RAC+A    C KL  +  F   EQF+ +HLSP++
Sbjct  121  WLRGYVADDPRRWEGVRACVAASGTCRKLAMDRSFIVPEQFYMSHLSPIE  170



>ref|XP_009336394.1| PREDICTED: tetraspanin-8-like [Pyrus x bretschneideri]
Length=267

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 105/168 (63%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNN+   LNF+ F+ SIPI  AG+WL+ +   EC  +L  PV+ +G+ +MLVSLAG 
Sbjct  1    MRVSNNLVGLLNFITFLLSIPIVWAGVWLSKQGSTECEKFLDKPVIILGVFLMLVSLAGL  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL+ M +LI++L ++ I AF VT       +  RGY EY+LG YS W
Sbjct  61   IGACCRVSWLLWVYLLVMFLLIVVLFAVTIFAFAVTNKGAGKVISNRGYKEYKLGDYSQW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + S+ +W KI++CL D  +C    +++   T + F++ +LS LQ
Sbjct  121  LQKRVNSTKNWNKIKSCLIDSKVCSTFRDKYVNDTIQTFYSENLSALQ  168



>ref|XP_008789800.1| PREDICTED: tetraspanin-7 [Phoenix dactylifera]
Length=272

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 101/166 (61%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            + +SNN+   LN L  + SIPI  AGIWL+ +   +C  +L  PV+ +G+ ++LVSLAG 
Sbjct  2    VRVSNNLIGILNILTLLLSIPILGAGIWLSHRAHTDCEKFLERPVIVLGVFLLLVSLAGL  61

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL LYL+ M +LI+LL    + AFVVT       V GRGY EYRLG YS W
Sbjct  62   FGACGRVSCLLWLYLLVMFLLIVLLFCFTVFAFVVTNRGAGEIVSGRGYKEYRLGDYSHW  121

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            L+  + +  +W KIR+CL D ++C  L  +  T ++F   +LSP Q
Sbjct  122  LQKRVENEGNWRKIRSCLQDSNVCKSLQEKNQTLDEFINNNLSPTQ  167



>ref|XP_009101499.1| PREDICTED: protein TORNADO 2-like [Brassica rapa]
Length=263

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 105/166 (63%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M LSNN+   +NF+A + S+P+  AGIWLA    N C+  L+WP++ +GI I+LV LAGF
Sbjct  1    MPLSNNVIGCINFIAVLLSLPVIGAGIWLAMGTVNSCVKILQWPIIILGILILLVGLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G  W+   LLG+YL+ M +LI+LL  L+   ++VT     +  P R Y EY L  +S +
Sbjct  61   IGGLWRITWLLGVYLIAMLVLIVLLGVLIGFTYMVTIKGSGHPEPSRAYLEYSLQDFSGY  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  +  SD W +IR CL+  +ICP+LN  F  A  FF AHLSP+Q
Sbjct  121  LRQRVEKSDKWDRIRTCLSTTNICPELNQRFSMAMDFFNAHLSPIQ  166



>dbj|BAD42919.1| similar to senescence-associated protein [Arabidopsis thaliana]
Length=273

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 102/165 (62%), Gaps = 2/165 (1%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGA  328
            SNN+   LNFL F+ SIPI A GIWL+ K   EC  +L  PV+ +G+ +M+V++AG  G+
Sbjct  5    SNNLVGILNFLVFLLSIPILAGGIWLSQKGSTECERFLDKPVIALGVFLMVVAIAGLVGS  64

Query  329  YWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRN  508
              +   LL +YL  M +LI+L+  + + AFVVT      ++ G+GY EY+LG YS+WL+ 
Sbjct  65   CCRVTWLLWVYLFVMFLLILLVFCITVFAFVVTNKGAGEAIEGKGYKEYKLGDYSTWLQK  124

Query  509  HITSSDSWGKIRACLADGDICPKLNNEFFT--AEQFFAAHLSPLQ  637
             + +  +W KIR+CL +  +C KL  +F       F+  HL+ LQ
Sbjct  125  RVENGKNWNKIRSCLVESKVCSKLEAKFVNVPVNSFYKEHLTALQ  169



>gb|KDO73130.1| hypothetical protein CISIN_1g023208mg [Citrus sinensis]
Length=285

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 103/171 (60%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNF  F+ SIPI   GIWL+S+ +N +C+ +L+WP++ IG++IM+VSLAG
Sbjct  1    MRNSNHLIGLLNFFTFLLSIPIIGGGIWLSSRANNTDCLKFLQWPLIVIGVSIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   L+  YL  M  +I  L+  +I A+ VT       V  R Y EY L  YS 
Sbjct  61   FAGACYRNTHLMRFYLFVMFFIIAALIGFIIFAYAVTDKGSGRPVMDRAYSEYHLEDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKL----NNEFFTAEQFFAAHLSPLQ  637
            WL++ +T    WGKI +C+ D  +CPK+    N    TA+ F    L+P+Q
Sbjct  121  WLKDRVTDDSYWGKISSCIRDSKVCPKMRRVINGAPETADMFSLRKLNPVQ  171



>ref|XP_006424654.1| hypothetical protein CICLE_v10028995mg [Citrus clementina]
 ref|XP_006488180.1| PREDICTED: tetraspanin-3-like [Citrus sinensis]
 gb|ESR37894.1| hypothetical protein CICLE_v10028995mg [Citrus clementina]
Length=285

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 103/171 (60%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNF  F+ SIPI   GIWL+S+ +N +C+ +L+WP++ IG++IM+VSLAG
Sbjct  1    MRNSNHLIGLLNFFTFLLSIPIIGGGIWLSSRANNTDCLKFLQWPLIVIGVSIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   L+  YL  M  +I  L+  +I A+ VT       V  R Y EY L  YS 
Sbjct  61   FAGACYRNTHLMRFYLFVMFFIIAALIGFIIFAYAVTDKGSGRPVMDRAYSEYHLEDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKL----NNEFFTAEQFFAAHLSPLQ  637
            WL++ +T    WGKI +C+ D  +CPK+    N    TA+ F    L+P+Q
Sbjct  121  WLKDRVTDDSYWGKISSCIRDSKVCPKMRRVINGAPETADMFSLRKLNPVQ  171



>ref|XP_007223206.1| hypothetical protein PRUPE_ppa010029mg [Prunus persica]
 gb|EMJ24405.1| hypothetical protein PRUPE_ppa010029mg [Prunus persica]
Length=267

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNN+   LNF+ F+ SIPI  AG+WL+ +   EC  +L  PV+ +G+ +MLVSLAG 
Sbjct  1    MKISNNLVGLLNFITFLLSIPIVVAGVWLSKQGSTECEKFLDKPVIILGVFLMLVSLAGL  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL+ M +LI++L +  I AF VT       +  +GY EYRLG YS+W
Sbjct  61   IGACCRVSWLLWVYLLVMFLLIVVLFAFTIFAFAVTNKGAGKVLSDKGYKEYRLGDYSNW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  ++S+ +W KI++CL D  +C    +++   T  + +  +LS LQ
Sbjct  121  LQKRVSSTKNWNKIKSCLIDSKVCSTFQDKYVNDTISELYKENLSALQ  168



>ref|XP_004509732.1| PREDICTED: protein TORNADO 2-like [Cicer arietinum]
Length=269

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+LSNN+   +NF+A + SIPI  AGIWLA+     C+  L+WPV+ +GI I++V++AGF
Sbjct  1    MALSNNVIGVINFIAMLLSIPIIGAGIWLATLQAESCVQILQWPVIILGILILIVAMAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+W+   LL  YL+ M +LI+LL+ L+I  +VVT        P R Y EY +  +S W
Sbjct  61   IGAFWRIPMLLIFYLIAMIVLIVLLVCLVIFVYVVTLRGHGNIEPNRSYLEYDVDDFSIW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  + SS  W  I++CL+  ++C +LN  +  A+ FF AHL+PLQ
Sbjct  121  LRRRVRSSHKWDGIKSCLSSSNMCAELNQSYRLAQDFFNAHLTPLQ  166



>gb|KHN22039.1| hypothetical protein glysoja_008951 [Glycine soja]
Length=285

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 106/171 (62%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNFL F+ SIPI   GIWL+S+ +N +C+ +L+WP++ IG++IM+VSLAG
Sbjct  1    MRKSNHLIGLLNFLTFLLSIPILGGGIWLSSRANNTDCLKFLQWPLIIIGVSIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   L+ LYLV M ++I +L+  +I A+VVT       V  R Y EY L  YS 
Sbjct  61   FAGACYRNTFLMRLYLVVMFLVIAVLIGFIIFAYVVTDKGSGRRVMSRAYLEYYLEDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKL----NNEFFTAEQFFAAHLSPLQ  637
            WL   + S   WGKI +C+ D   C ++    N    T + F+  HL+P+Q
Sbjct  121  WLEERVASDSYWGKIASCVRDSKACGRMGITINGMPETPDMFYIRHLTPIQ  171



>ref|NP_001105285.1| senescence-associated protein DH [Zea mays]
 gb|AAV31120.1| senescence-associated protein DH [Zea mays]
 gb|ACF84512.1| unknown [Zea mays]
 gb|ACG39120.1| senescence-associated protein DH [Zea mays]
 tpg|DAA61554.1| TPA: Senescence-associated protein DH [Zea mays]
Length=273

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 103/165 (62%), Gaps = 1/165 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPD-NECIHWLRWPVVFIGIAIMLVSLAGFA  322
            LSNN+   LNF+ F+ S+PI  AGIWL  + D  EC  +L  PV+ +G  ++ VSLAG  
Sbjct  5    LSNNLIGVLNFVTFLLSVPILGAGIWLGHRADGTECERYLSAPVIALGAFLLAVSLAGLV  64

Query  323  GAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWL  502
            GA  +   LL  YL+ M +LI++L    + AFVVT      +V GRGY EYRLG YS+WL
Sbjct  65   GACCRVTWLLWAYLLAMFVLILVLFCFTVFAFVVTNRGAGEAVSGRGYKEYRLGDYSNWL  124

Query  503  RNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            +  + ++ +W +IR+CL D  +C  L ++  T  QF ++ LSP++
Sbjct  125  QKRVENTRNWDRIRSCLQDSKVCKSLQDKNETVAQFMSSSLSPIE  169



>ref|NP_850045.2| tetraspanin8 [Arabidopsis thaliana]
 sp|Q8S8Q6.1|TET8_ARATH RecName: Full=Tetraspanin-8 [Arabidopsis thaliana]
 gb|AAM14957.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07493.1| tetraspanin8 [Arabidopsis thaliana]
Length=273

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 102/165 (62%), Gaps = 2/165 (1%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGA  328
            SNN+   LNFL F+ SIPI A GIWL+ K   EC  +L  PV+ +G+ +M+V++AG  G+
Sbjct  5    SNNLVGILNFLVFLLSIPILAGGIWLSQKGSTECERFLDKPVIALGVFLMVVAIAGLIGS  64

Query  329  YWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRN  508
              +   LL +YL  M +LI+L+  + + AFVVT      ++ G+GY EY+LG YS+WL+ 
Sbjct  65   CCRVTWLLWVYLFVMFLLILLVFCITVFAFVVTNKGAGEAIEGKGYKEYKLGDYSTWLQK  124

Query  509  HITSSDSWGKIRACLADGDICPKLNNEFFT--AEQFFAAHLSPLQ  637
             + +  +W KIR+CL +  +C KL  +F       F+  HL+ LQ
Sbjct  125  RVENGKNWNKIRSCLVESKVCSKLEAKFVNVPVNSFYKEHLTALQ  169



>ref|XP_009133989.1| PREDICTED: tetraspanin-8-like [Brassica rapa]
Length=270

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 101/165 (61%), Gaps = 2/165 (1%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGA  328
            SNN+   LNF+ F+ SIPI A GIWL+     EC  +L  PV+ +G+ +M+V++ G  G+
Sbjct  5    SNNLVGILNFIVFLLSIPILAGGIWLSQNGSTECEGFLDKPVIALGVFLMVVAIVGLIGS  64

Query  329  YWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRN  508
              +   LL  YL  M +LI+L+ S+ + AFVVT       V GRGY EYRLG YS+WL+ 
Sbjct  65   CCRVTWLLWTYLFVMFLLILLVFSITVFAFVVTNKGAGEKVSGRGYKEYRLGDYSNWLQK  124

Query  509  HITSSDSWGKIRACLADGDICPKLNNEFFT--AEQFFAAHLSPLQ  637
             + S  +W KIR+CLAD  +C KL ++      + F+  HL+ LQ
Sbjct  125  RVNSDKNWNKIRSCLADSKVCSKLEDKLVGVPVKNFYNEHLTALQ  169



>ref|NP_001241564.1| uncharacterized protein LOC100788977 [Glycine max]
 gb|ACU23085.1| unknown [Glycine max]
Length=285

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 106/171 (62%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   LNFL F+ SIPI   GIWL+S+ +N +C+ +L+WP++ IG++IM+VSLAG
Sbjct  1    MRKSNHLIGLLNFLTFLLSIPILGGGIWLSSRANNTDCLKFLQWPLIIIGVSIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++   L+ LYLV M ++I +L+  +I A+VVT       V  R Y EY L  YS 
Sbjct  61   FAGACYRNTFLMRLYLVVMFLVIAVLIGFIIFAYVVTDKGSGRRVMNRAYLEYYLEDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKL----NNEFFTAEQFFAAHLSPLQ  637
            WL   + S   WGKI +C+ D   C ++    N    T + F+  HL+P+Q
Sbjct  121  WLEERVASDSYWGKIVSCVRDSKACGRMGITINGMPETPDMFYIRHLTPIQ  171



>ref|XP_008362147.1| PREDICTED: tetraspanin-8-like [Malus domestica]
Length=267

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 105/168 (63%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M +SNN+   LNF+ F+ SIPI  AG+WL+ +   EC  +L  PV+ +G+ +MLVSLAG 
Sbjct  1    MRVSNNLVGLLNFITFLLSIPIVWAGVWLSKQGSTECEKFLDKPVIILGVFLMLVSLAGL  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA  +   LL +YL+ M +LI++L ++ I AF VT       +  RGY EY+LG YS W
Sbjct  61   IGACCRVSWLLWVYLLVMFLLIVVLFAVTIFAFAVTNKGAGKVLSNRGYKEYKLGDYSQW  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
            L+  + S+ +W KI++CL D  +C    +++   T + F++ +LS LQ
Sbjct  121  LQKRVNSTKNWNKIKSCLIDSKVCSNFRDKYANDTIQTFYSENLSALQ  168



>gb|KFK33948.1| hypothetical protein AALP_AA5G082700 [Arabis alpina]
Length=285

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   +NFL F+ SIPI   GIWL+S+ ++ +C+ +L+WP++ IGI+IM+VSLAG
Sbjct  1    MRSSNHVIGLVNFLTFLLSIPILGGGIWLSSRANSTDCLRFLQWPLIVIGISIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++ + L+ LYLV M ++I  L+  +I A+ VT      ++  RGY +Y L  YS 
Sbjct  61   FAGACYRNKFLMWLYLVVMLLIIAALIGFIIFAYAVTDKGSGRALLNRGYLDYYLQDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL++ ++    WGKI +C+ D   C K+   F     TA+ FF   LSP++
Sbjct  121  WLKDRVSDDGYWGKISSCIRDSGACRKIGRNFNGVPETADMFFIRKLSPVE  171



>ref|XP_004136394.1| PREDICTED: uncharacterized protein LOC101218363 [Cucumis sativus]
 ref|XP_004171514.1| PREDICTED: uncharacterized protein LOC101223520 [Cucumis sativus]
 gb|KGN60375.1| hypothetical protein Csa_3G901690 [Cucumis sativus]
Length=274

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 105/166 (63%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M+L+  +   +NF+A + SIPI  AGIWLA++ DN C+  L+WP++  G+ ++LV++AGF
Sbjct  1    MALNKTVMGAINFIAMVVSIPIIGAGIWLATQQDNACVQILQWPLIIFGVIVLLVAVAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             GA+ +   LL  YLV M ILI+LL  L+   ++VT     +  P R Y EY L  +S +
Sbjct  61   IGAFCRINWLLIAYLVAMLILIVLLGCLVGFIYMVTIRGSGHLEPNRSYLEYHLEDFSGF  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR+ + SS  W  IR+CL+   +C +LN  F  A+ FF A +SPLQ
Sbjct  121  LRHRVQSSFKWDLIRSCLSSSSMCAELNQSFRLAQDFFTAPISPLQ  166



>ref|XP_009150196.1| PREDICTED: tetraspanin-3 [Brassica rapa]
 emb|CDY48148.1| BnaCnng15900D [Brassica napus]
 emb|CDY23698.1| BnaC01g24230D [Brassica napus]
Length=285

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 109/171 (64%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   +NFL F+ SIPI   GIWL+S+ ++ +C+ +L+WP++ IGI+IM+VSLAG
Sbjct  1    MRSSNHLIGMVNFLTFLLSIPILGGGIWLSSRANSTDCLRFLQWPLIVIGISIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++ + L+ LYLV M ++I  L+  +I A+ VT      +V  RGY +Y L  YS 
Sbjct  61   FAGACYRNKFLMWLYLVAMLLIIAALIGFIIFAYAVTDKGSGRTVLNRGYLDYYLQDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL++ ++    WGKI +C+ D   C K+   F     +A+ FF   LSP++
Sbjct  121  WLKDRVSDDGYWGKISSCIRDSGACRKIGRSFNGVPESADMFFQRSLSPVE  171



>emb|CDY63054.1| BnaA06g40440D [Brassica napus]
Length=263

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 105/166 (63%), Gaps = 0/166 (0%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGF  319
            M LSNN+   +NF+A + S+P+  AGIWLA    N C+  L+WP++ +GI I+LV LAGF
Sbjct  1    MPLSNNVIGCINFIAVLLSLPVIGAGIWLAMGTVNSCVKILQWPIIILGILILLVGLAGF  60

Query  320  AGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSW  499
             G  W+   LLG+YL+ M +LI+LL  L+   ++VT     +  P R Y EY L  +S +
Sbjct  61   IGGLWRITWLLGVYLIAMLVLIVLLGVLIGFTYMVTIKGSGHPEPSRAYLEYSLQDFSGY  120

Query  500  LRNHITSSDSWGKIRACLADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            LR  +  +D W +IR CL+  +ICP+LN  F  A  FF AHLSP+Q
Sbjct  121  LRQRVEKADKWDRIRTCLSTTNICPELNQRFSMAMDFFNAHLSPIQ  166



>ref|XP_010535582.1| PREDICTED: tetraspanin-3-like [Tarenaya hassleriana]
Length=285

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 104/171 (61%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M  SN++   +NFL F+ SIPI   GIWL+S+ +  +C+ +L+WP++ IGI+IM+VSLAG
Sbjct  1    MRTSNHLIGLVNFLTFLLSIPILGGGIWLSSRANTTDCLRFLQWPLIVIGISIMVVSLAG  60

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++ + L+  YL  M  +I  L+  +I A+ VT       V  RGY +Y LG YS 
Sbjct  61   FAGACYRNKFLMWFYLFVMIFVIAALIGFIIFAYAVTDKGTGRVVLNRGYLDYYLGDYSG  120

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL++ +     W KIR+C+ D   C K+   F     TA+ FF   LSP++
Sbjct  121  WLKDRVADDGYWAKIRSCIRDSGACSKIGRSFNGVPETADMFFLRRLSPIE  171



>ref|XP_002325098.2| senescence-associated family protein [Populus trichocarpa]
 gb|EEF03663.2| senescence-associated family protein [Populus trichocarpa]
Length=273

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 101/166 (61%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LNF+ F+ SIPI  AGIWL +K  +EC  +   PV+ +GI ++LVSLAG  G
Sbjct  4    LSNNLVGILNFITFLLSIPILWAGIWLKNKGTSECDKFFDTPVIILGIFLLLVSLAGLIG  63

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL  YL+ M +LI+LL    I AFVVT       + G+GY EY+LG YS+WL+
Sbjct  64   ACCRVSWLLWAYLLVMFLLIVLLFCFTIFAFVVTNKGAGQVLSGKGYKEYKLGDYSNWLQ  123

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
              + +  +W KI++CL D  +C   N +F   T E  +  HLS LQ
Sbjct  124  KRVGNQKNWRKIKSCLIDAKVCSDFNQKFANDTVEVLYTRHLSALQ  169



>ref|XP_011018100.1| PREDICTED: tetraspanin-8 [Populus euphratica]
Length=273

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 2/166 (1%)
 Frame = +2

Query  146  LSNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAG  325
            LSNN+   LNF+ F+ SIPI  AGIWL +K  +EC  +   PV+ +GI ++LVSLAG  G
Sbjct  4    LSNNLVGILNFITFLLSIPILWAGIWLKNKGTSECDKFFDTPVIVLGIFLLLVSLAGLIG  63

Query  326  AYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLR  505
            A  +   LL  YL+ M +LI+LL    I AFVVT       + G+GY EY+LG YS+WL+
Sbjct  64   ACCRVSWLLWTYLLVMFLLIVLLFCFTIFAFVVTNKGAGQVLSGKGYKEYKLGDYSNWLQ  123

Query  506  NHITSSDSWGKIRACLADGDICPKLNNEFF--TAEQFFAAHLSPLQ  637
              + +  +W KI++CL D  +C   N +F   T +  +  HLS LQ
Sbjct  124  KRVGNEKNWRKIKSCLIDAKVCSDFNQKFVNDTVDVLYTRHLSALQ  169



>ref|XP_006419022.1| hypothetical protein EUTSA_v10002614mg [Eutrema salsugineum]
 gb|ESQ37458.1| hypothetical protein EUTSA_v10002614mg [Eutrema salsugineum]
Length=312

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 108/171 (63%), Gaps = 5/171 (3%)
 Frame = +2

Query  140  MSLSNNITAFLNFLAFMCSIPITAAGIWLASKPDN-ECIHWLRWPVVFIGIAIMLVSLAG  316
            M   N++  F+NFL F+ SIPI   GIWL+S+ ++ +C+ +L+WP++ IGI+IM+VSLAG
Sbjct  27   MRSCNHVIGFVNFLTFLLSIPILGGGIWLSSRANSTDCLRFLQWPLIVIGISIMVVSLAG  86

Query  317  FAGAYWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSS  496
            FAGA ++ + L+ LYLV M ++I  L+  +I A+ VT      +V  RGY +Y L  YS 
Sbjct  87   FAGACYRNKFLMWLYLVVMLLIIAALIGFIIFAYAVTDKGSGRTVVNRGYLDYYLQDYSG  146

Query  497  WLRNHITSSDSWGKIRACLADGDICPKLNNEF----FTAEQFFAAHLSPLQ  637
            WL++ ++    WGKI +C+ D   C K+   F      ++ FF   LSP++
Sbjct  147  WLKDRVSDDGYWGKISSCIRDSGACRKIGRSFNGVPENSDMFFMRRLSPVE  197



>gb|ABK24083.1| unknown [Picea sitchensis]
Length=257

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = +2

Query  194  SIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGAYWKKEGLLGLYLVCM  373
            S+ I  +GIWLASK D EC+ +LRWP++ IG+ ++LVS AGF G+ W+   LL +YL+ M
Sbjct  4    SVLIIGSGIWLASKQDTECVRFLRWPIITIGVILLLVSAAGFVGSLWRVPYLLVIYLIFM  63

Query  374  AiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRNHITSSDSWGKIRACL  553
             +LII+LL+L+I AFVVT   G ++V GR YDEY+L  +S WLR+++ ++  W KI++CL
Sbjct  64   FVLIIVLLALVIFAFVVTNKGGGHAVVGRNYDEYQLNDFSGWLRHYVENTKQWNKIKSCL  123

Query  554  ADGDICPKLNNEFFTAEQFFAAHLSPLQ  637
            +   +C +L+  + +A+ FF+AHL PL+
Sbjct  124  SSSKLCSQLDQRYPSAQYFFSAHLKPLE  151



>ref|XP_002880529.1| hypothetical protein ARALYDRAFT_481243 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56788.1| hypothetical protein ARALYDRAFT_481243 [Arabidopsis lyrata subsp. 
lyrata]
Length=273

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 101/165 (61%), Gaps = 2/165 (1%)
 Frame = +2

Query  149  SNNITAFLNFLAFMCSIPITAAGIWLASKPDNECIHWLRWPVVFIGIAIMLVSLAGFAGA  328
            SNN+   LNFL F+ SIPI A GIWL+ K   EC  +L  PV+ +G+ +M+V++AG  G+
Sbjct  5    SNNLVGILNFLVFLLSIPILAGGIWLSQKGSTECERFLDKPVIALGVFLMVVAIAGLIGS  64

Query  329  YWKKEGLLGLYLVCMAiliilllsllilAFVVTRPSGAYSVPGRGYDEYRLGGYSSWLRN  508
              +   LL +YL  M +LI+L+  + + AFVVT      ++ G+GY EY+LG YS WL+ 
Sbjct  65   CCRVTWLLWVYLFVMFLLILLVFCITVFAFVVTNKGAGEAIEGKGYKEYKLGDYSDWLQK  124

Query  509  HITSSDSWGKIRACLADGDICPKLNNEFFT--AEQFFAAHLSPLQ  637
             + +  +W KIR+CL +  +C KL  +F       F+  HL+ LQ
Sbjct  125  RVENGKNWNKIRSCLVESKVCSKLEAKFVNVPVTSFYNEHLTALQ  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125