BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F24

Length=506
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFK40653.1|  unknown                                                 270   7e-89   Medicago truncatula
gb|AAC33509.1|  glycolate oxidase                                       270   1e-88   Nicotiana tabacum [American tobacco]
gb|KDO50499.1|  hypothetical protein CISIN_1g017492mg                   270   2e-88   Citrus sinensis [apfelsine]
gb|ACJ85002.1|  unknown                                                 270   3e-88   Medicago truncatula
ref|XP_009615478.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    273   8e-88   Nicotiana tomentosiformis
gb|KDO50498.1|  hypothetical protein CISIN_1g017492mg                   272   8e-88   Citrus sinensis [apfelsine]
ref|XP_009619055.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    273   1e-87   Nicotiana tomentosiformis
ref|XP_006442234.1|  hypothetical protein CICLE_v10020692mg             272   2e-87   Citrus clementina [clementine]
ref|XP_009783958.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    272   2e-87   Nicotiana sylvestris
gb|KDO50496.1|  hypothetical protein CISIN_1g017492mg                   271   3e-87   Citrus sinensis [apfelsine]
gb|KDO50495.1|  hypothetical protein CISIN_1g017492mg                   271   3e-87   Citrus sinensis [apfelsine]
gb|KDO50494.1|  hypothetical protein CISIN_1g017492mg                   271   6e-87   Citrus sinensis [apfelsine]
gb|KDO50493.1|  hypothetical protein CISIN_1g017492mg                   271   6e-87   Citrus sinensis [apfelsine]
gb|KDO50492.1|  hypothetical protein CISIN_1g017492mg                   271   6e-87   Citrus sinensis [apfelsine]
ref|XP_011008443.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    271   7e-87   Populus euphratica
ref|XP_002317470.1|  glycolate oxidase family protein                   271   9e-87   Populus trichocarpa [western balsam poplar]
ref|XP_011029540.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    271   1e-86   Populus euphratica
gb|KEH38401.1|  peroxisomal (S)-2-hydroxy-acid oxidase GLO1             271   1e-86   Medicago truncatula
gb|AFK39756.1|  unknown                                                 270   3e-86   Lotus japonicus
ref|XP_006348379.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    270   3e-86   Solanum tuberosum [potatoes]
gb|ACU19205.1|  unknown                                                 269   6e-86   Glycine max [soybeans]
ref|XP_006596932.1|  PREDICTED: peroxisomal glycolate oxidase iso...    268   6e-86   Glycine max [soybeans]
ref|XP_007149221.1|  hypothetical protein PHAVU_005G051800g             268   9e-86   Phaseolus vulgaris [French bean]
ref|XP_004294094.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    268   1e-85   Fragaria vesca subsp. vesca
ref|XP_010694574.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    268   2e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006370191.1|  glycolate oxidase family protein                   267   2e-85   Populus trichocarpa [western balsam poplar]
ref|XP_002278104.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    267   3e-85   Vitis vinifera
gb|AFK39624.1|  unknown                                                 267   3e-85   Lotus japonicus
emb|CAN74334.1|  hypothetical protein VITISV_021217                     267   3e-85   Vitis vinifera
ref|XP_011098128.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    266   4e-85   Sesamum indicum [beniseed]
ref|XP_008383001.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    266   6e-85   Malus domestica [apple tree]
ref|XP_008439620.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    266   6e-85   Cucumis melo [Oriental melon]
ref|XP_010540122.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    266   6e-85   Tarenaya hassleriana [spider flower]
emb|CDP06107.1|  unnamed protein product                                266   8e-85   Coffea canephora [robusta coffee]
ref|XP_004488698.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    265   1e-84   
ref|XP_004243189.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    265   1e-84   Solanum lycopersicum
ref|XP_009407720.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    265   1e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009354832.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    265   1e-84   Pyrus x bretschneideri [bai li]
gb|ACY07928.1|  glycolate oxidase                                       259   1e-84   Panax ginseng [Asiatic ginseng]
ref|XP_002862992.1|  hypothetical protein ARALYDRAFT_333142             265   1e-84   Arabidopsis lyrata subsp. lyrata
gb|ADX97325.1|  glycolate oxidase                                       265   1e-84   Mangifera indica
gb|KJB57221.1|  hypothetical protein B456_009G154200                    265   2e-84   Gossypium raimondii
ref|XP_010244724.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    265   2e-84   Nelumbo nucifera [Indian lotus]
gb|KJB57223.1|  hypothetical protein B456_009G154200                    265   2e-84   Gossypium raimondii
gb|KGN49406.1|  hypothetical protein Csa_6G523470                       264   3e-84   Cucumis sativus [cucumbers]
tpg|DAA59562.1|  TPA: hypothetical protein ZEAMMB73_759880              259   3e-84   
ref|XP_010542340.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    264   4e-84   Tarenaya hassleriana [spider flower]
ref|XP_006389989.1|  hypothetical protein EUTSA_v10018744mg             264   4e-84   Eutrema salsugineum [saltwater cress]
gb|KDP37990.1|  hypothetical protein JCGZ_04633                         264   4e-84   Jatropha curcas
ref|XP_004170017.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    264   4e-84   
ref|XP_008372273.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    264   5e-84   
prf||1803516A  glycolate oxidase                                        263   5e-84
ref|XP_004981533.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    265   5e-84   
sp|P05414.1|GOX_SPIOL  RecName: Full=Peroxisomal (S)-2-hydroxy-ac...    263   6e-84   Spinacia oleracea
pdb|1GOX|A  Chain A, Refined Structure Of Spinach Glycolate Oxida...    263   6e-84   Spinacia oleracea
pdb|1AL7|A  Chain A, Three-Dimensional Structures Of Glycolate Ox...    263   6e-84   Spinacia oleracea
ref|NP_001238412.1|  peroxisomal glycolate oxidase                      263   6e-84   Glycine max [soybeans]
gb|EPS70764.1|  glycolate oxidase                                       263   7e-84   Genlisea aurea
ref|NP_001241302.1|  peroxisomal (S)-2-hydroxy-acid oxidase GLO1-...    263   7e-84   Glycine max [soybeans]
gb|KHN26775.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO1             263   8e-84   Glycine soja [wild soybean]
gb|KJB12827.1|  hypothetical protein B456_002G038000                    258   8e-84   Gossypium raimondii
gb|AEX09184.1|  glycolate oxidase                                       263   9e-84   Gossypium hirsutum [American cotton]
ref|XP_010472054.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    263   9e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010428965.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    263   1e-83   Camelina sativa [gold-of-pleasure]
ref|XP_006300515.1|  hypothetical protein CARUB_v10020498mg             263   1e-83   Capsella rubella
gb|AGV54360.1|  peroxisomal glycolate oxidase                           263   1e-83   Phaseolus vulgaris [French bean]
ref|XP_008787823.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    263   1e-83   Phoenix dactylifera
ref|XP_009344324.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    262   2e-83   Pyrus x bretschneideri [bai li]
gb|AIP93617.1|  GOX                                                     262   2e-83   Bassia scoparia [burning bush]
pdb|1GYL|A  Chain A, Involvement Of Tyr24 And Trp108 In Substrate...    262   2e-83   Spinacia oleracea
gb|KJB12828.1|  hypothetical protein B456_002G038000                    259   2e-83   Gossypium raimondii
ref|XP_002519658.1|  (S)-2-hydroxy-acid oxidase, putative               262   2e-83   Ricinus communis
ref|XP_007211461.1|  hypothetical protein PRUPE_ppa007390mg             262   2e-83   Prunus persica
ref|XP_010110945.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO1        261   2e-83   
gb|AAB40396.1|  glycolate oxidase                                       262   3e-83   Mesembryanthemum crystallinum
ref|XP_010275857.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    262   3e-83   Nelumbo nucifera [Indian lotus]
ref|XP_010275856.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    262   4e-83   Nelumbo nucifera [Indian lotus]
ref|XP_006360019.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    261   4e-83   Solanum tuberosum [potatoes]
ref|XP_007022181.1|  Aldolase-type TIM barrel family protein isof...    261   4e-83   
ref|XP_007025049.1|  Aldolase-type TIM barrel family protein isof...    261   4e-83   
ref|XP_004981534.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    261   5e-83   Setaria italica
ref|XP_008226252.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    261   6e-83   Prunus mume [ume]
ref|NP_001051487.1|  Os03g0786100                                       261   8e-83   
ref|XP_010244729.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    260   9e-83   Nelumbo nucifera [Indian lotus]
ref|XP_010052052.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    260   9e-83   Eucalyptus grandis [rose gum]
emb|CAN67413.1|  hypothetical protein VITISV_005886                     260   1e-82   Vitis vinifera
ref|XP_008777164.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    258   1e-82   
gb|EYU38209.1|  hypothetical protein MIMGU_mgv1a008544mg                260   1e-82   Erythranthe guttata [common monkey flower]
ref|XP_008651329.1|  PREDICTED: glycolate oxidase1 isoform X1           260   1e-82   
gb|ABY61829.1|  hemoglobin/glycolate oxidase fusion protein             264   2e-82   synthetic construct
emb|CDY40891.1|  BnaCnng09820D                                          258   2e-82   Brassica napus [oilseed rape]
ref|XP_006407074.1|  hypothetical protein EUTSA_v10020979mg             259   2e-82   
gb|EYU38211.1|  hypothetical protein MIMGU_mgv1a009683mg                258   2e-82   Erythranthe guttata [common monkey flower]
ref|XP_010487246.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    253   2e-82   Camelina sativa [gold-of-pleasure]
ref|XP_002305044.1|  hypothetical protein POPTR_0004s06400g             259   2e-82   Populus trichocarpa [western balsam poplar]
emb|CDY25424.1|  BnaC09g39390D                                          258   3e-82   Brassica napus [oilseed rape]
ref|XP_002466341.1|  hypothetical protein SORBIDRAFT_01g005960          259   3e-82   Sorghum bicolor [broomcorn]
emb|CDX82483.1|  BnaA03g33380D                                          259   3e-82   
ref|XP_006407076.1|  hypothetical protein EUTSA_v10020979mg             258   3e-82   
gb|KJB12821.1|  hypothetical protein B456_002G037900                    254   3e-82   Gossypium raimondii
emb|CDY35618.1|  BnaC01g21400D                                          258   4e-82   Brassica napus [oilseed rape]
gb|KJB12823.1|  hypothetical protein B456_002G038000                    258   5e-82   Gossypium raimondii
ref|XP_010941150.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    256   6e-82   
emb|CDX98453.1|  BnaC05g39220D                                          258   7e-82   
ref|XP_006650695.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    259   7e-82   Oryza brachyantha
ref|XP_002277249.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    258   8e-82   Vitis vinifera
ref|XP_010941135.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    258   9e-82   Elaeis guineensis
ref|NP_001078406.1|  glycolate oxidase                                  256   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|AEZ52381.1|  glycolate oxidase                                       257   2e-81   Wolffia australiana
ref|XP_010907304.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    257   2e-81   Elaeis guineensis
gb|AAO17067.1|  glycolate oxidase                                       257   2e-81   Zantedeschia aethiopica [arum-lily]
ref|XP_006657453.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    257   2e-81   Oryza brachyantha
ref|NP_188060.1|  peroxisomal (S)-2-hydroxy-acid oxidase GLO1           257   2e-81   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850585.2|  peroxisomal (S)-2-hydroxy-acid oxidase GLO1           257   2e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116892.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    256   2e-81   Brassica rapa
ref|XP_010501892.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    257   2e-81   Camelina sativa [gold-of-pleasure]
emb|CDY33221.1|  BnaC01g36940D                                          256   3e-81   Brassica napus [oilseed rape]
emb|CDX75771.1|  BnaC03g38540D                                          256   3e-81   
gb|AAV28535.1|  glycolate oxidase                                       256   3e-81   Brassica napus [oilseed rape]
emb|CDY39114.1|  BnaA01g29420D                                          256   3e-81   Brassica napus [oilseed rape]
emb|CDX82484.1|  BnaA03g33370D                                          256   3e-81   
ref|XP_009135382.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    256   4e-81   Brassica rapa
ref|XP_006283965.1|  hypothetical protein CARUB_v10005088mg             256   4e-81   Capsella rubella
ref|XP_009116903.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    256   5e-81   Brassica rapa
gb|ACJ84628.1|  unknown                                                 249   5e-81   Medicago truncatula
ref|XP_006407078.1|  hypothetical protein EUTSA_v10020982mg             256   5e-81   Eutrema salsugineum [saltwater cress]
gb|AAT08654.1|  glycolate oxidase                                       252   6e-81   Hyacinthus orientalis [common hyacinth]
gb|EEE66581.1|  hypothetical protein OsJ_23125                          256   6e-81   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058909.1|  Os07g0152900                                       256   6e-81   
ref|NP_193570.1|  glycolate oxidase                                     256   6e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146367.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    255   7e-81   Brassica rapa
gb|KJB12822.1|  hypothetical protein B456_002G037900                    254   8e-81   Gossypium raimondii
ref|XP_010439866.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    255   8e-81   Camelina sativa [gold-of-pleasure]
gb|ACD93720.1|  glycolate oxidase                                       255   8e-81   Mikania micrantha [bittervine]
gb|AAL16258.1|AF428328_1  AT3g14420/MOA2_2                              255   9e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297957.1|  hypothetical protein CARUB_v10013998mg             255   9e-81   Capsella rubella
gb|KCW67670.1|  hypothetical protein EUGRSUZ_F01413                     254   1e-80   Eucalyptus grandis [rose gum]
tpg|DAA59561.1|  TPA: hypothetical protein ZEAMMB73_759880              258   1e-80   
gb|AFV28786.1|  glycolate oxidase                                       254   1e-80   Gossypium hirsutum [American cotton]
gb|KJB12820.1|  hypothetical protein B456_002G037900                    254   2e-80   Gossypium raimondii
gb|KHG12854.1|  Peroxisomal (S)-2-hydroxy-acid oxidase                  254   2e-80   Gossypium arboreum [tree cotton]
ref|XP_009136924.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    254   2e-80   Brassica rapa
ref|XP_010465336.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    254   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006297960.1|  hypothetical protein CARUB_v10014001mg             254   2e-80   Capsella rubella
gb|KHG22455.1|  Peroxisomal (S)-2-hydroxy-acid oxidase                  254   2e-80   Gossypium arboreum [tree cotton]
ref|XP_010060801.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    254   2e-80   Eucalyptus grandis [rose gum]
ref|NP_188059.1|  peroxisomal (S)-2-hydroxy-acid oxidase GLO2           254   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004955475.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    256   2e-80   Setaria italica
emb|CDY55631.1|  BnaA03g58240D                                          254   2e-80   Brassica napus [oilseed rape]
ref|NP_001189891.1|  peroxisomal (S)-2-hydroxy-acid oxidase GLO2        254   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248224.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    254   3e-80   
ref|XP_003531157.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    254   3e-80   
gb|KDO78207.1|  hypothetical protein CISIN_1g015722mg                   250   3e-80   Citrus sinensis [apfelsine]
ref|XP_002960597.1|  hypothetical protein SELMODRAFT_266585             254   4e-80   Selaginella moellendorffii
ref|XP_006414116.1|  hypothetical protein EUTSA_v10025514mg             253   5e-80   Eutrema salsugineum [saltwater cress]
ref|XP_010517549.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    253   5e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010501901.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    253   6e-80   Camelina sativa [gold-of-pleasure]
emb|CDY01535.1|  BnaC07g35250D                                          253   6e-80   
ref|XP_010434548.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    253   7e-80   Camelina sativa [gold-of-pleasure]
ref|XP_002868001.1|  hypothetical protein ARALYDRAFT_914854             253   8e-80   Arabidopsis lyrata subsp. lyrata
ref|XP_006356963.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    253   9e-80   Solanum tuberosum [potatoes]
gb|AFK44395.1|  unknown                                                 246   1e-79   Medicago truncatula
ref|XP_006467448.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    252   1e-79   Citrus sinensis [apfelsine]
ref|XP_006449714.1|  hypothetical protein CICLE_v10015533mg             252   1e-79   Citrus clementina [clementine]
ref|XP_006836442.1|  hypothetical protein AMTR_s00092p00167960          252   2e-79   Amborella trichopoda
pir||T10242  (S)-2-hydroxy-acid oxidase (EC 1.1.3.15) - cucurbit        252   2e-79
ref|XP_006449713.1|  hypothetical protein CICLE_v10015533mg             252   2e-79   
ref|XP_003558107.2|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    260   3e-79   
ref|XP_009405361.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    251   3e-79   
ref|XP_009628914.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    251   4e-79   Nicotiana tomentosiformis
ref|XP_009791622.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    251   4e-79   Nicotiana sylvestris
ref|XP_006584583.1|  PREDICTED: uncharacterized protein LOC100800...    251   4e-79   
gb|AFK34700.1|  unknown                                                 250   8e-79   Lotus japonicus
ref|XP_007211466.1|  hypothetical protein PRUPE_ppa007462mg             250   9e-79   Prunus persica
ref|XP_003531156.2|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    250   1e-78   Glycine max [soybeans]
gb|ABK21603.1|  unknown                                                 245   1e-78   Picea sitchensis
gb|KDO78204.1|  hypothetical protein CISIN_1g015722mg                   249   2e-78   Citrus sinensis [apfelsine]
ref|XP_009791623.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    249   2e-78   Nicotiana sylvestris
gb|EMS55513.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO1             249   2e-78   Triticum urartu
ref|XP_011096586.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    249   2e-78   Sesamum indicum [beniseed]
ref|XP_011035452.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    249   3e-78   Populus euphratica
ref|XP_007158768.1|  hypothetical protein PHAVU_002G180300g             248   4e-78   Phaseolus vulgaris [French bean]
dbj|BAK04551.1|  predicted protein                                      248   5e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011035451.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    249   5e-78   Populus euphratica
gb|KHN12456.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO5             248   5e-78   Glycine soja [wild soybean]
gb|KDO78203.1|  hypothetical protein CISIN_1g015722mg                   249   6e-78   Citrus sinensis [apfelsine]
ref|XP_010056899.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    248   8e-78   Eucalyptus grandis [rose gum]
gb|ABR17627.1|  unknown                                                 247   1e-77   Picea sitchensis
gb|ABK25472.1|  unknown                                                 247   2e-77   Picea sitchensis
ref|XP_009360901.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    247   2e-77   
ref|XP_001754192.1|  predicted protein                                  246   2e-77   
ref|XP_004244966.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    247   2e-77   Solanum lycopersicum
ref|XP_010538538.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    246   4e-77   Tarenaya hassleriana [spider flower]
ref|XP_001769086.1|  predicted protein                                  246   4e-77   
ref|XP_004504562.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    245   8e-77   Cicer arietinum [garbanzo]
gb|EPS70695.1|  glycolate oxidase                                       244   1e-76   Genlisea aurea
ref|XP_008225499.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    244   1e-76   Prunus mume [ume]
ref|XP_008371612.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    244   2e-76   Malus domestica [apple tree]
gb|KJB34952.1|  hypothetical protein B456_006G092300                    244   3e-76   Gossypium raimondii
ref|XP_008371766.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    243   3e-76   
gb|KHN46072.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO5             243   4e-76   Glycine soja [wild soybean]
ref|NP_001242385.1|  uncharacterized protein LOC100782977               243   4e-76   Glycine max [soybeans]
ref|XP_006579405.1|  PREDICTED: uncharacterized protein LOC100782...    243   4e-76   Glycine max [soybeans]
ref|XP_010666716.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    243   6e-76   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX78843.1|  BnaA01g09100D                                          242   1e-75   
ref|XP_011460209.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    242   1e-75   Fragaria vesca subsp. vesca
ref|XP_001758665.1|  predicted protein                                  241   3e-75   
ref|XP_004976858.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    241   3e-75   Setaria italica
ref|XP_009146514.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    242   7e-75   
ref|XP_011082837.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    239   1e-74   
ref|XP_003557652.2|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    246   2e-74   
gb|KHG00838.1|  Peroxisomal                                             238   3e-74   Gossypium arboreum [tree cotton]
emb|CDX97573.1|  BnaA05g25060D                                          238   4e-74   
ref|XP_006652849.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    237   8e-74   Oryza brachyantha
ref|XP_003580580.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    237   9e-74   Brachypodium distachyon [annual false brome]
ref|XP_002447118.1|  hypothetical protein SORBIDRAFT_06g028990          237   1e-73   
dbj|BAG87371.1|  unnamed protein product                                236   1e-73   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053925.1|  Os04g0623500                                       236   2e-73   
gb|ACN25627.1|  unknown                                                 236   2e-73   Zea mays [maize]
tpg|DAA35953.1|  TPA: hypothetical protein ZEAMMB73_047023              235   4e-73   
tpg|DAA35954.1|  TPA: hypothetical protein ZEAMMB73_047023              236   5e-73   
dbj|BAJ94716.1|  predicted protein                                      235   7e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT00832.1|  Peroxisomal (S)-2-hydroxy-acid oxidase                  234   1e-72   
gb|KHN46073.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO1             233   5e-72   Glycine soja [wild soybean]
emb|CDX99474.1|  BnaC01g10780D                                          232   7e-72   
ref|XP_009131609.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    232   8e-72   Brassica rapa
emb|CDY25425.1|  BnaC09g39400D                                          230   4e-71   Brassica napus [oilseed rape]
emb|CDY33220.1|  BnaC01g36930D                                          230   5e-71   Brassica napus [oilseed rape]
gb|ABB02645.1|  crystallinum glycolate oxidase-like                     223   5e-71   Solanum tuberosum [potatoes]
gb|AAB82143.1|  glycolate oxidase                                       230   6e-71   Oryza sativa Indica Group [Indian rice]
gb|AFK45327.1|  unknown                                                 221   5e-70   Medicago truncatula
ref|XP_008779285.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    221   8e-70   
ref|NP_001030694.1|  peroxisomal (S)-2-hydroxy-acid oxidase GLO1        226   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KHG25666.1|  Peroxisomal (S)-2-hydroxy-acid oxidase                  226   1e-69   Gossypium arboreum [tree cotton]
gb|KHG25665.1|  Peroxisomal (S)-2-hydroxy-acid oxidase                  226   1e-69   Gossypium arboreum [tree cotton]
ref|XP_004504561.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    224   2e-68   Cicer arietinum [garbanzo]
ref|NP_001241915.1|  uncharacterized protein LOC100800520               222   3e-68   
ref|XP_006585086.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    218   3e-67   
emb|CDX98451.1|  BnaC05g39240D                                          216   2e-66   
ref|XP_008668180.1|  PREDICTED: hydroxyacid oxidase 1 isoform X4        218   3e-66   Zea mays [maize]
gb|EYU33378.1|  hypothetical protein MIMGU_mgv1a009261mg                217   3e-66   Erythranthe guttata [common monkey flower]
ref|XP_008668177.1|  PREDICTED: hydroxyacid oxidase 1 isoform X3        218   3e-66   Zea mays [maize]
ref|XP_008668179.1|  PREDICTED: hydroxyacid oxidase 1 isoform X1        218   4e-66   Zea mays [maize]
ref|XP_008668174.1|  PREDICTED: hydroxyacid oxidase 1 isoform X2        218   4e-66   Zea mays [maize]
ref|XP_002447119.1|  hypothetical protein SORBIDRAFT_06g029000          216   1e-65   
ref|NP_001152347.1|  hydroxyacid oxidase 1                              214   6e-65   Zea mays [maize]
emb|CAH66797.1|  H0215F08.8                                             211   7e-65   Oryza sativa [red rice]
gb|KHG00837.1|  Peroxisomal                                             213   8e-64   Gossypium arboreum [tree cotton]
ref|XP_004976860.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    209   5e-63   Setaria italica
ref|XP_004976861.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    209   6e-63   Setaria italica
gb|KHN12455.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO5             206   2e-62   Glycine soja [wild soybean]
emb|CAE03501.2|  OSJNBa0053K19.9                                        204   4e-62   Oryza sativa Japonica Group [Japonica rice]
gb|KDO50497.1|  hypothetical protein CISIN_1g017492mg                   205   1e-61   Citrus sinensis [apfelsine]
sp|Q01KC2.2|GLO2_ORYSI  RecName: Full=Peroxisomal (S)-2-hydroxy-a...    204   6e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_001768460.1|  predicted protein                                  201   7e-60   
gb|AEP95753.1|  glycolate oxidase                                       189   2e-56   Cicer arietinum [garbanzo]
gb|KHN12454.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO1             187   9e-55   Glycine soja [wild soybean]
dbj|BAG09385.1|  peroxisomal glycolate oxidase                          179   1e-53   Glycine max [soybeans]
ref|XP_010465295.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    183   5e-53   Camelina sativa [gold-of-pleasure]
gb|EMS58206.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO5             182   6e-53   Triticum urartu
ref|XP_010501638.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    182   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008362344.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    182   1e-52   
gb|KFK38770.1|  hypothetical protein AALP_AA3G158200                    177   2e-52   Arabis alpina [alpine rockcress]
ref|XP_009378364.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    182   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_007149226.1|  hypothetical protein PHAVU_005G052100g             174   2e-52   Phaseolus vulgaris [French bean]
ref|XP_009336687.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    182   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_009117166.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    174   3e-52   Brassica rapa
ref|XP_002529194.1|  (S)-2-hydroxy-acid oxidase, putative               181   3e-52   
ref|XP_002270074.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    181   4e-52   Vitis vinifera
ref|XP_010655679.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    181   4e-52   
emb|CAN60339.1|  hypothetical protein VITISV_031318                     181   4e-52   Vitis vinifera
ref|XP_002270101.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    181   4e-52   Vitis vinifera
ref|XP_006299043.1|  hypothetical protein CARUB_v10015180mg             181   5e-52   Capsella rubella
ref|XP_009354833.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    181   5e-52   Pyrus x bretschneideri [bai li]
ref|XP_004303718.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    181   6e-52   Fragaria vesca subsp. vesca
ref|XP_008342429.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    180   8e-52   
ref|XP_006407121.1|  hypothetical protein EUTSA_v10020996mg             178   9e-52   
ref|XP_010542341.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    180   9e-52   
emb|CDY39100.1|  BnaA01g29560D                                          180   1e-51   Brassica napus [oilseed rape]
ref|XP_010694576.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    180   1e-51   
emb|CAN60338.1|  hypothetical protein VITISV_031317                     180   1e-51   
gb|KDP40668.1|  hypothetical protein JCGZ_24667                         180   1e-51   
gb|KCW67671.1|  hypothetical protein EUGRSUZ_F01413                     179   1e-51   
gb|KCW68886.1|  hypothetical protein EUGRSUZ_F02472                     178   2e-51   
ref|XP_008380775.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    179   2e-51   
ref|XP_010061851.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    179   2e-51   
ref|XP_009117162.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    179   2e-51   
gb|KCW68884.1|  hypothetical protein EUGRSUZ_F02471                     179   4e-51   
ref|XP_011460738.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    178   4e-51   
ref|XP_009117145.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    179   4e-51   
emb|CDY33247.1|  BnaC01g37200D                                          178   5e-51   
ref|XP_010061852.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    178   6e-51   
ref|XP_010110944.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO1        177   7e-51   
ref|XP_010644817.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    178   7e-51   
ref|XP_010244727.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    178   8e-51   
ref|XP_004134579.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...    180   8e-51   
ref|XP_006407122.1|  hypothetical protein EUTSA_v10020996mg             177   9e-51   
ref|XP_002885014.1|  hypothetical protein ARALYDRAFT_478828             177   1e-50   
ref|XP_006407075.1|  hypothetical protein EUTSA_v10020979mg             176   1e-50   
ref|XP_010487199.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    177   2e-50   
ref|NP_188029.1|  Aldolase-type TIM barrel family protein               176   3e-50   
ref|XP_004235559.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    176   3e-50   
emb|CDX75747.1|  BnaC03g38300D                                          176   3e-50   
gb|KDO36501.1|  hypothetical protein CISIN_1g024846mg                   171   5e-50   
ref|NP_001078154.1|  peroxisomal (S)-2-hydroxy-acid oxidase GLO1        175   6e-50   
ref|XP_007024700.1|  Aldolase-type TIM barrel family protein            175   7e-50   
gb|AAM61594.1|  glycolate oxidase, putative                             175   7e-50   
ref|XP_010465339.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    175   1e-49   
ref|XP_010487248.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    175   1e-49   
ref|XP_010501894.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    174   1e-49   
ref|XP_007215577.1|  hypothetical protein PRUPE_ppa007512mg             174   1e-49   
ref|NP_001078155.1|  peroxisomal (S)-2-hydroxy-acid oxidase GLO1        174   2e-49   
ref|XP_007215578.1|  hypothetical protein PRUPE_ppa007512mg             174   2e-49   
ref|XP_008228157.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    174   2e-49   
ref|XP_002529188.1|  (S)-2-hydroxy-acid oxidase, putative               174   2e-49   
ref|XP_009135383.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    174   2e-49   
ref|XP_005538305.1|  glycolate oxidase, peroxysomal                     174   3e-49   
gb|KDO36498.1|  hypothetical protein CISIN_1g024846mg                   170   4e-49   
emb|CBL95266.1|  glycerate oxidase                                      173   4e-49   
ref|XP_006342937.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    173   4e-49   
ref|XP_008800459.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    173   5e-49   
gb|KHG05076.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 -like...    173   5e-49   
ref|XP_009116911.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    173   5e-49   
ref|NP_188031.1|  Aldolase-type TIM barrel family protein               173   5e-49   
gb|KJB66829.1|  hypothetical protein B456_010G174000                    169   5e-49   
gb|KDO36497.1|  hypothetical protein CISIN_1g024846mg                   170   6e-49   
ref|XP_009146369.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    172   8e-49   
ref|XP_010910946.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    172   8e-49   
ref|XP_010465337.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    172   8e-49   
ref|XP_010939865.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    172   8e-49   
ref|XP_005703045.1|  (S)-2-hydroxy-acid oxidase                         173   1e-48   
gb|EEE67592.1|  hypothetical protein OsJ_25131                          171   1e-48   
ref|XP_002960171.1|  hypothetical protein SELMODRAFT_402239             172   2e-48   
gb|KJB70173.1|  hypothetical protein B456_011G062200                    172   2e-48   
ref|XP_010552249.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    171   2e-48   
gb|KJB66831.1|  hypothetical protein B456_010G174000                    168   2e-48   
ref|XP_010465334.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    171   2e-48   
gb|EEC82445.1|  hypothetical protein OsI_26871                          171   3e-48   
ref|NP_001060276.1|  Os07g0616500                                       171   3e-48   
ref|XP_007024701.1|  Aldolase-type TIM barrel family protein isof...    171   3e-48   
gb|KJB66835.1|  hypothetical protein B456_010G174000                    168   3e-48   
sp|B8B8K5.2|GLO4_ORYSI  RecName: Full=Peroxisomal (S)-2-hydroxy-a...    171   3e-48   
ref|XP_002983964.1|  hypothetical protein SELMODRAFT_119126             171   3e-48   
ref|XP_009595001.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    171   3e-48   
ref|XP_004303716.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    171   3e-48   
ref|XP_004958307.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    171   4e-48   
ref|XP_006843889.1|  hypothetical protein AMTR_s00007p00266650          169   4e-48   
ref|XP_009804446.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    171   5e-48   
gb|EWM30206.1|  peroxisomal glycolate oxidase                           171   5e-48   
ref|XP_006426722.1|  hypothetical protein CICLE_v10025921mg             171   5e-48   
ref|XP_007903670.1|  PREDICTED: hydroxyacid oxidase 1                   171   6e-48   
ref|XP_010274131.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    166   6e-48   
emb|CDX82499.1|  BnaA03g33220D                                          170   6e-48   
gb|KJB66828.1|  hypothetical protein B456_010G174000                    168   7e-48   
dbj|BAB02979.1|  glycolate oxidase                                      170   9e-48   
ref|XP_011072615.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    170   9e-48   
ref|XP_002304232.2|  (S)-2-hydroxy-acid oxidase family protein          169   1e-47   
ref|XP_002304231.2|  (S)-2-hydroxy-acid oxidase family protein          169   1e-47   
ref|XP_002529193.1|  (S)-2-hydroxy-acid oxidase, putative               169   2e-47   
gb|AAM67194.1|  glycolate oxidase, putative                             169   2e-47   
gb|AEP95752.1|  glycolate oxidase                                       165   2e-47   
ref|XP_006426726.1|  hypothetical protein CICLE_v10025729mg             168   3e-47   
ref|NP_001131708.1|  hypothetical protein                               165   4e-47   
ref|XP_010534951.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    169   4e-47   
ref|XP_010534950.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    169   4e-47   
ref|XP_006342936.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    168   4e-47   
ref|XP_006426743.1|  hypothetical protein CICLE_v10025922mg             168   5e-47   
emb|CDY52266.1|  BnaC05g52100D                                          168   6e-47   
ref|XP_009135360.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    168   6e-47   
ref|XP_009135361.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    167   6e-47   
gb|KHG20547.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 -like...    167   7e-47   
ref|XP_008371768.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    167   7e-47   
ref|XP_009336737.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    160   1e-46   
ref|NP_001120470.1|  hydroxyacid oxidase (glycolate oxidase) 1          162   1e-46   
ref|XP_006467449.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    166   2e-46   
ref|XP_010273879.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    166   2e-46   
ref|XP_009804445.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    166   2e-46   
tpg|DAA41448.1|  TPA: LOW QUALITY PROTEIN: hypothetical protein Z...    166   3e-46   
ref|XP_011036482.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    166   3e-46   
ref|XP_010704890.1|  PREDICTED: hydroxyacid oxidase 1-like              162   4e-46   
ref|XP_008371614.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    165   5e-46   
ref|XP_011072614.1|  PREDICTED: uncharacterized protein LOC105157...    170   5e-46   
emb|CDO97821.1|  unnamed protein product                                165   5e-46   
ref|XP_008460443.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    164   5e-46   
gb|EMT00619.1|  Putative peroxisomal (S)-2-hydroxy-acid oxidase 1       170   6e-46   
ref|XP_008498777.1|  PREDICTED: hydroxyacid oxidase 1                   165   7e-46   
ref|XP_011072613.1|  PREDICTED: uncharacterized protein LOC105157...    170   7e-46   
ref|XP_011072612.1|  PREDICTED: uncharacterized protein LOC105157...    170   8e-46   
ref|XP_005708359.1|  (S)-2-hydroxy-acid oxidase                         165   8e-46   
ref|XP_002461016.1|  hypothetical protein SORBIDRAFT_02g039240          164   9e-46   
ref|XP_011072611.1|  PREDICTED: uncharacterized protein LOC105157...    170   9e-46   
emb|CDY52265.1|  BnaC05g52090D                                          164   1e-45   
gb|KFP06070.1|  Hydroxyacid oxidase 1                                   164   1e-45   
ref|XP_009390878.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    164   1e-45   
ref|XP_009146409.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    164   1e-45   
ref|XP_009146410.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    164   1e-45   
ref|XP_004235561.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    164   1e-45   
ref|XP_010318479.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    164   2e-45   
ref|XP_009072571.1|  PREDICTED: hydroxyacid oxidase 1                   158   3e-45   
ref|XP_005708266.1|  (S)-2-hydroxy-acid oxidase                         164   3e-45   
ref|XP_010685269.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    163   3e-45   
ref|XP_010153041.1|  PREDICTED: hydroxyacid oxidase 1                   158   3e-45   
gb|ACN35437.1|  unknown                                                 157   4e-45   
ref|XP_004958312.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    163   4e-45   
ref|XP_002304230.2|  (S)-2-hydroxy-acid oxidase family protein          162   5e-45   
ref|XP_011036479.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    162   5e-45   
ref|XP_009336739.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    155   7e-45   
ref|NP_001186371.2|  hydroxyacid oxidase 1                              162   7e-45   
gb|KJB67083.1|  hypothetical protein B456_010G173900                    157   8e-45   
ref|XP_006657955.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...    162   1e-44   
ref|XP_007257507.1|  PREDICTED: hydroxyacid oxidase 1 isoform X1        161   2e-44   
ref|XP_010115156.1|  PREDICTED: hydroxyacid oxidase 1                   161   2e-44   
gb|EFA76141.1|  hydroxyacid oxidase                                     161   2e-44   
ref|XP_010111981.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO4        159   2e-44   
gb|KCW73815.1|  hypothetical protein EUGRSUZ_E02418                     160   2e-44   
ref|XP_010056904.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    161   2e-44   
ref|XP_004144436.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    160   3e-44   
gb|KJB70180.1|  hypothetical protein B456_011G062400                    159   3e-44   
emb|CDX97546.1|  BnaA05g25330D                                          164   4e-44   
ref|XP_010401324.1|  PREDICTED: hydroxyacid oxidase 1                   160   5e-44   
ref|XP_009291053.1|  PREDICTED: hydroxyacid oxidase 1 isoform X1        159   5e-44   
gb|KJB66836.1|  hypothetical protein B456_010G174000                    158   5e-44   
ref|XP_010014120.1|  PREDICTED: hydroxyacid oxidase 1                   160   7e-44   
ref|XP_010217239.1|  PREDICTED: hydroxyacid oxidase 1                   160   7e-44   
gb|KJB70181.1|  hypothetical protein B456_011G062400                    160   9e-44   
ref|XP_004165161.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    155   9e-44   
ref|XP_010080298.1|  PREDICTED: hydroxyacid oxidase 1                   159   1e-43   
gb|KJB70176.1|  hypothetical protein B456_011G062400                    159   1e-43   
ref|XP_005010879.1|  PREDICTED: hydroxyacid oxidase 1                   159   1e-43   
gb|KFV14047.1|  Hydroxyacid oxidase 1                                   158   1e-43   
gb|KGL80232.1|  Hydroxyacid oxidase 1                                   158   1e-43   
gb|KFP40268.1|  Hydroxyacid oxidase 1                                   158   1e-43   
ref|XP_007024703.1|  Aldolase-type TIM barrel family protein            165   1e-43   
ref|XP_005042692.1|  PREDICTED: hydroxyacid oxidase 1                   159   1e-43   
ref|NP_001077011.1|  hydroxyacid oxidase 1                              159   1e-43   
ref|XP_009704254.1|  PREDICTED: hydroxyacid oxidase 1                   159   2e-43   
ref|XP_009091955.1|  PREDICTED: hydroxyacid oxidase 1                   159   2e-43   
gb|AAI46640.1|  LOC100101335 protein                                    159   2e-43   
ref|XP_009989590.1|  PREDICTED: hydroxyacid oxidase 1                   158   2e-43   
tpg|DAA35946.1|  TPA: hypothetical protein ZEAMMB73_697207              154   2e-43   
gb|KFP67874.1|  Hydroxyacid oxidase 1                                   158   3e-43   
ref|XP_010005420.1|  PREDICTED: hydroxyacid oxidase 1                   158   3e-43   
ref|XP_004350463.1|  hydroxyacid oxidase                                159   3e-43   
ref|XP_002199246.1|  PREDICTED: hydroxyacid oxidase 1                   158   3e-43   
ref|XP_005525502.1|  PREDICTED: hydroxyacid oxidase 1                   158   3e-43   
gb|KFU84799.1|  Hydroxyacid oxidase 1                                   157   3e-43   
ref|XP_009474433.1|  PREDICTED: hydroxyacid oxidase 1                   158   3e-43   
gb|KFP90095.1|  Hydroxyacid oxidase 1                                   157   4e-43   
ref|XP_009814439.1|  PREDICTED: hydroxyacid oxidase 1                   158   4e-43   
gb|KFQ84957.1|  Hydroxyacid oxidase 1                                   157   4e-43   
ref|XP_007670288.1|  PREDICTED: hydroxyacid oxidase 1                   157   4e-43   
ref|XP_799303.3|  PREDICTED: hydroxyacid oxidase 1-like                 157   4e-43   
ref|XP_009949274.1|  PREDICTED: hydroxyacid oxidase 1                   157   4e-43   
gb|KHG17648.1|  Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 -like...    157   5e-43   
ref|XP_009870091.1|  PREDICTED: hydroxyacid oxidase 1                   157   5e-43   
gb|KFQ92348.1|  Hydroxyacid oxidase 1                                   157   5e-43   
ref|XP_004276504.1|  PREDICTED: hydroxyacid oxidase 1                   157   6e-43   
gb|KFV56997.1|  Hydroxyacid oxidase 1                                   156   6e-43   
ref|XP_008460328.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    157   6e-43   
gb|AHG88755.1|  FMN-dependent alpha-hydroxy acid dehydrogenase          157   6e-43   
ref|XP_009554779.1|  PREDICTED: hydroxyacid oxidase 1                   157   6e-43   
ref|XP_005238648.1|  PREDICTED: hydroxyacid oxidase 1                   157   7e-43   
ref|XP_003562656.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    157   8e-43   
ref|XP_007121210.1|  PREDICTED: hydroxyacid oxidase 1-like              154   8e-43   
gb|KFQ11139.1|  Hydroxyacid oxidase 1                                   156   8e-43   
ref|XP_007165299.1|  PREDICTED: hydroxyacid oxidase 1                   157   8e-43   
gb|KFO72930.1|  Hydroxyacid oxidase 1                                   156   1e-42   
emb|CDQ59733.1|  unnamed protein product                                157   1e-42   
ref|XP_010208662.1|  PREDICTED: hydroxyacid oxidase 1                   156   1e-42   
ref|XP_009317853.1|  PREDICTED: hydroxyacid oxidase 1                   156   1e-42   
ref|XP_004144438.1|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    156   1e-42   
ref|XP_009586068.1|  PREDICTED: hydroxyacid oxidase 1                   156   1e-42   
gb|KJB66830.1|  hypothetical protein B456_010G174000                    150   1e-42   
ref|XP_009280795.1|  PREDICTED: hydroxyacid oxidase 1                   156   1e-42   
gb|KFV99141.1|  Hydroxyacid oxidase 1                                   155   2e-42   
gb|KFP58733.1|  Hydroxyacid oxidase 1                                   156   2e-42   
gb|KFW64004.1|  Hydroxyacid oxidase 1                                   155   2e-42   
ref|XP_009884332.1|  PREDICTED: hydroxyacid oxidase 1                   156   2e-42   
gb|KFM09696.1|  Hydroxyacid oxidase 1                                   155   2e-42   
gb|KFP28755.1|  Hydroxyacid oxidase 1                                   155   2e-42   
gb|ACO09477.1|  Hydroxyacid oxidase 1                                   156   2e-42   
ref|XP_010129279.1|  PREDICTED: hydroxyacid oxidase 1                   155   2e-42   
pdb|2CDH|0  Chain 0, Architecture Of The Thermomyces Lanuginosus ...    152   2e-42   
ref|XP_009499080.1|  PREDICTED: hydroxyacid oxidase 1                   155   2e-42   
ref|XP_009934266.1|  PREDICTED: hydroxyacid oxidase 1                   155   3e-42   
ref|XP_009639850.1|  PREDICTED: hydroxyacid oxidase 1                   155   3e-42   
ref|XP_009485408.1|  PREDICTED: hydroxyacid oxidase 1                   155   3e-42   
gb|KGL94154.1|  Hydroxyacid oxidase 1                                   154   3e-42   
ref|XP_005515214.1|  PREDICTED: hydroxyacid oxidase 1 isoform X1        155   3e-42   
ref|XP_007464246.1|  PREDICTED: hydroxyacid oxidase 1                   155   3e-42   
ref|XP_008114455.1|  PREDICTED: hydroxyacid oxidase 1 isoform X2        154   4e-42   
ref|XP_006813604.1|  PREDICTED: hydroxyacid oxidase 1-like              155   4e-42   
ref|XP_009915451.1|  PREDICTED: hydroxyacid oxidase 1                   155   4e-42   
gb|KFW73970.1|  Hydroxyacid oxidase 1                                   154   5e-42   
gb|KFP18287.1|  Hydroxyacid oxidase 1                                   154   5e-42   
gb|KFR11778.1|  Hydroxyacid oxidase 1                                   154   5e-42   
ref|XP_006053631.1|  PREDICTED: hydroxyacid oxidase 1-like isofor...    155   5e-42   
ref|XP_006053632.1|  PREDICTED: hydroxyacid oxidase 1-like isofor...    155   5e-42   
ref|XP_006015504.1|  PREDICTED: hydroxyacid oxidase 1                   155   6e-42   
ref|XP_006625995.1|  PREDICTED: hydroxyacid oxidase 1-like              154   6e-42   



>gb|AFK40653.1| unknown [Medicago truncatula]
Length=186

 Score =   270 bits (689),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITN+ EYE IA++KLPKMAFDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNISEYEEIARQKLPKMAFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            +STTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   LSTTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|AAC33509.1| glycolate oxidase, partial [Nicotiana tabacum]
Length=217

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M E+TNVMEYEAIAKKKLPKM FDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSK+D
Sbjct  1    MEEVTNVMEYEAIAKKKLPKMVFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKMD  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MSTTV+GFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MSTTVVGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|KDO50499.1| hypothetical protein CISIN_1g017492mg [Citrus sinensis]
Length=234

 Score =   270 bits (691),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSW+TSSVEEVAST
Sbjct  61   MNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|ACJ85002.1| unknown [Medicago truncatula]
Length=224

 Score =   270 bits (689),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITN+ EYE IA++KLPKMAFDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNISEYEEIARQKLPKMAFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            +STTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   LSTTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>ref|XP_009615478.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like [Nicotiana 
tomentosiformis]
 ref|XP_009799036.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like [Nicotiana 
sylvestris]
 gb|ADM26718.1| glycolate oxidase [Nicotiana benthamiana]
Length=371

 Score =   273 bits (699),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/146 (97%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M E+TNVMEYEAIAKKKLPKM FDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID
Sbjct  1    MEEVTNVMEYEAIAKKKLPKMVFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MSTTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MSTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|KDO50498.1| hypothetical protein CISIN_1g017492mg [Citrus sinensis]
Length=323

 Score =   272 bits (695),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSW+TSSVEEVAST
Sbjct  61   MNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>ref|XP_009619055.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Nicotiana 
tomentosiformis]
 ref|XP_009619056.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Nicotiana 
tomentosiformis]
Length=371

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/146 (97%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEYE IAK+KLPKM FDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYEEIAKQKLPKMVFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            +STTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   LSTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>ref|XP_006442234.1| hypothetical protein CICLE_v10020692mg [Citrus clementina]
 ref|XP_006477967.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Citrus 
sinensis]
 gb|ESR55474.1| hypothetical protein CICLE_v10020692mg [Citrus clementina]
Length=370

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/146 (97%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MSTTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSW+TSSVEEVAST
Sbjct  61   MSTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>ref|XP_009783958.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Nicotiana 
sylvestris]
Length=371

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGE+TNVMEYE IAK+KLPKM FDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEVTNVMEYEEIAKQKLPKMVFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            +STTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   LSTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|KDO50496.1| hypothetical protein CISIN_1g017492mg [Citrus sinensis]
Length=349

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSW+TSSVEEVAST
Sbjct  61   MNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|KDO50495.1| hypothetical protein CISIN_1g017492mg [Citrus sinensis]
Length=354

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSW+TSSVEEVAST
Sbjct  61   MNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|KDO50494.1| hypothetical protein CISIN_1g017492mg [Citrus sinensis]
Length=367

 Score =   271 bits (693),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSW+TSSVEEVAST
Sbjct  61   MNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|KDO50493.1| hypothetical protein CISIN_1g017492mg [Citrus sinensis]
Length=366

 Score =   271 bits (693),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSW+TSSVEEVAST
Sbjct  61   MNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|KDO50492.1| hypothetical protein CISIN_1g017492mg [Citrus sinensis]
Length=370

 Score =   271 bits (693),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSW+TSSVEEVAST
Sbjct  61   MNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>ref|XP_011008443.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like [Populus 
euphratica]
Length=369

 Score =   271 bits (692),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 140/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYEAIAK+KLPKM FDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVMEYEAIAKQKLPKMVFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_002317470.1| glycolate oxidase family protein [Populus trichocarpa]
 gb|ABK96554.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE98082.1| glycolate oxidase family protein [Populus trichocarpa]
Length=369

 Score =   271 bits (692),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 140/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYEAIAK+KLPKM FDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVMEYEAIAKQKLPKMVFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_011029540.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Populus euphratica]
 ref|XP_011029541.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Populus euphratica]
Length=369

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYEAIAK+KLPKM FDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVMEYEAIAKQKLPKMVFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|KEH38401.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Medicago truncatula]
Length=372

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITN+ EYE IA++KLPKMAFDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNISEYEEIARQKLPKMAFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            +STTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   LSTTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|AFK39756.1| unknown [Lotus japonicus]
Length=371

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            E+TNV EYEAIAK+KLPKMAFDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EVTNVTEYEAIAKQKLPKMAFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_006348379.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006348380.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X2 [Solanum tuberosum]
Length=371

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M E+TNV EY+ IAKKKLPKMA+DYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID
Sbjct  1    MEEVTNVTEYQEIAKKKLPKMAYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MTTTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|ACU19205.1| unknown [Glycine max]
Length=371

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 139/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKMAFDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID++
Sbjct  2    EITNVSEYEAIAKQKLPKMAFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDLT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_006596932.1| PREDICTED: peroxisomal glycolate oxidase isoform X1 [Glycine 
max]
Length=371

 Score =   268 bits (686),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 139/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKMAFDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID++
Sbjct  2    EITNVSEYEAIAKQKLPKMAFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDLT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_007149221.1| hypothetical protein PHAVU_005G051800g [Phaseolus vulgaris]
 gb|ESW21215.1| hypothetical protein PHAVU_005G051800g [Phaseolus vulgaris]
Length=371

 Score =   268 bits (685),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            E+TNV EYEAIAK+KLPKMAFDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID++
Sbjct  2    EVTNVSEYEAIAKQKLPKMAFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDIT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_004294094.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase isoform X1 
[Fragaria vesca subsp. vesca]
Length=368

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGE+TNV EYEAIAK+KLPKMA+DYYASG+EDQWTLAENRNAFS+ILFRPRILIDVS ID
Sbjct  1    MGEVTNVSEYEAIAKQKLPKMAYDYYASGSEDQWTLAENRNAFSKILFRPRILIDVSNID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MTTTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDR+VVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRHVVAQLVRRAE  146



>ref|XP_010694574.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010694575.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=370

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            E+TNV EYEAIAK+KLPKMA+DYYASGAEDQWTLAENRNAFSRILFRPRILIDV+ IDM+
Sbjct  2    EVTNVNEYEAIAKQKLPKMAYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_006370191.1| glycolate oxidase family protein [Populus trichocarpa]
 gb|ABK95141.1| unknown [Populus trichocarpa]
 gb|ERP66760.1| glycolate oxidase family protein [Populus trichocarpa]
Length=369

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_002278104.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Vitis vinifera]
 emb|CBI30923.3| unnamed protein product [Vitis vinifera]
Length=372

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/144 (97%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK KLPKMAFDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  5    EITNVTEYEAIAKAKLPKMAFDYYASGAEDQWTLRENRNAFSRILFRPRILIDVSKIDMT  64

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  65   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  124

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDR+VVAQLVRRAE
Sbjct  125  GIRFFQLYVYKDRHVVAQLVRRAE  148



>gb|AFK39624.1| unknown [Lotus japonicus]
Length=371

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            E+TNV EYEAIAK+KL KMAFDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EVTNVTEYEAIAKQKLSKMAFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>emb|CAN74334.1| hypothetical protein VITISV_021217 [Vitis vinifera]
Length=372

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/144 (97%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK KLPKMAFDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  5    EITNVTEYEAIAKAKLPKMAFDYYASGAEDQWTLRENRNAFSRILFRPRILIDVSKIDMT  64

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  65   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  124

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDR+VVAQLVRRAE
Sbjct  125  GIRFFQLYVYKDRHVVAQLVRRAE  148



>ref|XP_011098128.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Sesamum indicum]
 ref|XP_011098129.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Sesamum indicum]
Length=371

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M E+TNV EY+AIAK+KLPKM +DYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID
Sbjct  1    MAEVTNVTEYQAIAKEKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAP+A QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MTTTVLGFKISMPIMIAPSAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>ref|XP_008383001.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like [Malus 
domestica]
Length=369

 Score =   266 bits (680),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKMA+DYYASGAEDQWTLAENRNAFSRILFRPRILIDVS IDM+
Sbjct  2    EITNVSEYEAIAKEKLPKMAYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSHIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDR+VVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRHVVAQLVRRAE  145



>ref|XP_008439620.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Cucumis 
melo]
 ref|XP_008439621.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Cucumis 
melo]
Length=367

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDMS
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIDMS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_010540122.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Tarenaya 
hassleriana]
Length=369

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIA++KLPKMA+DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID+S
Sbjct  2    EITNVNEYEAIAREKLPKMAYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDIS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>emb|CDP06107.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   266 bits (679),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNV EY+AIAK+KLPKM +DYYASGAED+WTLAENRNAFSRILFRPRILIDVS+ID
Sbjct  1    MGEITNVTEYQAIAKQKLPKMVYDYYASGAEDEWTLAENRNAFSRILFRPRILIDVSRID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TT+LGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVY+DRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYRDRNVVAQLVRRAE  146



>ref|XP_004488698.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X1 [Cicer arietinum]
 ref|XP_004488699.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X2 [Cicer arietinum]
 ref|XP_004488700.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X3 [Cicer arietinum]
Length=371

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEA+AK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAVAKQKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_004243189.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Solanum 
lycopersicum]
 ref|XP_010323619.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Solanum 
lycopersicum]
 ref|XP_010323620.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Solanum 
lycopersicum]
Length=371

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M E+TNV EY+ IAKKKLPKM +DYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID
Sbjct  1    MEEVTNVTEYQEIAKKKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MTTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>ref|XP_009407720.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Musa 
acuminata subsp. malaccensis]
Length=367

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYEA+AK+KLPKM FDYYASGAEDQWTL ENR AFSRILFRPRILIDVS+IDM+
Sbjct  2    EITNVMEYEAVAKQKLPKMVFDYYASGAEDQWTLKENREAFSRILFRPRILIDVSRIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_009354832.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X1 [Pyrus x bretschneideri]
Length=369

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTLAENRNAF+RILFRPRILIDVS+IDM+
Sbjct  2    EITNVSEYEAIAKEKLPKMVYDYYASGAEDQWTLAENRNAFARILFRPRILIDVSRIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAAS AGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASXAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|ACY07928.1| glycolate oxidase [Panax ginseng]
Length=183

 Score =   259 bits (661),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            E+TNV EY+AIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EVTNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAA TIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAANTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_002862992.1| hypothetical protein ARALYDRAFT_333142 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002887734.1| hypothetical protein ARALYDRAFT_895734 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39251.1| hypothetical protein ARALYDRAFT_333142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63993.1| hypothetical protein ARALYDRAFT_895734 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVNEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|ADX97325.1| glycolate oxidase [Mangifera indica]
Length=370

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M EITNVMEYEAIAK+KLPKM FDYYASGAEDQWTL ENR AFSRILFRPRILIDVSKID
Sbjct  1    MEEITNVMEYEAIAKQKLPKMVFDYYASGAEDQWTLRENRFAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MTTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVRRAE  146



>gb|KJB57221.1| hypothetical protein B456_009G154200 [Gossypium raimondii]
 gb|KJB57222.1| hypothetical protein B456_009G154200 [Gossypium raimondii]
 gb|KJB57224.1| hypothetical protein B456_009G154200 [Gossypium raimondii]
 gb|KJB57225.1| hypothetical protein B456_009G154200 [Gossypium raimondii]
Length=367

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_010244724.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010244726.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Nelumbo nucifera]
Length=372

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDMS
Sbjct  2    EITNVMEYEAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYV KDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVNKDRNVVAQLVRRAE  145



>gb|KJB57223.1| hypothetical protein B456_009G154200 [Gossypium raimondii]
Length=371

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|KGN49406.1| hypothetical protein Csa_6G523470 [Cucumis sativus]
Length=369

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            E+TNV E+EAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDMS
Sbjct  2    EVTNVTEFEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIDMS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>tpg|DAA59562.1| TPA: hypothetical protein ZEAMMB73_759880 [Zea mays]
 tpg|DAA59563.1| TPA: hypothetical protein ZEAMMB73_759880 [Zea mays]
Length=216

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEY+AIAK+KLPKMA+DYYASGAED+WTL ENR AFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYQAIAKQKLPKMAYDYYASGAEDEWTLQENREAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIM+APTA QKMAHP+GE ATARAA+AAGTIMTLSSWATSSVEEVAST
Sbjct  61   MTTTVLGFKISMPIMVAPTAMQKMAHPDGENATARAAAAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRKVVEQLVRRAE  146



>ref|XP_010542340.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Tarenaya hassleriana]
Length=367

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVSEYEAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_006389989.1| hypothetical protein EUTSA_v10018744mg [Eutrema salsugineum]
 ref|XP_006389990.1| hypothetical protein EUTSA_v10018744mg [Eutrema salsugineum]
 gb|ESQ27275.1| hypothetical protein EUTSA_v10018744mg [Eutrema salsugineum]
 gb|ESQ27276.1| hypothetical protein EUTSA_v10018744mg [Eutrema salsugineum]
Length=369

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVNEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|KDP37990.1| hypothetical protein JCGZ_04633 [Jatropha curcas]
Length=367

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IA++KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVMEYEEIARQKLPKMVFDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            T+VLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TSVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_004170017.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Cucumis 
sativus]
Length=367

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            E+TNV E+EAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDMS
Sbjct  2    EVTNVTEFEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIDMS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_008372273.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Malus domestica]
Length=369

 Score =   264 bits (674),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTLAENRNAF+RILFRPRILIDVS+IDM+
Sbjct  2    EITNVSEYEAIAKEKLPKMVYDYYASGAEDQWTLAENRNAFARILFRPRILIDVSRIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>prf||1803516A glycolate oxidase
Length=371

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYE +AK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVSEYENVAKQKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_004981533.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Setaria italica]
Length=399

 Score =   265 bits (676),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +1

Query  49   SIKGAKMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILI  228
            S +G  MGEITNVMEY+AIAK+KLPKMA+DYYASGAED+WTL ENR AFSRILFRPRILI
Sbjct  26   SGEGGAMGEITNVMEYQAIAKQKLPKMAYDYYASGAEDEWTLNENREAFSRILFRPRILI  85

Query  229  DVSKIDMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSV  408
            DVSKIDM+T+VLGFKISMPIMIAPTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSV
Sbjct  86   DVSKIDMTTSVLGFKISMPIMIAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSV  145

Query  409  EEVASTGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            EEVASTGPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  146  EEVASTGPGIRFFQLYVYKDRKVVEQLVRRAE  177



>sp|P05414.1|GOX_SPIOL RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase; AltName: 
Full=Glycolate oxidase; Short=GOX; AltName: Full=Short chain 
alpha-hydroxy acid oxidase [Spinacia oleracea]
 gb|AAA34030.1| glycolate oxidase (EC 1.1.3.15) [Spinacia oleracea]
Length=369

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTLAENRNAFSRILFRPRILIDV+ IDM+
Sbjct  2    EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>pdb|1GOX|A Chain A, Refined Structure Of Spinach Glycolate Oxidase At 2 
Angstroms Resolution
Length=370

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTLAENRNAFSRILFRPRILIDV+ IDM+
Sbjct  3    EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMT  62

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  63   TTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  122

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  123  GIRFFQLYVYKDRNVVAQLVRRAE  146



>pdb|1AL7|A Chain A, Three-Dimensional Structures Of Glycolate Oxidase With 
Bound Active- Site Inhibitors
 pdb|1AL8|A Chain A, Three-Dimensional Structure Of Glycolate Oxidase With 
Bound Active- Site Inhibitors
Length=359

 Score =   263 bits (672),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTLAENRNAFSRILFRPRILIDV+ IDM+
Sbjct  2    EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|NP_001238412.1| peroxisomal glycolate oxidase [Glycine max]
 dbj|BAG09373.1| peroxisomal glycolate oxidase [Glycine max]
Length=371

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID++
Sbjct  2    EITNVSEYEAIAKQKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDIT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMLAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|EPS70764.1| glycolate oxidase, partial [Genlisea aurea]
Length=361

 Score =   263 bits (672),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGE+TNV EY+AIAK+KLPKM +DYYASGAED+WTLAENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEVTNVEEYQAIAKEKLPKMVYDYYASGAEDEWTLAENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MSTTVLGFKISMPIMIAP+A QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MSTTVLGFKISMPIMIAPSAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            G GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  121  GGGIRFFQLYVYKDRNVVAQLVRRAE  146



>ref|NP_001241302.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Glycine max]
 ref|XP_006584549.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Glycine max]
 dbj|BAG09382.1| peroxisomal glycolate oxidase [Glycine max]
Length=371

 Score =   263 bits (672),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID++
Sbjct  2    EITNVSEYEAIAKQKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDIT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMLAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|KHN26775.1| Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Glycine soja]
Length=371

 Score =   263 bits (672),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID++
Sbjct  2    EITNVSEYEAIAKQKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDIT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMLAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|KJB12827.1| hypothetical protein B456_002G038000 [Gossypium raimondii]
Length=234

 Score =   258 bits (660),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+ IAK+KLPKMA+DYYASGAEDQWTL ENR AF++ILFRPRILIDVSKIDM+
Sbjct  2    EITNVSEYQEIAKQKLPKMAYDYYASGAEDQWTLHENRFAFTKILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|AEX09184.1| glycolate oxidase [Gossypium hirsutum]
Length=367

 Score =   263 bits (672),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITN+ EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNITEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVE+VASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEDVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_010472054.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Camelina 
sativa]
Length=369

 Score =   263 bits (672),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVSKIDM+
Sbjct  2    EITNVNEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILLDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_010428965.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Camelina 
sativa]
Length=369

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVSKIDM+
Sbjct  2    EITNVNEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILLDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_006300515.1| hypothetical protein CARUB_v10020498mg [Capsella rubella]
 gb|EOA33413.1| hypothetical protein CARUB_v10020498mg [Capsella rubella]
Length=369

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVSKIDM+
Sbjct  2    EITNVNEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILLDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|AGV54360.1| peroxisomal glycolate oxidase [Phaseolus vulgaris]
Length=371

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            E+TNV EYEAIAK+KLPKMAFDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID++
Sbjct  2    EVTNVSEYEAIAKQKLPKMAFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDIT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRN VAQL RRAE
Sbjct  122  GIRFFQLYVYKDRNGVAQLGRRAE  145



>ref|XP_008787823.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Phoenix 
dactylifera]
Length=367

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEY+AIAK+KLPKM +DYYASGAEDQWTL ENR AFSRILFRPRILIDVS+IDM+
Sbjct  2    EITNVMEYKAIAKQKLPKMVYDYYASGAEDQWTLKENREAFSRILFRPRILIDVSRIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_009344324.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Pyrus x bretschneideri]
 ref|XP_009347986.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Pyrus x bretschneideri]
Length=369

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTLAENRNAFSRILFRPRILIDVS IDM+
Sbjct  2    EITNVSEYEAIAKEKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSHIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDR+VVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRHVVAQLVRRAE  145



>gb|AIP93617.1| GOX [Bassia scoparia]
Length=370

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTLAENRNAF+RILFRPRILIDV+ ID+S
Sbjct  2    EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFARILFRPRILIDVTNIDLS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHP+GEYATARA+SAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARASSAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>pdb|1GYL|A Chain A, Involvement Of Tyr24 And Trp108 In Substrate Binding 
And Substrate Specificity Of Glycolate Oxidase
 pdb|1GYL|B Chain B, Involvement Of Tyr24 And Trp108 In Substrate Binding 
And Substrate Specificity Of Glycolate Oxidase
Length=369

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +D+YASGAEDQWTLAENRNAFSRILFRPRILIDV+ IDM+
Sbjct  2    EITNVNEYEAIAKQKLPKMVYDFYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|KJB12828.1| hypothetical protein B456_002G038000 [Gossypium raimondii]
Length=278

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+ IAK+KLPKMA+DYYASGAEDQWTL ENR AF++ILFRPRILIDVSKIDM+
Sbjct  2    EITNVSEYQEIAKQKLPKMAYDYYASGAEDQWTLHENRFAFTKILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_002519658.1| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis]
 gb|EEF42631.1| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis]
Length=369

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IA++KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVMEYEEIARQKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            T+VLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TSVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVY+DRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYRDRNVVAQLVRRAE  145



>ref|XP_007211461.1| hypothetical protein PRUPE_ppa007390mg [Prunus persica]
 gb|EMJ12660.1| hypothetical protein PRUPE_ppa007390mg [Prunus persica]
Length=369

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM FDYYASGAEDQWTLAENRNAFS+ILFRPRILIDVS IDM+
Sbjct  2    EITNVSEYEAIAKQKLPKMVFDYYASGAEDQWTLAENRNAFSKILFRPRILIDVSHIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            G+RFFQLYVYKDR+VVAQLVRRAE
Sbjct  122  GVRFFQLYVYKDRHVVAQLVRRAE  145



>ref|XP_010110945.1| Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Morus notabilis]
 gb|EXC29331.1| Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Morus notabilis]
Length=352

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQW+L ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVSEYEAIAKQKLPKMVYDYYASGAEDQWSLQENRNAFSRILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDR+VVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRHVVAQLVRRAE  145



>gb|AAB40396.1| glycolate oxidase [Mesembryanthemum crystallinum]
Length=370

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTLAENRNAFSRILFRPRILIDV+KIDM+
Sbjct  2    EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>ref|XP_010275857.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase isoform X2 
[Nelumbo nucifera]
 ref|XP_010275858.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase isoform X2 
[Nelumbo nucifera]
Length=372

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYEAIAK+KLPKM +DYYASGAEDQWTL ENR+AFSRILFRPRILIDVSKIDMS
Sbjct  2    EITNVMEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRHAFSRILFRPRILIDVSKIDMS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLG+KI MPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGYKILMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_010275856.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase isoform X1 
[Nelumbo nucifera]
Length=379

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYEAIAK+KLPKM +DYYASGAEDQWTL ENR+AFSRILFRPRILIDVSKIDMS
Sbjct  9    EITNVMEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRHAFSRILFRPRILIDVSKIDMS  68

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLG+KI MPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  69   TTVLGYKILMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  128

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  129  GIRFFQLYVYKDRNVVAQLVRRAE  152



>ref|XP_006360019.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Solanum 
tuberosum]
Length=371

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVME+EAIAK+KLPKM +DYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEFEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            +STTVLGF ISMPIM+APTA QKMAHP+GEYA ARAASAAGTIMTLSSW TSSVEEVAST
Sbjct  61   LSTTVLGFNISMPIMVAPTAMQKMAHPDGEYAIARAASAAGTIMTLSSWGTSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG RFFQLYVYKDRNV  QLVRRAE
Sbjct  121  GPGTRFFQLYVYKDRNVTIQLVRRAE  146



>ref|XP_007022181.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007022182.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007022183.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007022184.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY13706.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY13707.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY13708.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY13709.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
Length=369

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDR+VVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRHVVAQLVRRAE  145



>ref|XP_007025049.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007025050.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007025051.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY27671.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY27672.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
 gb|EOY27673.1| Aldolase-type TIM barrel family protein isoform 1 [Theobroma 
cacao]
Length=367

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILVDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYV KDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVCKDRNVVAQLVRRAE  145



>ref|XP_004981534.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X2 [Setaria italica]
Length=368

 Score =   261 bits (667),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEY+AIAK+KLPKMA+DYYASGAED+WTL ENR AFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYQAIAKQKLPKMAYDYYASGAEDEWTLNENREAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+T+VLGFKISMPIMIAPTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MTTSVLGFKISMPIMIAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRKVVEQLVRRAE  146



>ref|XP_008226252.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Prunus 
mume]
Length=369

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM FDYYASGAEDQWTLAENRNAFS+ILFRPRILIDVS ID++
Sbjct  2    EITNVSEYEAIAKQKLPKMVFDYYASGAEDQWTLAENRNAFSKILFRPRILIDVSHIDLT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            G+RFFQLYVYKDR+VVAQLVRRAE
Sbjct  122  GVRFFQLYVYKDRHVVAQLVRRAE  145



>ref|NP_001051487.1| Os03g0786100 [Oryza sativa Japonica Group]
 sp|Q10CE4.1|GLO1_ORYSJ RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO1; AltName: 
Full=Glycolate oxidase 1; Short=GOX 1; Short=OsGLO1; 
AltName: Full=Short chain alpha-hydroxy acid oxidase GLO1 [Oryza 
sativa Japonica Group]
 sp|B8AKX6.1|GLO1_ORYSI RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO1; AltName: 
Full=Glycolate oxidase 1; Short=GOX 1; Short=OsGLO1; 
AltName: Full=Short chain alpha-hydroxy acid oxidase GLO1 [Oryza 
sativa Indica Group]
 gb|ABF99231.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13401.1| Os03g0786100 [Oryza sativa Japonica Group]
 dbj|BAG93788.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99960.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76290.1| hypothetical protein OsI_13800 [Oryza sativa Indica Group]
 gb|EEE60058.1| hypothetical protein OsJ_12861 [Oryza sativa Japonica Group]
Length=369

 Score =   261 bits (666),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEY+AIAK+KLPKM +DYYASGAED+WTL ENR AFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYQAIAKQKLPKMIYDYYASGAEDEWTLKENREAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MS TVLGFKISMPIMIAP+A QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MSATVLGFKISMPIMIAPSAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVV QLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRNVVEQLVRRAE  146



>ref|XP_010244729.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Nelumbo 
nucifera]
 ref|XP_010244730.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Nelumbo 
nucifera]
 ref|XP_010244731.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Nelumbo 
nucifera]
Length=372

 Score =   260 bits (665),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID++
Sbjct  2    EITNVMEYEAIAKQKLPKMIYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDLT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFK+SMPIMIAPTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKMSMPIMIAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYV+KDRN+VAQLVRRAE
Sbjct  122  GIRFFQLYVHKDRNLVAQLVRRAE  145



>ref|XP_010052052.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Eucalyptus 
grandis]
 ref|XP_010052053.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Eucalyptus 
grandis]
 gb|KCW75910.1| hypothetical protein EUGRSUZ_D00288 [Eucalyptus grandis]
Length=367

 Score =   260 bits (665),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID S
Sbjct  2    EITNVMEYEEIAKQKLPKMVFDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIDTS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFNISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVVQLVKRAE  145



>emb|CAN67413.1| hypothetical protein VITISV_005886 [Vitis vinifera]
Length=371

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM FDYYASGAEDQWTL +NR+AFS+ILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKQKLPKMVFDYYASGAEDQWTLYQNRHAFSQILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASA GTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASATGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDR+VVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRHVVAQLVRRAE  145



>ref|XP_008777164.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Phoenix 
dactylifera]
Length=317

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIA++KLPKM +DYYASGAED+W+L ENR AFSRILFRPRILIDVS+IDM+
Sbjct  4    EITNVTEYQAIARQKLPKMVYDYYASGAEDEWSLKENREAFSRILFRPRILIDVSRIDMT  63

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARA+SAAGTIMTLSSWATSSVEEVASTGP
Sbjct  64   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARASSAAGTIMTLSSWATSSVEEVASTGP  123

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  124  GIRFFQLYVYKDRNVVAQLVRRAE  147



>gb|EYU38209.1| hypothetical protein MIMGU_mgv1a008544mg [Erythranthe guttata]
 gb|EYU38210.1| hypothetical protein MIMGU_mgv1a008544mg [Erythranthe guttata]
Length=370

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGE+TNV EY+AIAK+KLPKM +DYYASGAEDQWTLAEN+NAFSRILFRPRILIDVSKID
Sbjct  1    MGEVTNVTEYQAIAKEKLPKMVYDYYASGAEDQWTLAENQNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TT+LGFKISMPIMIAPTA QKMAHPEGEYATARAASAA TIMTLSSWATSSVEEVAST
Sbjct  61   MTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAANTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRKVVEQLVRRAE  146



>ref|XP_008651329.1| PREDICTED: glycolate oxidase1 isoform X1 [Zea mays]
 gb|ACN28768.1| unknown [Zea mays]
 tpg|DAA59560.1| TPA: hypothetical protein ZEAMMB73_759880 [Zea mays]
Length=369

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEY+AIAK+KLPKMA+DYYASGAED+WTL ENR AFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYQAIAKQKLPKMAYDYYASGAEDEWTLQENREAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIM+APTA QKMAHP+GE ATARAA+AAGTIMTLSSWATSSVEEVAST
Sbjct  61   MTTTVLGFKISMPIMVAPTAMQKMAHPDGENATARAAAAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRKVVEQLVRRAE  146



>gb|ABY61829.1| hemoglobin/glycolate oxidase fusion protein [synthetic construct]
Length=525

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTLAENRNAFSRILFRPRILIDV+ IDM+
Sbjct  158  EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMT  217

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  218  TTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  277

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  278  GIRFFQLYVYKDRNVVAQLVRRAE  301



>emb|CDY40891.1| BnaCnng09820D [Brassica napus]
 emb|CDY16268.1| BnaC01g23030D [Brassica napus]
 emb|CDY11082.1| BnaC06g23340D [Brassica napus]
 emb|CDX81438.1| BnaC09g08490D [Brassica napus]
Length=311

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            +ITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    KITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>ref|XP_006407074.1| hypothetical protein EUTSA_v10020979mg [Eutrema salsugineum]
 ref|XP_006407077.1| hypothetical protein EUTSA_v10020979mg [Eutrema salsugineum]
 gb|ESQ48527.1| hypothetical protein EUTSA_v10020979mg [Eutrema salsugineum]
 gb|ESQ48530.1| hypothetical protein EUTSA_v10020979mg [Eutrema salsugineum]
Length=367

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>gb|EYU38211.1| hypothetical protein MIMGU_mgv1a009683mg [Erythranthe guttata]
 gb|EYU38212.1| hypothetical protein MIMGU_mgv1a009683mg [Erythranthe guttata]
Length=334

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGE+TNV EY+AIAK+KLPKM +DYYASGAEDQWTLAEN+NAFSRILFRPRILIDVSKID
Sbjct  1    MGEVTNVTEYQAIAKEKLPKMVYDYYASGAEDQWTLAENQNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TT+LGFKISMPIMIAPTA QKMAHPEGEYATARAASAA TIMTLSSWATSSVEEVAST
Sbjct  61   MTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAANTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYK+R VV QLVRRAE
Sbjct  121  GPGIRFFQLYVYKNRKVVEQLVRRAE  146



>ref|XP_010487246.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2-like [Camelina 
sativa]
Length=171

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDV+KIDM+
Sbjct  2    EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>ref|XP_002305044.1| hypothetical protein POPTR_0004s06400g [Populus trichocarpa]
 gb|EEE85555.1| hypothetical protein POPTR_0004s06400g [Populus trichocarpa]
Length=368

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M +ITNVMEY+ IA++KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID
Sbjct  1    MDQITNVMEYQEIARQKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MSTTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAA TIMTLSSWATSSVEEVAST
Sbjct  61   MSTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAADTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG+RFFQLYV+KDRNVVAQLVRRAE
Sbjct  121  GPGVRFFQLYVHKDRNVVAQLVRRAE  146



>emb|CDY25424.1| BnaC09g39390D [Brassica napus]
Length=335

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            +ITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    KITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>ref|XP_002466341.1| hypothetical protein SORBIDRAFT_01g005960 [Sorghum bicolor]
 gb|EER93339.1| hypothetical protein SORBIDRAFT_01g005960 [Sorghum bicolor]
Length=368

 Score =   259 bits (662),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEY+AIAK+KLPKMA+DYYASGAED+WTL ENR AFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYQAIAKQKLPKMAYDYYASGAEDEWTLKENREAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+T+VLGFKISMPIM+APTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MTTSVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYV+KDR VV QLVRRAE
Sbjct  121  GPGIRFFQLYVHKDRKVVEQLVRRAE  146



>emb|CDX82483.1| BnaA03g33380D [Brassica napus]
Length=373

 Score =   259 bits (662),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>ref|XP_006407076.1| hypothetical protein EUTSA_v10020979mg [Eutrema salsugineum]
 gb|ESQ48529.1| hypothetical protein EUTSA_v10020979mg [Eutrema salsugineum]
Length=349

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>gb|KJB12821.1| hypothetical protein B456_002G037900 [Gossypium raimondii]
Length=238

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+ IAK+KLPKM +DYYASGAEDQWTL ENR AF++ILFRPRILIDVSKIDM+
Sbjct  2    EITNVSEYQEIAKQKLPKMVYDYYASGAEDQWTLQENRFAFTKILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>emb|CDY35618.1| BnaC01g21400D [Brassica napus]
 emb|CDX68645.1| BnaC01g08080D [Brassica napus]
Length=337

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            +ITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    KITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>gb|KJB12823.1| hypothetical protein B456_002G038000 [Gossypium raimondii]
 gb|KJB12824.1| hypothetical protein B456_002G038000 [Gossypium raimondii]
 gb|KJB12826.1| hypothetical protein B456_002G038000 [Gossypium raimondii]
 gb|KJB12829.1| hypothetical protein B456_002G038000 [Gossypium raimondii]
Length=369

 Score =   258 bits (660),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+ IAK+KLPKMA+DYYASGAEDQWTL ENR AF++ILFRPRILIDVSKIDM+
Sbjct  2    EITNVSEYQEIAKQKLPKMAYDYYASGAEDQWTLHENRFAFTKILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_010941150.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X2 [Elaeis guineensis]
Length=314

 Score =   256 bits (655),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEY+ IAK+KLPKM +DYYASGAED+WTL ENR AFSRILFRPRILIDVS+IDM+
Sbjct  2    EITNVMEYQPIAKQKLPKMVYDYYASGAEDEWTLNENREAFSRILFRPRILIDVSRIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVKRAE  145



>emb|CDX98453.1| BnaC05g39220D [Brassica napus]
 emb|CDX97574.1| BnaA05g25050D [Brassica napus]
Length=370

 Score =   258 bits (659),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTILGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>ref|XP_006650695.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Oryza 
brachyantha]
Length=422

 Score =   259 bits (663),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  52   IKGAKMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILID  231
             K  +MGEITNV EY+AIAK+KLPKM +DYYASGAED+WTL ENR AFSRILFRPRILID
Sbjct  49   CKAGQMGEITNVTEYQAIAKQKLPKMIYDYYASGAEDEWTLKENREAFSRILFRPRILID  108

Query  232  VSKIDMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVE  411
            VS+IDM+TTVLGFKISMPIMIAP+A QKMAHPEGEYATARAASAAGTIMTLSSWATSSVE
Sbjct  109  VSRIDMTTTVLGFKISMPIMIAPSAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVE  168

Query  412  EVASTGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            EVASTGPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  169  EVASTGPGIRFFQLYVYKDRKVVEQLVRRAE  199



>ref|XP_002277249.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Vitis vinifera]
 ref|XP_010644816.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Vitis vinifera]
 emb|CBI32921.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   258 bits (659),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM FDYYASGAEDQWTL +NR+AFS+ILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKQKLPKMVFDYYASGAEDQWTLYQNRHAFSQILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDR+VVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRHVVAQLVRRAE  145



>ref|XP_010941135.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010941143.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Elaeis guineensis]
Length=367

 Score =   258 bits (658),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEY+ IAK+KLPKM +DYYASGAED+WTL ENR AFSRILFRPRILIDVS+IDM+
Sbjct  2    EITNVMEYQPIAKQKLPKMVYDYYASGAEDEWTLNENREAFSRILFRPRILIDVSRIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVKRAE  145



>ref|NP_001078406.1| glycolate oxidase [Arabidopsis thaliana]
 gb|AEE84032.1| glycolate oxidase [Arabidopsis thaliana]
Length=314

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIMIAPTA QKMAHP+GE ATARA SAAGTIMTLSSWAT SVEEVASTGP
Sbjct  62   TTVLGFNISMPIMIAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATCSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVIQLVKRAE  145



>gb|AEZ52381.1| glycolate oxidase [Wolffia australiana]
Length=367

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV E+EAIAK+KLPKM FDYYASGAEDQWTL ENRNAFSRILFRPRILIDV+KID+S
Sbjct  2    EITNVNEFEAIAKQKLPKMVFDYYASGAEDQWTLGENRNAFSRILFRPRILIDVTKIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
             T+LG+KISMPIM+APTA QKMAHPEGEYATARAAS+A TIMTLSSWATSSVE+VASTGP
Sbjct  62   ATILGYKISMPIMLAPTAMQKMAHPEGEYATARAASSANTIMTLSSWATSSVEKVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_010907304.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Elaeis guineensis]
 ref|XP_010907305.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Elaeis guineensis]
 ref|XP_010907306.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Elaeis guineensis]
 ref|XP_010907307.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Elaeis guineensis]
Length=367

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+ IAK+KLPKM +DYYASGAED+WTL ENR AFSRILFRPRILIDVS+IDM+
Sbjct  2    EITNVTEYQPIAKQKLPKMVYDYYASGAEDEWTLKENREAFSRILFRPRILIDVSRIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|AAO17067.1| glycolate oxidase [Zantedeschia aethiopica]
Length=367

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEA+AK KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDV+KIDM+
Sbjct  2    EITNVSEYEAVAKDKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVTKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLG+KISMPIMIAPTA QKMAH +GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGYKISMPIMIAPTAMQKMAHLDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_006657453.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5-like [Oryza 
brachyantha]
Length=369

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNV EY+AIAK+KLPKM +DYYASGAED+WTL ENR AFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVTEYQAIAKQKLPKMIYDYYASGAEDEWTLQENREAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAP+A QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MATTVLGFKISMPIMIAPSAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRKVVEQLVRRAE  146



>ref|NP_188060.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Arabidopsis thaliana]
 ref|NP_850584.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Arabidopsis thaliana]
 ref|XP_002882879.1| hypothetical protein ARALYDRAFT_478862 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q9LRR9.1|GLO1_ARATH RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO1; AltName: 
Full=Glycolate oxidase 1; Short=AtGLO1; Short=GOX 1; 
AltName: Full=Short chain alpha-hydroxy acid oxidase GLO1 [Arabidopsis 
thaliana]
 gb|AAL16164.1|AF428396_1 AT3g14420/MOA2_2 [Arabidopsis thaliana]
 dbj|BAB01334.1| glycolate oxidase [Arabidopsis thaliana]
 gb|AAK96642.1| AT3g14420/MOA2_2 [Arabidopsis thaliana]
 gb|AAL69528.1| AT3g14420/MOA2_2 [Arabidopsis thaliana]
 gb|EFH59138.1| hypothetical protein ARALYDRAFT_478862 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE75518.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Arabidopsis thaliana]
 gb|AEE75520.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Arabidopsis thaliana]
Length=367

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>ref|NP_850585.2| peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Arabidopsis thaliana]
 gb|AEE75519.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Arabidopsis thaliana]
Length=367

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>ref|XP_009116892.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2-like [Brassica 
rapa]
Length=347

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>ref|XP_010501892.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Camelina sativa]
 ref|XP_010465338.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Camelina sativa]
 ref|XP_010487247.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Camelina sativa]
Length=371

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>emb|CDY33221.1| BnaC01g36940D [Brassica napus]
Length=367

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>emb|CDX75771.1| BnaC03g38540D [Brassica napus]
Length=367

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>gb|AAV28535.1| glycolate oxidase [Brassica napus]
Length=367

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>emb|CDY39114.1| BnaA01g29420D [Brassica napus]
Length=367

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>emb|CDX82484.1| BnaA03g33370D [Brassica napus]
Length=367

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>ref|XP_009135382.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2 isoform 
X1 [Brassica rapa]
Length=367

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>ref|XP_006283965.1| hypothetical protein CARUB_v10005088mg [Capsella rubella]
 gb|EOA16863.1| hypothetical protein CARUB_v10005088mg [Capsella rubella]
Length=368

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIM+APTA QKMAHP+GE ATARA SAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFNISMPIMVAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVRQLVKRAE  145



>ref|XP_009116903.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Brassica rapa]
 emb|CDY39115.1| BnaA01g29410D [Brassica napus]
Length=367

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTILGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>gb|ACJ84628.1| unknown [Medicago truncatula]
Length=180

 Score =   249 bits (637),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV EYEAIAK+KLPKM +DY+ SGAEDQWTL ENRNAFSRILFRPRIL DVSKID
Sbjct  1    MDLITNVNEYEAIAKQKLPKMVYDYFVSGAEDQWTLQENRNAFSRILFRPRILRDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            ++TTVLGF ISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   LTTTVLGFNISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG+RFFQLYV KDRNVVAQLV+RAE
Sbjct  121  GPGVRFFQLYVIKDRNVVAQLVKRAE  146



>ref|XP_006407078.1| hypothetical protein EUTSA_v10020982mg [Eutrema salsugineum]
 ref|XP_006407079.1| hypothetical protein EUTSA_v10020982mg [Eutrema salsugineum]
 gb|ESQ48531.1| hypothetical protein EUTSA_v10020982mg [Eutrema salsugineum]
 gb|ESQ48532.1| hypothetical protein EUTSA_v10020982mg [Eutrema salsugineum]
Length=367

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDV+KIDM+
Sbjct  2    EITNVTEYEAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>gb|AAT08654.1| glycolate oxidase [Hyacinthus orientalis]
Length=253

 Score =   252 bits (643),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYE IAKKKLPKM +DYYASGAEDQW+L EN  AFSRILFRPRILIDVS+IDM+
Sbjct  14   EITNVSEYEEIAKKKLPKMVYDYYASGAEDQWSLRENIEAFSRILFRPRILIDVSRIDMT  73

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  74   TTVLGFNISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  133

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLV+RAE
Sbjct  134  GIRFFQLYVYKDRNVVAQLVKRAE  157



>gb|EEE66581.1| hypothetical protein OsJ_23125 [Oryza sativa Japonica Group]
Length=369

 Score =   256 bits (653),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNV EY+AIAK+KLPKM +DYYASGAED+WTL ENR AF+RILFRPRILIDVSKID
Sbjct  1    MGEITNVTEYQAIAKQKLPKMIYDYYASGAEDEWTLQENREAFARILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAP+A QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MATTVLGFKISMPIMIAPSAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRRVVEQLVRRAE  146



>ref|NP_001058909.1| Os07g0152900 [Oryza sativa Japonica Group]
 sp|Q6YT73.1|GLO5_ORYSJ RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO5; AltName: 
Full=Glycolate oxidase 5; Short=GOX 5; Short=OsGLO5; 
AltName: Full=Short chain alpha-hydroxy acid oxidase GLO5 [Oryza 
sativa Japonica Group]
 sp|B8B7C5.1|GLO5_ORYSI RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO5; AltName: 
Full=Glycolate oxidase 5; Short=GOX 5; Short=OsGLO5; 
AltName: Full=Short chain alpha-hydroxy acid oxidase GLO5 [Oryza 
sativa Indica Group]
 dbj|BAC84719.1| putative glycolate oxidase [Oryza sativa Japonica Group]
 dbj|BAD31578.1| putative (S)-2-hydroxy-acid oxidase [Oryza sativa Japonica Group]
 dbj|BAF20823.1| Os07g0152900 [Oryza sativa Japonica Group]
 dbj|BAG96328.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG88242.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81529.1| hypothetical protein OsI_24928 [Oryza sativa Indica Group]
Length=369

 Score =   256 bits (653),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNV EY+AIAK+KLPKM +DYYASGAED+WTL ENR AF+RILFRPRILIDVSKID
Sbjct  1    MGEITNVTEYQAIAKQKLPKMIYDYYASGAEDEWTLQENREAFARILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIMIAP+A QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MATTVLGFKISMPIMIAPSAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRRVVEQLVRRAE  146



>ref|NP_193570.1| glycolate oxidase [Arabidopsis thaliana]
 sp|O49506.1|GLO5_ARATH RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO5; AltName: 
Full=Glycolate oxidase 3; Short=AtGLO5; Short=GOX 3; 
AltName: Full=Short chain alpha-hydroxy acid oxidase GLO5 [Arabidopsis 
thaliana]
 emb|CAA16716.1| glycolate oxidase - like protein [Arabidopsis thaliana]
 emb|CAB78838.1| glycolate oxidase-like protein [Arabidopsis thaliana]
 gb|AAN71944.1| putative glycolate oxidase [Arabidopsis thaliana]
 gb|AEE84031.1| glycolate oxidase [Arabidopsis thaliana]
Length=368

 Score =   256 bits (653),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIMIAPTA QKMAHP+GE ATARA SAAGTIMTLSSWAT SVEEVASTGP
Sbjct  62   TTVLGFNISMPIMIAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATCSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVIQLVKRAE  145



>ref|XP_009146367.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Brassica rapa]
 ref|XP_009146368.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Brassica rapa]
Length=370

 Score =   255 bits (652),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKID +
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDTT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTILGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>gb|KJB12822.1| hypothetical protein B456_002G037900 [Gossypium raimondii]
Length=334

 Score =   254 bits (649),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+ IAK+KLPKM +DYYASGAEDQWTL ENR AF++ILFRPRILIDVSKIDM+
Sbjct  2    EITNVSEYQEIAKQKLPKMVYDYYASGAEDQWTLQENRFAFTKILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_010439866.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Camelina 
sativa]
 ref|XP_010439867.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Camelina 
sativa]
Length=368

 Score =   255 bits (652),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIMIAPTA QKMAHP+GE ATARA SAAGTIMTLSSWAT SVEEVASTGP
Sbjct  62   TTVLGFNISMPIMIAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATCSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVRQLVKRAE  145



>gb|ACD93720.1| glycolate oxidase [Mikania micrantha]
Length=369

 Score =   255 bits (652),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            +TNV EYEAIAK+KLPKM +DYYASGAEDQWTL E+RNAFSRILFRPRILIDVSKI M+T
Sbjct  3    VTNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLEESRNAFSRILFRPRILIDVSKIVMTT  62

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
            T+LGFKISMPIM+APTA QKMAHPEGEYATARAAS+AGTIMTLSSWATSSVEE ASTGPG
Sbjct  63   TILGFKISMPIMVAPTAMQKMAHPEGEYATARAASSAGTIMTLSSWATSSVEEAASTGPG  122

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDRNVVAQLVRRAE
Sbjct  123  IRFFQLYVYKDRNVVAQLVRRAE  145



>gb|AAL16258.1|AF428328_1 AT3g14420/MOA2_2 [Arabidopsis thaliana]
Length=367

 Score =   255 bits (652),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILID SKIDM+
Sbjct  2    EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDASKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>ref|XP_006297957.1| hypothetical protein CARUB_v10013998mg [Capsella rubella]
 gb|EOA30855.1| hypothetical protein CARUB_v10013998mg [Capsella rubella]
Length=367

 Score =   255 bits (652),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL ENRNAF RILFRPRILIDV+KIDM+
Sbjct  2    EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFGRILFRPRILIDVNKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+RNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRNVVEQLVRRAE  145



>gb|KCW67670.1| hypothetical protein EUGRSUZ_F01413 [Eucalyptus grandis]
Length=338

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL EN+ AFS+ILFRPRILIDVS+IDM+
Sbjct  2    EITNVNEYQAIAKEKLPKMVYDYYASGAEDQWTLQENQYAFSKILFRPRILIDVSRIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>tpg|DAA59561.1| TPA: hypothetical protein ZEAMMB73_759880 [Zea mays]
Length=484

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEY+AIAK+KLPKMA+DYYASGAED+WTL ENR AFSRILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYQAIAKQKLPKMAYDYYASGAEDEWTLQENREAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGFKISMPIM+APTA QKMAHP+GE ATARAA+AAGTIMTLSSWATSSVEEVAST
Sbjct  61   MTTTVLGFKISMPIMVAPTAMQKMAHPDGENATARAAAAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  121  GPGIRFFQLYVYKDRKVVEQLVRRAE  146



>gb|AFV28786.1| glycolate oxidase, partial [Gossypium hirsutum]
 gb|AFV28787.1| glycolate oxidase, partial [Gossypium hirsutum]
Length=369

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+ IAK+KLPKM +DYYASGAEDQWTL ENR AF++ILFRPRILIDVSKIDM+
Sbjct  2    EITNVSEYQEIAKQKLPKMVYDYYASGAEDQWTLHENRFAFTKILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTALQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|KJB12820.1| hypothetical protein B456_002G037900 [Gossypium raimondii]
Length=369

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+ IAK+KLPKM +DYYASGAEDQWTL ENR AF++ILFRPRILIDVSKIDM+
Sbjct  2    EITNVSEYQEIAKQKLPKMVYDYYASGAEDQWTLQENRFAFTKILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>gb|KHG12854.1| Peroxisomal (S)-2-hydroxy-acid oxidase [Gossypium arboreum]
Length=369

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+ IAK+KLPKM +DYYASGAEDQWTL ENR AF++ILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYQEIAKQKLPKMVYDYYASGAEDQWTLHENRFAFTKILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_009136924.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Brassica 
rapa]
 ref|XP_009136925.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Brassica 
rapa]
Length=368

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIM+APTA QKMAHP+GE ATARA SAAGTIMTLSSWAT SVEEVASTGP
Sbjct  62   TTVLGFNISMPIMVAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATCSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVRQLVKRAE  145



>ref|XP_010465336.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2-like isoform 
X1 [Camelina sativa]
Length=367

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>ref|XP_006297960.1| hypothetical protein CARUB_v10014001mg [Capsella rubella]
 gb|EOA30858.1| hypothetical protein CARUB_v10014001mg [Capsella rubella]
Length=367

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDV+KIDM+
Sbjct  2    EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVNKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>gb|KHG22455.1| Peroxisomal (S)-2-hydroxy-acid oxidase [Gossypium arboreum]
Length=369

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+ IAK+KLPKM +DYYASGAEDQWTL ENR AF++ILFRPRILIDVSKIDM+
Sbjct  2    EITNVSEYQEIAKQKLPKMVYDYYASGAEDQWTLHENRFAFTKILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_010060801.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Eucalyptus 
grandis]
Length=369

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL EN+ AFS+ILFRPRILIDVS+IDM+
Sbjct  2    EITNVNEYQAIAKEKLPKMVYDYYASGAEDQWTLQENQYAFSKILFRPRILIDVSRIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|NP_188059.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO2 [Arabidopsis thaliana]
 ref|NP_001189892.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO2 [Arabidopsis thaliana]
 sp|Q9LRS0.1|GLO2_ARATH RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO2; AltName: 
Full=Glycolate oxidase 1; Short=AtGLO2; Short=GOX 1; 
AltName: Full=Short chain alpha-hydroxy acid oxidase GLO2 [Arabidopsis 
thaliana]
 dbj|BAB01333.1| glycolate oxidase [Arabidopsis thaliana]
 gb|AAL24203.1| AT3g14420/MOA2_2 [Arabidopsis thaliana]
 gb|AAM97068.1| glycolate oxidase [Arabidopsis thaliana]
 gb|AAN72140.1| glycolate oxidase [Arabidopsis thaliana]
 dbj|BAD95441.1| glycolate oxidase like protein [Arabidopsis thaliana]
 gb|AEE75515.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO2 [Arabidopsis thaliana]
 gb|AEE75517.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO2 [Arabidopsis thaliana]
Length=367

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDV+KIDM+
Sbjct  2    EITNVTEYDAIAKAKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTAFQKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAFQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>ref|XP_004955475.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5-like [Setaria 
italica]
Length=428

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 141/148 (95%), Gaps = 1/148 (1%)
 Frame = +1

Query  61   AKMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSK  240
            AKM EITNVMEY+AIAK+KLPKMA+DYYASGAED+WTL ENR AFSRILFRPRILIDVSK
Sbjct  59   AKM-EITNVMEYQAIAKQKLPKMAYDYYASGAEDEWTLNENREAFSRILFRPRILIDVSK  117

Query  241  IDMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVA  420
            IDM+TTVLGFKISMPIM+APTAFQKMAHP+GE ATARAASAA T+MTLSSWATSSVEEVA
Sbjct  118  IDMTTTVLGFKISMPIMVAPTAFQKMAHPDGELATARAASAANTVMTLSSWATSSVEEVA  177

Query  421  STGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            STGPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  178  STGPGIRFFQLYVYKDRKVVEQLVRRAE  205



>emb|CDY55631.1| BnaA03g58240D [Brassica napus]
Length=368

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIM+APTA QKMAHP+GE ATARA SAAGTIMTLSSWAT SVEEVASTGP
Sbjct  62   TTVLGFNISMPIMVAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATCSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVRQLVKRAE  145



>ref|NP_001189891.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO2 [Arabidopsis thaliana]
 gb|AEE75516.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO2 [Arabidopsis thaliana]
Length=373

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDV+KIDM+
Sbjct  2    EITNVTEYDAIAKAKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTAFQKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAFQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>ref|XP_004248224.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Solanum 
lycopersicum]
 ref|XP_004248225.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Solanum 
lycopersicum]
Length=371

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGE+TNVME+EAIAK+KLPKM +DYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID
Sbjct  1    MGEVTNVMEFEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            +ST+VLGF ISMPIMIAPTA QKMAHP+GEYA ARAASAA TIMTLSSW TSSVEEV ST
Sbjct  61   LSTSVLGFNISMPIMIAPTAMQKMAHPDGEYAIARAASAAETIMTLSSWGTSSVEEVNST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG RFFQLYVYKDRNV  QLVRRAE
Sbjct  121  GPGTRFFQLYVYKDRNVTIQLVRRAE  146



>ref|XP_003531157.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Glycine max]
 ref|XP_006585083.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X2 [Glycine max]
 ref|XP_006585084.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X3 [Glycine max]
 ref|XP_006585085.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X4 [Glycine max]
Length=370

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +1

Query  64   KMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKI  243
            KM  ITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVSKI
Sbjct  2    KMEMITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILVDVSKI  61

Query  244  DMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAS  423
            D++ TVLGFKISMPIMIAPTA QKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEVAS
Sbjct  62   DLTATVLGFKISMPIMIAPTAMQKMAHPEGELATARAASAAGTIMTLSSWATSSVEEVAS  121

Query  424  TGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            TGP IRFFQLYV+KDRNVVAQLVRRAE
Sbjct  122  TGPDIRFFQLYVFKDRNVVAQLVRRAE  148



>gb|KDO78207.1| hypothetical protein CISIN_1g015722mg [Citrus sinensis]
Length=249

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            + EITNVMEYEA+AK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL DVSKID
Sbjct  4    ISEITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKID  63

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGF ISMPIMIAPTAFQKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEV+ST
Sbjct  64   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSST  123

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYV K RNV AQLV+RAE
Sbjct  124  GPGIRFFQLYVTKHRNVDAQLVKRAE  149



>ref|XP_002960597.1| hypothetical protein SELMODRAFT_266585 [Selaginella moellendorffii]
 ref|XP_002969240.1| hypothetical protein SELMODRAFT_270767 [Selaginella moellendorffii]
 gb|EFJ29328.1| hypothetical protein SELMODRAFT_270767 [Selaginella moellendorffii]
 gb|EFJ38136.1| hypothetical protein SELMODRAFT_266585 [Selaginella moellendorffii]
Length=371

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYE +AK++LPKMAFDYYASGAEDQWTL ENR AF RI FRPRIL+DV+ +DM+
Sbjct  6    EITNVTEYEELAKQRLPKMAFDYYASGAEDQWTLKENRTAFERIRFRPRILVDVTNVDMT  65

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTAFQ+MAHPEGE ATARA S+ GTIMTLSSWATSSVEEVASTGP
Sbjct  66   TTVLGFKISMPIMVAPTAFQRMAHPEGELATARAVSSHGTIMTLSSWATSSVEEVASTGP  125

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  126  GIRFFQLYVYKDRNVVAQLVRRAE  149



>ref|XP_006414116.1| hypothetical protein EUTSA_v10025514mg [Eutrema salsugineum]
 gb|ESQ55569.1| hypothetical protein EUTSA_v10025514mg [Eutrema salsugineum]
Length=368

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVS+ID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSEIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIMIAPTA QKMAHP+GE ATARA SAAGTIMTLSSWAT SVEEVASTGP
Sbjct  62   TTVLGFNISMPIMIAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATCSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVRQLVKRAE  145



>ref|XP_010517549.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5-like [Camelina 
sativa]
 ref|XP_010517550.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5-like [Camelina 
sativa]
Length=368

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVS ID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSNIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIMIAPTA QKMAHP+GE ATARA SAAGTIMTLSSWAT SVEEVASTGP
Sbjct  62   TTVLGFNISMPIMIAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATCSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVRQLVKRAE  145



>ref|XP_010501901.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2 [Camelina 
sativa]
 ref|XP_010465333.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2 isoform 
X1 [Camelina sativa]
 ref|XP_010487244.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2 isoform 
X1 [Camelina sativa]
Length=367

 Score =   253 bits (646),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EY+AIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDV+KIDM+
Sbjct  2    EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNKIDMA  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIM+APTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRKVVEQLVRRAE  145



>emb|CDY01535.1| BnaC07g35250D [Brassica napus]
Length=368

 Score =   253 bits (646),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIM+APTA QKMAHP+GE ATARA SAAGTIMTLSSWAT SVEEVASTGP
Sbjct  62   TTVLGFNISMPIMVAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATCSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVY+DRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYQDRNVVRQLVKRAE  145



>ref|XP_010434548.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5-like [Camelina 
sativa]
Length=368

 Score =   253 bits (646),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF  SMPIMIAPTA QKMAHP+GE A ARA SAAGTIMTLSSWAT SVEEVASTGP
Sbjct  62   TTVLGFNTSMPIMIAPTAMQKMAHPDGELANARATSAAGTIMTLSSWATCSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVRQLVKRAE  145



>ref|XP_002868001.1| hypothetical protein ARALYDRAFT_914854 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44260.1| hypothetical protein ARALYDRAFT_914854 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   253 bits (645),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            T VLGF ISMPIMIAPTA QKMAHP+GE ATARA SAAGTIMTLSSWAT SVEEVASTGP
Sbjct  62   TRVLGFNISMPIMIAPTAMQKMAHPDGELATARATSAAGTIMTLSSWATCSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVIQLVKRAE  145



>ref|XP_006356963.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006356964.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X2 [Solanum tuberosum]
Length=372

 Score =   253 bits (645),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +1

Query  64   KMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKI  243
            KM  +TNVMEYE +AK++LPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVS I
Sbjct  4    KMESVTNVMEYEILAKERLPKMIYDYYASGAEDQWTLQENRNAFSRILFRPRILVDVSNI  63

Query  244  DMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAS  423
            D +T+VLGFKISMPIM+APTA QKMAHPEGEYATARA SAAGTIMTLSSW TSSVEEVAS
Sbjct  64   DTTTSVLGFKISMPIMVAPTAMQKMAHPEGEYATARATSAAGTIMTLSSWGTSSVEEVAS  123

Query  424  TGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            TGPGIRFFQLYVYKDRNVV QLV+RAE
Sbjct  124  TGPGIRFFQLYVYKDRNVVMQLVKRAE  150



>gb|AFK44395.1| unknown [Medicago truncatula]
Length=192

 Score =   246 bits (629),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV EYEAIAK+KLPKM +DY+ SGAEDQWTL ENRNAFSRILFRPRIL DVSKID
Sbjct  1    MDLITNVNEYEAIAKQKLPKMVYDYFVSGAEDQWTLQENRNAFSRILFRPRILRDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            ++TTVLG  ISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   LTTTVLGLNISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG+RFFQLYV KDRNVVAQLV+RAE
Sbjct  121  GPGVRFFQLYVIKDRNVVAQLVKRAE  146



>ref|XP_006467448.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X1 [Citrus sinensis]
Length=371

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            + EITNVMEYEA+AK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL DVSKID
Sbjct  4    ISEITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKID  63

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGF ISMPIMIAPTAFQKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEV+ST
Sbjct  64   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSST  123

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYV KDRNV AQLV+RAE
Sbjct  124  GPGIRFFQLYVTKDRNVDAQLVKRAE  149



>ref|XP_006449714.1| hypothetical protein CICLE_v10015533mg [Citrus clementina]
 gb|ESR62954.1| hypothetical protein CICLE_v10015533mg [Citrus clementina]
Length=371

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            + EITNVMEYEA+AK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL DVSKID
Sbjct  4    ISEITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKID  63

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGF ISMPIMIAPTAFQKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEV+ST
Sbjct  64   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSST  123

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYV KDRNV AQLV+RAE
Sbjct  124  GPGIRFFQLYVTKDRNVDAQLVKRAE  149



>ref|XP_006836442.1| hypothetical protein AMTR_s00092p00167960 [Amborella trichopoda]
 gb|ERM99295.1| hypothetical protein AMTR_s00092p00167960 [Amborella trichopoda]
Length=367

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            E+ NVMEY+AIAKKKLPKM +DYYASGAED+W+L ENR+AFSRILFRPRILIDVS I+M+
Sbjct  2    EVVNVMEYQAIAKKKLPKMVYDYYASGAEDEWSLRENRHAFSRILFRPRILIDVSNIEMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIMIAPTA QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTLLGFKISMPIMIAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDR VVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRKVVAQLVRRAE  145



>pir||T10242 (S)-2-hydroxy-acid oxidase (EC 1.1.3.15) - cucurbit
 dbj|BAA03131.1| glycolate oxidase [Cucurbita cv. Kurokawa Amakuri]
Length=367

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQW L ENRNAFSRILFRPRILIDVSKIDMS
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYYASGAEDQWALKENRNAFSRILFRPRILIDVSKIDMS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGT  TLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTTTTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVAQLVRRAE  145



>ref|XP_006449713.1| hypothetical protein CICLE_v10015533mg [Citrus clementina]
 gb|ESR62953.1| hypothetical protein CICLE_v10015533mg [Citrus clementina]
Length=392

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            + EITNVMEYEA+AK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL DVSKID
Sbjct  25   ISEITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKID  84

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGF ISMPIMIAPTAFQKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEV+ST
Sbjct  85   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSST  144

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYV KDRNV AQLV+RAE
Sbjct  145  GPGIRFFQLYVTKDRNVDAQLVKRAE  170



>ref|XP_003558107.2| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Brachypodium 
distachyon]
Length=699

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  64   KMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKI  243
            KMGE+TNVMEY+AIAK+KLPKMA+DYYASGAED+WTL ENR AFSRILFRPRILIDV+ I
Sbjct  330  KMGEVTNVMEYQAIAKQKLPKMAYDYYASGAEDEWTLKENREAFSRILFRPRILIDVANI  389

Query  244  DMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAS  423
            DM+T+VLGFKISMPIMI+PTAFQKMAHPEGEYATARAASAAGT+MTLSSWATSSVEEVAS
Sbjct  390  DMTTSVLGFKISMPIMISPTAFQKMAHPEGEYATARAASAAGTVMTLSSWATSSVEEVAS  449

Query  424  TGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            TGPGIRFFQLYVYKDR VV QLVRRAE
Sbjct  450  TGPGIRFFQLYVYKDRKVVEQLVRRAE  476



>ref|XP_009405361.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405362.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405363.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405364.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Musa 
acuminata subsp. malaccensis]
Length=369

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVS IDM+
Sbjct  4    EITNVCEYEEIAKQKLPKMIYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSNIDMT  63

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIMIAPTA QKMAHPEGEYATARAASAA TIMTLSSWATSSVEEVASTGP
Sbjct  64   TTVLGFNISMPIMIAPTAMQKMAHPEGEYATARAASAANTIMTLSSWATSSVEEVASTGP  123

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            G+RFFQLYVYKDR+VV QLV+RAE
Sbjct  124  GVRFFQLYVYKDRDVVRQLVKRAE  147



>ref|XP_009628914.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Nicotiana 
tomentosiformis]
 ref|XP_009628915.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Nicotiana 
tomentosiformis]
Length=368

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRP IL+DVS ID
Sbjct  1    MENITNVMEYEIIAKEKLPKMIYDYYASGAEDQWTLQENRNAFSRILFRPCILVDVSNID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
             +T+VLGFK+SMPIM+APTA QKMAHPEGEYATARA SAAGTIMTLSSWATSSVEEVAST
Sbjct  61   TTTSVLGFKVSMPIMVAPTAMQKMAHPEGEYATARATSAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVV QLV+RAE
Sbjct  121  GPGIRFFQLYVYKDRNVVRQLVKRAE  146



>ref|XP_009791622.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X1 [Nicotiana sylvestris]
Length=383

 Score =   251 bits (642),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +1

Query  64   KMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKI  243
            KM  ITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DV  I
Sbjct  15   KMESITNVMEYETIAKEKLPKMIYDYYASGAEDQWTLQENRNAFSRILFRPRILVDVRSI  74

Query  244  DMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAS  423
            D +T+VLGFK+SMPIM+APTA QKMAH EGEYATARA SAAGTIMTLSSWATSSVEEVAS
Sbjct  75   DTTTSVLGFKVSMPIMVAPTAMQKMAHSEGEYATARATSAAGTIMTLSSWATSSVEEVAS  134

Query  424  TGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            TGPGIRFFQLYVYKDRNVV QLV+RAE
Sbjct  135  TGPGIRFFQLYVYKDRNVVRQLVKRAE  161



>ref|XP_006584583.1| PREDICTED: uncharacterized protein LOC100800520 isoform X1 [Glycine 
max]
 ref|XP_006584584.1| PREDICTED: uncharacterized protein LOC100800520 isoform X2 [Glycine 
max]
 ref|XP_006584585.1| PREDICTED: uncharacterized protein LOC100800520 isoform X3 [Glycine 
max]
Length=370

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            +TNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVSKID++ 
Sbjct  6    MTNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILVDVSKIDLTA  65

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
            TVLGFKISMPIMIAPTA QKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEVASTGP 
Sbjct  66   TVLGFKISMPIMIAPTAMQKMAHPEGELATARAASAAGTIMTLSSWATSSVEEVASTGPD  125

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYV+KDRNVVAQLVRRAE
Sbjct  126  IRFFQLYVFKDRNVVAQLVRRAE  148



>gb|AFK34700.1| unknown [Lotus japonicus]
Length=369

 Score =   250 bits (639),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV EYEAIAK+ LPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVS+ID
Sbjct  1    MDLITNVCEYEAIAKQILPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILVDVSRID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            ++TTVLGFKISMPIMIAPTA QKMAHPEGEYATARAASAAGTIMTLSSW TSSVEEVAST
Sbjct  61   LTTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWGTSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYV K+RNVV QLVRRAE
Sbjct  121  GPGIRFFQLYVIKNRNVVTQLVRRAE  146



>ref|XP_007211466.1| hypothetical protein PRUPE_ppa007462mg [Prunus persica]
 gb|EMJ12665.1| hypothetical protein PRUPE_ppa007462mg [Prunus persica]
Length=367

 Score =   250 bits (638),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL EN++AFSRILFRPR+LIDVSKID+ 
Sbjct  2    EITNVSEYEAIAKQKLPKMVYDYYASGAEDQWTLKENQHAFSRILFRPRVLIDVSKIDLR  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIMIAPTA QKMAHPEGEYATARAA+AA TIMTLSSWATSSV+EVASTGP
Sbjct  62   TTVLGFNISMPIMIAPTAMQKMAHPEGEYATARAAAAADTIMTLSSWATSSVKEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLVRRAE
Sbjct  122  GIRFFQLYVYKDRNVVTQLVRRAE  145



>ref|XP_003531156.2| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Glycine 
max]
Length=370

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +1

Query  64   KMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKI  243
            KM  ITNV EYEAIAK+KLPKM +DYYASGAEDQWTL EN+NAFSRILFRPRIL+DVSKI
Sbjct  2    KMDMITNVNEYEAIAKEKLPKMVYDYYASGAEDQWTLKENQNAFSRILFRPRILVDVSKI  61

Query  244  DMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAS  423
            D++ TVLGFKISMPIMIAPTA QKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEVAS
Sbjct  62   DLTATVLGFKISMPIMIAPTAMQKMAHPEGELATARAASAAGTIMTLSSWATSSVEEVAS  121

Query  424  TGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            TGP IRFFQLYV+KDRNV AQLVRRAE
Sbjct  122  TGPDIRFFQLYVFKDRNVAAQLVRRAE  148



>gb|ABK21603.1| unknown [Picea sitchensis]
Length=236

 Score =   245 bits (626),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EI NV +YE +AK+KLPKM FDYYASGAEDQWTL ENR AF RI FRPRILIDV+K+D+S
Sbjct  2    EIVNVSDYEVVAKQKLPKMVFDYYASGAEDQWTLHENRKAFERIRFRPRILIDVTKVDLS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGE+ATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEFATARAASAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R+VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRHVVEQLVRRAE  145



>gb|KDO78204.1| hypothetical protein CISIN_1g015722mg [Citrus sinensis]
 gb|KDO78205.1| hypothetical protein CISIN_1g015722mg [Citrus sinensis]
Length=371

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            + EITNVMEYEA+AK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL DVSKID
Sbjct  4    ISEITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKID  63

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGF ISMPIMIAPTAFQKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEV+ST
Sbjct  64   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSST  123

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYV K RNV AQLV+RAE
Sbjct  124  GPGIRFFQLYVTKHRNVDAQLVKRAE  149



>ref|XP_009791623.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009791624.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X2 [Nicotiana sylvestris]
Length=368

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DV  ID
Sbjct  1    MESITNVMEYETIAKEKLPKMIYDYYASGAEDQWTLQENRNAFSRILFRPRILVDVRSID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
             +T+VLGFK+SMPIM+APTA QKMAH EGEYATARA SAAGTIMTLSSWATSSVEEVAST
Sbjct  61   TTTSVLGFKVSMPIMVAPTAMQKMAHSEGEYATARATSAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVV QLV+RAE
Sbjct  121  GPGIRFFQLYVYKDRNVVRQLVKRAE  146



>gb|EMS55513.1| Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Triticum urartu]
Length=370

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            +TNV EY+AIAK+KLPKMA+DYYASGAED+WTL ENR AFSRILFRPRILIDVS IDM+T
Sbjct  5    VTNVSEYQAIAKRKLPKMAYDYYASGAEDEWTLKENREAFSRILFRPRILIDVSTIDMTT  64

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
            +VLG KISMPIMI+PTAFQKMAHPEGEYATARAASAAGT+MTLSSWATSSVEEVASTGPG
Sbjct  65   SVLGIKISMPIMISPTAFQKMAHPEGEYATARAASAAGTVMTLSSWATSSVEEVASTGPG  124

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDR VV QLVRRAE
Sbjct  125  IRFFQLYVYKDRKVVEQLVRRAE  147



>ref|XP_011096586.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Sesamum indicum]
 ref|XP_011096587.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Sesamum indicum]
 ref|XP_011096588.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase [Sesamum indicum]
Length=373

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +1

Query  64   KMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKI  243
            +M  ITNVME+EA+A++KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVS I
Sbjct  5    EMESITNVMEFEAVAREKLPKMVYDYYASGAEDQWTLHENRNAFSRILFRPRILVDVSNI  64

Query  244  DMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAS  423
            DM+TT+LGFK+SMPIM+APTA QKMAHP GE ATARAASAAGTIMTLSSWATSSVEEVAS
Sbjct  65   DMTTTILGFKVSMPIMVAPTAMQKMAHPAGELATARAASAAGTIMTLSSWATSSVEEVAS  124

Query  424  TGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            TGPG RFFQLYVY+DRNVV QLVRRAE
Sbjct  125  TGPGTRFFQLYVYRDRNVVRQLVRRAE  151



>ref|XP_011035452.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X2 [Populus euphratica]
 ref|XP_011035454.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X2 [Populus euphratica]
 ref|XP_011035455.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X2 [Populus euphratica]
 ref|XP_011035456.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X2 [Populus euphratica]
Length=368

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M +ITNVMEY+ IA++KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPR+LIDVSKID
Sbjct  1    MDQITNVMEYQEIARQKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRVLIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MSTTVLGFKISMPIMIAP+A QKMAHPEGE ATARAASAA TIMTLSSWATSSVEEVAST
Sbjct  61   MSTTVLGFKISMPIMIAPSAMQKMAHPEGENATARAASAANTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG+RFFQLYV K+RNVVAQLVRRAE
Sbjct  121  GPGVRFFQLYVLKERNVVAQLVRRAE  146



>ref|XP_007158768.1| hypothetical protein PHAVU_002G180300g [Phaseolus vulgaris]
 gb|ESW30762.1| hypothetical protein PHAVU_002G180300g [Phaseolus vulgaris]
Length=368

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV EYEAIAK KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRIL+DVS ID
Sbjct  1    MEMITNVTEYEAIAKAKLPKMVYDYYASGAEDQWTLKENRNAFARILFRPRILVDVSSID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            ++ T+LGFK+SMPIMIAPTA QKMAHPEGE+ATARAASAA TIMTLSSWATSSVEEVAST
Sbjct  61   LTATILGFKVSMPIMIAPTAMQKMAHPEGEFATARAASAADTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYV+KDRNVVAQLVRRAE
Sbjct  121  GPGIRFFQLYVFKDRNVVAQLVRRAE  146



>dbj|BAK04551.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=370

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 140/147 (95%), Gaps = 1/147 (1%)
 Frame = +1

Query  67   MGE-ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKI  243
            MGE ITNV EY+AIAK+KLPKMA+DYYASGAED+WTL ENR AFSRILFRPRILIDVS I
Sbjct  1    MGETITNVSEYQAIAKQKLPKMAYDYYASGAEDEWTLKENREAFSRILFRPRILIDVSTI  60

Query  244  DMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAS  423
            DM+T+VLG K+SMPIMI+PTAFQKMAHPEGEYATARAASAAGT+MTLSSWATSSVEEVAS
Sbjct  61   DMTTSVLGMKMSMPIMISPTAFQKMAHPEGEYATARAASAAGTVMTLSSWATSSVEEVAS  120

Query  424  TGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            TGPGIRFFQLYVYK+R VVAQLV+RAE
Sbjct  121  TGPGIRFFQLYVYKNRKVVAQLVKRAE  147



>ref|XP_011035451.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like isoform 
X1 [Populus euphratica]
Length=411

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 145/167 (87%), Gaps = 4/167 (2%)
 Frame = +1

Query  4    CTLFSSFGAQDF*RGSIKGAKMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAEN  183
            C L   FG       S +  +M +ITNVMEY+ IA++KLPKM +DYYASGAEDQWTL EN
Sbjct  27   CGLTRLFGES----ASNQFEEMDQITNVMEYQEIARQKLPKMVYDYYASGAEDQWTLKEN  82

Query  184  RNAFSRILFRPRILIDVSKIDMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasa  363
            RNAFSRILFRPR+LIDVSKIDMSTTVLGFKISMPIMIAP+A QKMAHPEGE ATARAASA
Sbjct  83   RNAFSRILFRPRVLIDVSKIDMSTTVLGFKISMPIMIAPSAMQKMAHPEGENATARAASA  142

Query  364  aGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            A TIMTLSSWATSSVEEVASTGPG+RFFQLYV K+RNVVAQLVRRAE
Sbjct  143  ANTIMTLSSWATSSVEEVASTGPGVRFFQLYVLKERNVVAQLVRRAE  189



>gb|KHN12456.1| Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Glycine soja]
Length=368

 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV EYEAIAK+KLPKM +DYYASGAEDQWTL EN+NAFSRILFRPRIL+DVSKID
Sbjct  1    MDMITNVNEYEAIAKEKLPKMVYDYYASGAEDQWTLKENQNAFSRILFRPRILVDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            ++ TVLGFKISMPIMIAPTA QKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   LTATVLGFKISMPIMIAPTAMQKMAHPEGELATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GP IRFFQLYV+KDRNV AQLVRRAE
Sbjct  121  GPDIRFFQLYVFKDRNVAAQLVRRAE  146



>gb|KDO78203.1| hypothetical protein CISIN_1g015722mg [Citrus sinensis]
Length=402

 Score =   249 bits (635),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            + EITNVMEYEA+AK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL DVSKID
Sbjct  35   ISEITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSKID  94

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+TTVLGF ISMPIMIAPTAFQKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEV+ST
Sbjct  95   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSST  154

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYV K RNV AQLV+RAE
Sbjct  155  GPGIRFFQLYVTKHRNVDAQLVKRAE  180



>ref|XP_010056899.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase isoform X1 
[Eucalyptus grandis]
 ref|XP_010056900.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase isoform X1 
[Eucalyptus grandis]
 ref|XP_010056901.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase isoform X1 
[Eucalyptus grandis]
 gb|KCW73816.1| hypothetical protein EUGRSUZ_E02420 [Eucalyptus grandis]
Length=367

 Score =   248 bits (632),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAKKKLPKM +DYYASGAEDQWTL ENRNAFSRILFRPR+L+DVS ID++
Sbjct  2    EITNVMEYEEIAKKKLPKMVYDYYASGAEDQWTLTENRNAFSRILFRPRVLVDVSHIDVT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            T VLGFKISMPIMIAPTA QKMAHP+GE ATARAASAAGTIMTLSSWATS+ EEVASTGP
Sbjct  62   TMVLGFKISMPIMIAPTAMQKMAHPDGECATARAASAAGTIMTLSSWATSNAEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GI FFQLYV KDRNVVAQLVRRAE
Sbjct  122  GIHFFQLYVLKDRNVVAQLVRRAE  145



>gb|ABR17627.1| unknown [Picea sitchensis]
Length=367

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EI NV +YE +AK+KLPKM FDYYASGAEDQWTL ENR AF RI FRPRILIDV+K+D+S
Sbjct  2    EIVNVSDYEVVAKQKLPKMVFDYYASGAEDQWTLHENRKAFERIRFRPRILIDVTKVDLS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGE+ATARA+SAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEFATARASSAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R+VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRHVVEQLVRRAE  145



>gb|ABK25472.1| unknown [Picea sitchensis]
 gb|ABK25475.1| unknown [Picea sitchensis]
 gb|ACN40478.1| unknown [Picea sitchensis]
Length=367

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EI NV +YE +AK+KLPKM FDYYASGAEDQWTL ENR AF RI FRPRILIDV+K+D+S
Sbjct  2    EIVNVSDYEVVAKQKLPKMVFDYYASGAEDQWTLHENRKAFERIRFRPRILIDVTKVDLS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGFKISMPIMIAPTA QKMAHPEGE+ATARA+SAAGTIMTLSSWATSSVEEVASTGP
Sbjct  62   TTVLGFKISMPIMIAPTAMQKMAHPEGEFATARASSAAGTIMTLSSWATSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R+VV QLVRRAE
Sbjct  122  GIRFFQLYVYKNRHVVEQLVRRAE  145



>ref|XP_009360901.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Pyrus 
x bretschneideri]
 ref|XP_009360902.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Pyrus 
x bretschneideri]
Length=368

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL EN  AFSRILFRPRILIDVSKID
Sbjct  1    MVEITNVSEYEAIAKEKLPKMIYDYYASGAEDQWTLKENERAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            + TTVLGF ISMPIMIAPTA QKMAHPEGEYATARAASAA TIMTLSSWATSSVEEVAST
Sbjct  61   LRTTVLGFNISMPIMIAPTAMQKMAHPEGEYATARAASAADTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG+RF QLYV+KDRNVVAQLV+RAE
Sbjct  121  GPGVRFLQLYVHKDRNVVAQLVKRAE  146



>ref|XP_001754192.1| predicted protein [Physcomitrella patens]
 gb|EDQ81093.1| predicted protein [Physcomitrella patens]
Length=368

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            E+TNV EYE +A++KLPKM FDYYASGAEDQWTL ENRNAF RI FRPRILIDV+K+D++
Sbjct  5    EVTNVTEYEELARQKLPKMVFDYYASGAEDQWTLRENRNAFERIRFRPRILIDVTKVDLT  64

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            T VLGF ISMPIM+APTA Q+MAHP+GE ATARA S AGTIMTLSSWATSSVEEVAS GP
Sbjct  65   TNVLGFNISMPIMVAPTAMQRMAHPDGELATARAVSKAGTIMTLSSWATSSVEEVASVGP  124

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  125  GIRFFQLYVYKDRNVVAQLVRRAE  148



>ref|XP_004244966.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Solanum 
lycopersicum]
 ref|XP_010324901.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Solanum 
lycopersicum]
 ref|XP_010324902.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Solanum 
lycopersicum]
 ref|XP_010324903.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Solanum 
lycopersicum]
Length=372

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +1

Query  64   KMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKI  243
             M  +TNVMEYE +AKK+LPKM +DYYASGAEDQWTL ENRNAFS+ILFRPRIL+DVS I
Sbjct  4    NMESVTNVMEYEILAKKRLPKMIYDYYASGAEDQWTLQENRNAFSKILFRPRILVDVSNI  63

Query  244  DMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAS  423
            D +T+VLG+KISMPIM+APTA QKMAHPEGE ATARA SAAGTIMTLSSW TSSVEEVAS
Sbjct  64   DTTTSVLGYKISMPIMVAPTAMQKMAHPEGECATARATSAAGTIMTLSSWGTSSVEEVAS  123

Query  424  TGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            TGPGIRFFQLYVYKDRNVV QLV+RAE
Sbjct  124  TGPGIRFFQLYVYKDRNVVMQLVKRAE  150



>ref|XP_010538538.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Tarenaya 
hassleriana]
 ref|XP_010538539.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Tarenaya 
hassleriana]
Length=371

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  61   AKMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSK  240
              M EITNVME+E +AK+KLPKM +DY ASGAEDQWTLAENRNAFSRILFRPRIL+DVS+
Sbjct  2    GNMEEITNVMEFEKLAKEKLPKMVYDYNASGAEDQWTLAENRNAFSRILFRPRILVDVSE  61

Query  241  IDMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVA  420
            ID+S TVLGFKISMPIMIAPTA QKM HP+GE ATARAASAAGTIMTLSSW T SVEEV+
Sbjct  62   IDVSATVLGFKISMPIMIAPTAMQKMVHPDGEIATARAASAAGTIMTLSSWGTCSVEEVS  121

Query  421  STGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            STGPGIRFFQLYVYKDRNVV QLVRRAE
Sbjct  122  STGPGIRFFQLYVYKDRNVVIQLVRRAE  149



>ref|XP_001769086.1| predicted protein [Physcomitrella patens]
 gb|EDQ66164.1| predicted protein [Physcomitrella patens]
Length=368

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            + E+TNV EYE +A++KLPKM +DYYASGAEDQWTL ENR+AF RI FRPRILIDV+K+D
Sbjct  3    IAEVTNVTEYEELARQKLPKMVYDYYASGAEDQWTLKENRSAFERIRFRPRILIDVTKVD  62

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            +ST VLGF ISMPIM+APTA Q+MAHPEGE ATARA + AGTIMTLSSWATSSVEEVAS 
Sbjct  63   LSTNVLGFNISMPIMVAPTAMQRMAHPEGELATARAVAKAGTIMTLSSWATSSVEEVASV  122

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  123  GPGIRFFQLYVYKDRNVVAQLVRRAE  148



>ref|XP_004504562.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Cicer 
arietinum]
Length=368

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV E+EAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL DVSKID
Sbjct  1    MDLITNVTEFEAIAKEKLPKMIYDYYASGAEDQWTLKENRNAFSRILFRPRILRDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            ++T VLGF ISMPIMIAPTA QKMAH EGEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   LTTNVLGFNISMPIMIAPTAMQKMAHLEGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYV KDRNVV QLVRRAE
Sbjct  121  GPGIRFFQLYVVKDRNVVTQLVRRAE  146



>gb|EPS70695.1| glycolate oxidase, partial [Genlisea aurea]
Length=360

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNVME+EAIAK+KLPKM +DY+ASGAEDQWTL+ENRNAFSRIL RPRILIDVS +D
Sbjct  1    MESITNVMEFEAIAKEKLPKMVYDYFASGAEDQWTLSENRNAFSRILIRPRILIDVSNVD  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
             STTVLGFKISMPIM+AP+A QKMAHP+GE ATARA+S+AGTIM LSSWATSSVEEVAST
Sbjct  61   TSTTVLGFKISMPIMVAPSAMQKMAHPDGELATARASSSAGTIMALSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG RFFQLYV++DR+VVAQLV+RAE
Sbjct  121  GPGTRFFQLYVFRDRSVVAQLVKRAE  146



>ref|XP_008225499.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Prunus 
mume]
 ref|XP_008225500.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Prunus 
mume]
Length=367

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL EN++AFSRILFRPRILIDVSKID+ 
Sbjct  2    EITNVSEYEAIAKQKLPKMVYDYYASGAEDQWTLKENQHAFSRILFRPRILIDVSKIDLR  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIMIAPTA QKMAHPEGEYATARA +AA TIMTLSSWATSS +EVASTGP
Sbjct  62   TTVLGFNISMPIMIAPTAMQKMAHPEGEYATARATAAADTIMTLSSWATSSAQEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDR+VV QLVRRAE
Sbjct  122  GIRFFQLYVYKDRSVVTQLVRRAE  145



>ref|XP_008371612.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Malus domestica]
 ref|XP_008371613.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Malus domestica]
 ref|XP_008356031.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 isoform 
X1 [Malus domestica]
Length=368

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL EN +AFSRILFRPRILIDVSKID
Sbjct  1    MVEITNVSEYEAIAKEKLPKMIYDYYASGAEDQWTLKENESAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            + TTVLGF ISMPIMIAPTA QKMAHPEGEYATARAASAA TIMTLSSWA+SSVEEVAST
Sbjct  61   LRTTVLGFNISMPIMIAPTAMQKMAHPEGEYATARAASAADTIMTLSSWASSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG+RF QLYV+ DRNVVAQLV+RAE
Sbjct  121  GPGVRFLQLYVHNDRNVVAQLVKRAE  146



>gb|KJB34952.1| hypothetical protein B456_006G092300 [Gossypium raimondii]
 gb|KJB34953.1| hypothetical protein B456_006G092300 [Gossypium raimondii]
 gb|KJB34954.1| hypothetical protein B456_006G092300 [Gossypium raimondii]
 gb|KJB34956.1| hypothetical protein B456_006G092300 [Gossypium raimondii]
 gb|KJB34957.1| hypothetical protein B456_006G092300 [Gossypium raimondii]
Length=368

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKIDM T
Sbjct  4    ITNVSEYEVIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIDMMT  63

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
            T+LGF+ISMPIM+APT  QKMAHPEGE ATARAAS AGTIMTLSS+A SSVEEVASTG G
Sbjct  64   TILGFRISMPIMVAPTGMQKMAHPEGECATARAASDAGTIMTLSSYANSSVEEVASTGSG  123

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYV+KDRN+VAQLVRRAE
Sbjct  124  IRFFQLYVHKDRNLVAQLVRRAE  146



>ref|XP_008371766.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Malus domestica]
 ref|XP_008371767.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like isoform 
X1 [Malus domestica]
Length=367

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+ LPKM +DYYASGAED+WTL EN+ AFSRILFRPRIL+DVSKID+ 
Sbjct  2    EITNVSEYEAIAKEXLPKMVYDYYASGAEDEWTLKENKRAFSRILFRPRILVDVSKIDLR  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLGF ISMPIMIAPTA QKMAHPEGE+ATARAASAA TIMTLSSW+TSSVEEVASTGP
Sbjct  62   TTVLGFNISMPIMIAPTAMQKMAHPEGEFATARAASAADTIMTLSSWSTSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRN+VAQLV+RAE
Sbjct  122  GIRFFQLYVYKDRNMVAQLVKRAE  145



>gb|KHN46072.1| Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Glycine soja]
Length=368

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVSKID
Sbjct  1    MEMITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILVDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            ++TTVLGFKISMPIMIAPTA QK+AHPEGE ATARAASAAGTIMTLSS A+SSVEEVAST
Sbjct  61   LTTTVLGFKISMPIMIAPTAMQKLAHPEGELATARAASAAGTIMTLSSCASSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            G  IRFFQLYV KDRNVVAQLVRRAE
Sbjct  121  GSDIRFFQLYVLKDRNVVAQLVRRAE  146



>ref|NP_001242385.1| uncharacterized protein LOC100782977 [Glycine max]
 gb|ACU23996.1| unknown [Glycine max]
Length=368

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVSKID
Sbjct  1    MEMITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLNENRNAFSRILFRPRILVDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            ++TTVLGFKISMPIMIAPTA QK+AHPEGE ATARAASAAGTIMTLSS A+SSVEEVAST
Sbjct  61   LTTTVLGFKISMPIMIAPTAMQKLAHPEGELATARAASAAGTIMTLSSCASSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            G  IRFFQLYV KDRNVVAQLVRRAE
Sbjct  121  GSDIRFFQLYVLKDRNVVAQLVRRAE  146



>ref|XP_006579405.1| PREDICTED: uncharacterized protein LOC100782977 isoform X1 [Glycine 
max]
Length=368

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVSKID
Sbjct  1    MEMITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLNENRNAFSRILFRPRILVDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            ++TTVLGFKISMPIMIAPTA QK+AHPEGE ATARAASAAGTIMTLSS A+SSVEEVAST
Sbjct  61   LTTTVLGFKISMPIMIAPTAMQKLAHPEGELATARAASAAGTIMTLSSCASSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            G  IRFFQLYV KDRNVVAQLVRRAE
Sbjct  121  GSDIRFFQLYVLKDRNVVAQLVRRAE  146



>ref|XP_010666716.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Beta 
vulgaris subsp. vulgaris]
Length=370

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M EITNV EYE +AK++LPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVS+ID
Sbjct  3    MMEITNVSEYEKLAKERLPKMIYDYYASGAEDQWTLEENRNAFSRILFRPRILIDVSQID  62

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            ++T VLGFKISMPIMIAPTA QKMAHPEGE+ATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  63   ITTKVLGFKISMPIMIAPTAMQKMAHPEGEFATARAASAAGTIMTLSSWATSSVEEVAST  122

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            G GIRFFQLYV +DRN VAQLV+RAE
Sbjct  123  GHGIRFFQLYVMRDRNFVAQLVKRAE  148



>emb|CDX78843.1| BnaA01g09100D [Brassica napus]
Length=368

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPR LIDVS+ID+S
Sbjct  2    EITNVMEYEKIAKDKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRSLIDVSEIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            T VLGF ISMPIM+APTA QKMAHP+GE ATARA SAAGTIMTLS+ AT SVEEVASTGP
Sbjct  62   TRVLGFNISMPIMVAPTAMQKMAHPDGELATARATSAAGTIMTLSTCATCSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  122  GIRFFQLYVYKDRNVVRQLVKRAE  145



>ref|XP_011460209.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460210.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Fragaria 
vesca subsp. vesca]
Length=368

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV E++ IAK+KLPKM +DYYASGAEDQWTL EN  AFSRILFRPRILIDVSKID
Sbjct  1    MEMITNVSEFQKIAKEKLPKMVYDYYASGAEDQWTLKENERAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            + TTVLGF ISMPIMIAPTA QKMAHPEGE+ATARAASAA TIMTLSSWATSSVEEVAST
Sbjct  61   LRTTVLGFNISMPIMIAPTAMQKMAHPEGEFATARAASAADTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRNVVAQLV++AE
Sbjct  121  GPGIRFFQLYVYKDRNVVAQLVKKAE  146



>ref|XP_001758665.1| predicted protein [Physcomitrella patens]
 gb|EDQ76643.1| predicted protein [Physcomitrella patens]
Length=368

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EI NV EYE +A++KLPKM +DYYASGAEDQWTL ENR+AF RI FRPRILIDV+K+D+S
Sbjct  5    EIVNVSEYEELARQKLPKMVYDYYASGAEDQWTLKENRSAFERIRFRPRILIDVTKVDLS  64

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            T VLGF ISMPIM+APTA Q+MAHP+GE ATARA + AGTIMTLSSW+TSSVEEVAS GP
Sbjct  65   TNVLGFNISMPIMVAPTAMQRMAHPDGELATARATAKAGTIMTLSSWSTSSVEEVASVGP  124

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVVAQLVRRAE
Sbjct  125  GIRFFQLYVYKDRNVVAQLVRRAE  148



>ref|XP_004976858.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO3-like isoform 
X1 [Setaria italica]
 ref|XP_004976859.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO3-like isoform 
X2 [Setaria italica]
Length=367

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYE +AK+KLPKM +DYYASGAEDQWTL ENR AFSRILFRPRILIDVS IDM+T
Sbjct  4    ITNVTEYEKLAKEKLPKMVYDYYASGAEDQWTLKENREAFSRILFRPRILIDVSHIDMTT  63

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
             VLGF ISMPIMIAPTA QKMAHPEGE ATARAA++AGTIMTLSSW+TSSVEEV S GPG
Sbjct  64   NVLGFNISMPIMIAPTAMQKMAHPEGELATARAAASAGTIMTLSSWSTSSVEEVNSVGPG  123

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDRN+V QLV+RAE
Sbjct  124  IRFFQLYVYKDRNIVRQLVKRAE  146



>ref|XP_009146514.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2-like [Brassica 
rapa]
Length=423

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 135/149 (91%), Gaps = 5/149 (3%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQWTL ENRNAF+RILFRPRILIDV+KIDM+
Sbjct  2    EITNVNEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVTKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIM+APTA QKMAHPEGE ATARA+SAAGTIMTLSSW TSSVEEVASTGP
Sbjct  62   TTILGFKISMPIMVAPTAMQKMAHPEGELATARASSAAGTIMTLSSWTTSSVEEVASTGP  121

Query  433  G-----IRFFQLYVYKDRNVVAQLVRRAE  504
            G     IRFFQL VYK+R VV QLVRRAE
Sbjct  122  GIRFFQIRFFQLQVYKNRKVVEQLVRRAE  150



>ref|XP_011082837.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Sesamum 
indicum]
Length=364

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M E+TNV EYEAIA++KLPKM +DYYASGAEDQWTLAEN  AFSRILFRPRILIDVSKID
Sbjct  1    MAEVTNVSEYEAIAREKLPKMVYDYYASGAEDQWTLAENTRAFSRILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+  VLGFKISMPIMIAPTA QKMAHP GE ATARAASAAGTIM LSSW+TSSVEEVAST
Sbjct  61   MTANVLGFKISMPIMIAPTAMQKMAHPHGECATARAASAAGTIMILSSWSTSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQL VYKDR+VV +LVRR E
Sbjct  121  GPGIRFFQLSVYKDRHVVERLVRRVE  146



>ref|XP_003557652.2| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Brachypodium 
distachyon]
Length=659

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 140/152 (92%), Gaps = 2/152 (1%)
 Frame = +1

Query  55   KGAKMGEIT--NVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILI  228
            +G KMGE+T  NV EY+AIAK+KLPKM +DYYASGAED+WTL ENR AF+RILFRPRILI
Sbjct  285  EGGKMGEVTVTNVTEYQAIAKQKLPKMIYDYYASGAEDEWTLQENREAFARILFRPRILI  344

Query  229  DVSKIDMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSV  408
            DVSKIDM+  VLGFK+SMPIMIAP+A QKMAHP+GEYATARAASAAGTIMTLSSWATSSV
Sbjct  345  DVSKIDMTANVLGFKLSMPIMIAPSAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSV  404

Query  409  EEVASTGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            EEVASTGPGIRFFQLYVYK+R VV QLVRRAE
Sbjct  405  EEVASTGPGIRFFQLYVYKNRKVVEQLVRRAE  436



>gb|KHG00838.1| Peroxisomal [Gossypium arboreum]
Length=368

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV EYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKI+
Sbjct  1    MEMITNVSEYEVIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIN  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M TT+LGF+ISMPIM+APTA QKMAHPEGE ATARAAS AGTIMTLS++A SSVEEVAST
Sbjct  61   MMTTILGFRISMPIMVAPTAMQKMAHPEGECATARAASDAGTIMTLSTYANSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
              GIRFFQLYV+KDRN+VAQLVRRAE
Sbjct  121  RSGIRFFQLYVHKDRNLVAQLVRRAE  146



>emb|CDX97573.1| BnaA05g25060D [Brassica napus]
Length=381

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 135/149 (91%), Gaps = 5/149 (3%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DY+ASGAED+WTL ENRN+F+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKMVYDYFASGAEDEWTLQENRNSFARILFRPRILIDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIM LSSW TSSVEEVASTGP
Sbjct  62   TTILGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMILSSWTTSSVEEVASTGP  121

Query  433  G-----IRFFQLYVYKDRNVVAQLVRRAE  504
            G     IRFFQL VYK+R VV QLVRRAE
Sbjct  122  GIQFFQIRFFQLQVYKNRKVVEQLVRRAE  150



>ref|XP_006652849.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO3-like [Oryza 
brachyantha]
Length=367

 Score =   237 bits (605),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYE +AK+KLPKM +DYYASGAEDQWTL ENR AFSRILFRPRILI+VS+I+M+T
Sbjct  4    ITNVSEYEQLAKQKLPKMIYDYYASGAEDQWTLKENREAFSRILFRPRILINVSRINMAT  63

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
             VLGF ISMPIMIAP+A QKMAHPEGE ATARAA+A GTIMTLSSW+TSSVEEV S GPG
Sbjct  64   NVLGFNISMPIMIAPSAMQKMAHPEGELATARAAAAEGTIMTLSSWSTSSVEEVNSVGPG  123

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDRN+V QLVRRAE
Sbjct  124  IRFFQLYVYKDRNIVRQLVRRAE  146



>ref|XP_003580580.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO3 [Brachypodium 
distachyon]
Length=373

 Score =   237 bits (605),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYE +AK+KLPKM +DYYASGAEDQWTL ENR+AFSRILFRPR+LIDVS I+M+T
Sbjct  6    ITNVSEYEKLAKEKLPKMVYDYYASGAEDQWTLKENRDAFSRILFRPRVLIDVSHINMAT  65

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
             VLGF ISMPIMIAPTA Q+MAHPEGE ATARAA++AGTIMTLSSWATSSVEEV S GPG
Sbjct  66   NVLGFNISMPIMIAPTAMQRMAHPEGELATARAAASAGTIMTLSSWATSSVEEVNSVGPG  125

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDR +V QLVRRAE
Sbjct  126  IRFFQLYVYKDRTIVRQLVRRAE  148



>ref|XP_002447118.1| hypothetical protein SORBIDRAFT_06g028990 [Sorghum bicolor]
 gb|EES11446.1| hypothetical protein SORBIDRAFT_06g028990 [Sorghum bicolor]
Length=367

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYE +AK+KLPKM +DYYASGAEDQWTL ENR AFSRILFRPR+LIDVS+IDM+T
Sbjct  4    ITNVTEYEKLAKEKLPKMVYDYYASGAEDQWTLKENREAFSRILFRPRVLIDVSRIDMAT  63

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
             VLGF ISMPIMIAP+A QKMAHP+GE ATARAA++AGTIMTLSSW+TSSV+EV S GPG
Sbjct  64   NVLGFNISMPIMIAPSAMQKMAHPDGELATARAAASAGTIMTLSSWSTSSVDEVNSVGPG  123

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDRN+V QLV+RAE
Sbjct  124  IRFFQLYVYKDRNIVRQLVKRAE  146



>dbj|BAG87371.1| unnamed protein product [Oryza sativa Japonica Group]
Length=365

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYE +AK+KLPKM +DYYASGAEDQWTL ENR AFSRILFRPRILIDVS+I+M+T
Sbjct  4    ITNVSEYEQLAKQKLPKMIYDYYASGAEDQWTLKENREAFSRILFRPRILIDVSRINMAT  63

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
             VLGF ISMPIMIAP+A QKMAHPEGE ATARAASAAGTIMTLSSW+TSSVEEV S  PG
Sbjct  64   NVLGFNISMPIMIAPSAMQKMAHPEGELATARAASAAGTIMTLSSWSTSSVEEVNSAAPG  123

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDRN+V QLVRRAE
Sbjct  124  IRFFQLYVYKDRNIVRQLVRRAE  146



>ref|NP_001053925.1| Os04g0623500 [Oryza sativa Japonica Group]
 sp|Q7FAS1.1|GLO3_ORYSJ RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO3; AltName: 
Full=Glycolate oxidase 3; Short=GOX 3; Short=OsGLO3; 
AltName: Full=Short chain alpha-hydroxy acid oxidase GLO3 [Oryza 
sativa Japonica Group]
 sp|B8AUI3.1|GLO3_ORYSI RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO3; AltName: 
Full=Glycolate oxidase 3; Short=GOX 3; Short=OsGLO3; 
AltName: Full=Short chain alpha-hydroxy acid oxidase GLO3 [Oryza 
sativa Indica Group]
 emb|CAE03500.2| OSJNBa0053K19.8 [Oryza sativa Japonica Group]
 dbj|BAF15839.1| Os04g0623500 [Oryza sativa Japonica Group]
 emb|CAH66796.1| H0215F08.7 [Oryza sativa Indica Group]
 dbj|BAG91005.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78043.1| hypothetical protein OsI_17479 [Oryza sativa Indica Group]
 gb|EEE61716.1| hypothetical protein OsJ_16217 [Oryza sativa Japonica Group]
Length=367

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYE +AK+KLPKM +DYYASGAEDQWTL ENR AFSRILFRPRILIDVS+I+M+T
Sbjct  4    ITNVSEYEQLAKQKLPKMIYDYYASGAEDQWTLKENREAFSRILFRPRILIDVSRINMAT  63

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
             VLGF ISMPIMIAP+A QKMAHPEGE ATARAASAAGTIMTLSSW+TSSVEEV S  PG
Sbjct  64   NVLGFNISMPIMIAPSAMQKMAHPEGELATARAASAAGTIMTLSSWSTSSVEEVNSAAPG  123

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDRN+V QLVRRAE
Sbjct  124  IRFFQLYVYKDRNIVRQLVRRAE  146



>gb|ACN25627.1| unknown [Zea mays]
Length=367

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYE +AK++LPKM +DYYASGAEDQWTL ENR AFSRILFRPR+LIDVS+IDM+T
Sbjct  4    ITNVTEYEKLAKERLPKMVYDYYASGAEDQWTLKENREAFSRILFRPRVLIDVSRIDMAT  63

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
             +LGF ISMPIMIAP+A QKMAHP+GE ATARAA++AGTIMTLSSW+TSSVEEV S GPG
Sbjct  64   NILGFSISMPIMIAPSAMQKMAHPDGELATARAAASAGTIMTLSSWSTSSVEEVNSVGPG  123

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDRN+V QLV+RAE
Sbjct  124  IRFFQLYVYKDRNIVRQLVKRAE  146



>tpg|DAA35953.1| TPA: hypothetical protein ZEAMMB73_047023 [Zea mays]
Length=362

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYE +AK++LPKM +DYYASGAEDQWTL ENR AFSRILFRPR+LIDVS+IDM+T
Sbjct  36   ITNVTEYEKLAKERLPKMVYDYYASGAEDQWTLKENREAFSRILFRPRVLIDVSRIDMAT  95

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
             +LGF ISMPIMIAP+A QKMAHP+GE ATARAA++AGTIMTLSSW+TSSVEEV S GPG
Sbjct  96   NILGFSISMPIMIAPSAMQKMAHPDGELATARAAASAGTIMTLSSWSTSSVEEVNSVGPG  155

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDRN+V QLV+RAE
Sbjct  156  IRFFQLYVYKDRNIVRQLVKRAE  178



>tpg|DAA35954.1| TPA: hypothetical protein ZEAMMB73_047023 [Zea mays]
Length=399

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYE +AK++LPKM +DYYASGAEDQWTL ENR AFSRILFRPR+LIDVS+IDM+T
Sbjct  36   ITNVTEYEKLAKERLPKMVYDYYASGAEDQWTLKENREAFSRILFRPRVLIDVSRIDMAT  95

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
             +LGF ISMPIMIAP+A QKMAHP+GE ATARAA++AGTIMTLSSW+TSSVEEV S GPG
Sbjct  96   NILGFSISMPIMIAPSAMQKMAHPDGELATARAAASAGTIMTLSSWSTSSVEEVNSVGPG  155

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDRN+V QLV+RAE
Sbjct  156  IRFFQLYVYKDRNIVRQLVKRAE  178



>dbj|BAJ94716.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV EYE +AK+KLPKM +DYYASGAEDQWTL ENR AFSRILFRPR+LIDVS I+
Sbjct  3    MEMITNVSEYERLAKEKLPKMVYDYYASGAEDQWTLNENREAFSRILFRPRVLIDVSHIN  62

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            M+T++LGF +SMPIMIAPTA QKMAHPEGE ATARAA++AGTIMTLSSWATSSVE V S 
Sbjct  63   MATSILGFDVSMPIMIAPTAMQKMAHPEGELATARAAASAGTIMTLSSWATSSVERVNSV  122

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPGIRFFQLYVYKDRN+V QLV+RAE
Sbjct  123  GPGIRFFQLYVYKDRNIVRQLVKRAE  148



>gb|EMT00832.1| Peroxisomal (S)-2-hydroxy-acid oxidase [Aegilops tauschii]
Length=375

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYE +AK+KLPKM +DYYASGAEDQWTL ENR AFSRILFRPR+LIDVS I+M+T
Sbjct  4    ITNVSEYERLAKEKLPKMVYDYYASGAEDQWTLNENREAFSRILFRPRVLIDVSHINMAT  63

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
             +LGF +SMPIMIAPTA QKMAHPEGE ATARAA++AGTIMTLSSWATSSVE V S GPG
Sbjct  64   NILGFDVSMPIMIAPTAMQKMAHPEGELATARAAASAGTIMTLSSWATSSVERVNSVGPG  123

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRFFQLYVYKDRN+V QLV+RAE
Sbjct  124  IRFFQLYVYKDRNIVRQLVKRAE  146



>gb|KHN46073.1| Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Glycine soja]
Length=371

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 134/144 (93%), Gaps = 1/144 (1%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYEAIAK+KLPKM +D+YASGAEDQWTL ENRNAFSRILF+PRILIDVSKID++T
Sbjct  6    ITNVTEYEAIAKEKLPKMVYDFYASGAEDQWTLKENRNAFSRILFQPRILIDVSKIDLTT  65

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
            TV+GFKISMPIMIAPTA QKMAHPEGE ATARAASAAGTIMTLSS ATSSVEEVASTGPG
Sbjct  66   TVMGFKISMPIMIAPTAMQKMAHPEGELATARAASAAGTIMTLSSTATSSVEEVASTGPG  125

Query  436  IRFFQ-LYVYKDRNVVAQLVRRAE  504
            I FF  ++V KDRNVVAQ+VRRAE
Sbjct  126  IHFFNFMWVLKDRNVVAQVVRRAE  149



>emb|CDX99474.1| BnaC01g10780D [Brassica napus]
Length=368

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPK+ +DYYASGAEDQWTL ENRNAFSRILFRPRIL DVS+ID+S
Sbjct  2    EITNVMEYEKIAKEKLPKLVYDYYASGAEDQWTLQENRNAFSRILFRPRILKDVSEIDVS  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            T VLGF ISMPIM+APTA QKMAHP+GE ATARA SAAGTIMTLS+ AT SV+EVASTGP
Sbjct  62   TRVLGFNISMPIMVAPTAMQKMAHPDGELATARATSAAGTIMTLSTCATCSVDEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVY+DR VV QL +RAE
Sbjct  122  GIRFFQLYVYEDRYVVRQLAKRAE  145



>ref|XP_009131609.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Brassica 
rapa]
Length=366

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 2/144 (1%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNVMEYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRIL  PRIL DVS+ID+S
Sbjct  2    EITNVMEYEKIAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRIL--PRILKDVSEIDVS  59

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            T VLGF ISMPIM+APTA QKMAHP+GE ATARA SAAGTIMTLS+ AT SVEEVASTGP
Sbjct  60   TRVLGFNISMPIMVAPTAMQKMAHPDGELATARATSAAGTIMTLSTCATCSVEEVASTGP  119

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYKDRNVV QLV+RAE
Sbjct  120  GIRFFQLYVYKDRNVVRQLVKRAE  143



>emb|CDY25425.1| BnaC09g39400D [Brassica napus]
 emb|CDX81437.1| BnaC09g08480D [Brassica napus]
 emb|CDX68646.1| BnaC01g08070D [Brassica napus]
Length=357

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 129/144 (90%), Gaps = 10/144 (7%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM          DQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKM----------DQWTLQENRNAFARILFRPRILIDVSKIDMT  51

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  52   TTILGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  111

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  112  GIRFFQLYVYKNRKVVEQLVRRAE  135



>emb|CDY33220.1| BnaC01g36930D [Brassica napus]
Length=357

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 129/144 (90%), Gaps = 10/144 (7%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM          DQWTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKM----------DQWTLQENRNAFARILFRPRILIDVSKIDMT  51

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP
Sbjct  52   TTILGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP  111

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYVYK+R VV QLVRRAE
Sbjct  112  GIRFFQLYVYKNRKVVEQLVRRAE  135



>gb|ABB02645.1| crystallinum glycolate oxidase-like [Solanum tuberosum]
Length=139

 Score =   223 bits (567),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  +TN MEYE +AK++LPKM +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVS ID
Sbjct  1    MESVTNAMEYEILAKERLPKMIYDYYASGAEDQWTLQENRNAFSRILFRPRILVDVSNID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
             +T+VLGFKISMPIM+APTA QKMAHPEGEYATARA SAAGTIMTLSSW TSSVEEVAST
Sbjct  61   TTTSVLGFKISMPIMVAPTAMQKMAHPEGEYATARATSAAGTIMTLSSWGTSSVEEVAST  120

Query  427  GPGIRFFQLYV  459
            GPGIRFFQLYV
Sbjct  121  GPGIRFFQLYV  131



>gb|AAB82143.1| glycolate oxidase [Oryza sativa Indica Group]
Length=369

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            MGEITNVMEY+AIA + LPKM +DYY+SGAED WTL ENR AFS ILFRPRILIDVSKID
Sbjct  1    MGEITNVMEYQAIANQNLPKMIYDYYSSGAEDDWTLKENREAFSAILFRPRILIDVSKID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MS TVLGFKISMPIMIAP+A QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVAST
Sbjct  61   MSATVLGFKISMPIMIAPSAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVAST  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG  F  LY+ KDRNVV  LV++ +
Sbjct  121  GPGNPFLHLYLCKDRNVVEHLVKKTK  146



>gb|AFK45327.1| unknown [Medicago truncatula]
Length=188

 Score =   221 bits (564),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  76   ITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMST  255
            ITNV EYEAIAK+K+PKM FD+YASGAED+WTL ENRNAFSRILFRPRILIDVSKID++T
Sbjct  3    ITNVSEYEAIAKQKVPKMIFDHYASGAEDEWTLKENRNAFSRILFRPRILIDVSKIDLTT  62

Query  256  TVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPG  435
            TV G KISMPIM+APT   +MAH EGE ATARAASAAGTIMTL++ AT SVEEVASTGPG
Sbjct  63   TVFGSKISMPIMVAPTGQHQMAHLEGECATARAASAAGTIMTLATGATFSVEEVASTGPG  122

Query  436  IRFFQLYVYKDRNVVAQLVRRAE  504
            IRF QLY++KDRNV  QLVRRAE
Sbjct  123  IRFLQLYMFKDRNVATQLVRRAE  145



>ref|XP_008779285.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like, partial 
[Phoenix dactylifera]
Length=185

 Score =   221 bits (563),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM +DYYASGAEDQW+L ENR AFSRILFRP +L+DVSKIDM+
Sbjct  2    EITNVSEYEAIAKQKLPKMVYDYYASGAEDQWSLRENRAAFSRILFRPHVLVDVSKIDMT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TTVLG+ ISMPIMIAPTA  KMAHPEGEYA ARAASA+GTIMTLSS +TSSVEEVASTGP
Sbjct  62   TTVLGYNISMPIMIAPTAMLKMAHPEGEYAVARAASASGTIMTLSSVSTSSVEEVASTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRFFQLYV+KDRN+VAQLV+ AE
Sbjct  122  GIRFFQLYVFKDRNIVAQLVKIAE  145



>ref|NP_001030694.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Arabidopsis thaliana]
 dbj|BAH20203.1| AT3G14420 [Arabidopsis thaliana]
 gb|AEE75521.1| peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Arabidopsis thaliana]
Length=348

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +1

Query  127  MAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMSTTVLGFKISMPIMIAPTA  306
            M +DYYASGAEDQWTL ENRNAF+RILFRPRILIDVSKIDM+TTVLGFKISMPIM+APTA
Sbjct  1    MVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMTTTVLGFKISMPIMVAPTA  60

Query  307  FQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQ  486
             QKMAHP+GEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYK+RNVV Q
Sbjct  61   MQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRNVVEQ  120

Query  487  LVRRAE  504
            LVRRAE
Sbjct  121  LVRRAE  126



>gb|KHG25666.1| Peroxisomal (S)-2-hydroxy-acid oxidase [Gossypium arboreum]
Length=350

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +1

Query  127  MAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMSTTVLGFKISMPIMIAPTA  306
            M +DYYASGAEDQWTL ENR AF++ILFRPRILIDVSKIDM+TTVLGFKISMPIMIAPTA
Sbjct  1    MVYDYYASGAEDQWTLHENRFAFTKILFRPRILIDVSKIDMTTTVLGFKISMPIMIAPTA  60

Query  307  FQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQ  486
             QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQ
Sbjct  61   MQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQ  120

Query  487  LVRRAE  504
            LVRRAE
Sbjct  121  LVRRAE  126



>gb|KHG25665.1| Peroxisomal (S)-2-hydroxy-acid oxidase [Gossypium arboreum]
Length=350

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +1

Query  127  MAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMSTTVLGFKISMPIMIAPTA  306
            M +DYYASGAEDQWTL ENR AF++ILFRPRILIDVSKIDM+TTVLGFKISMPIMIAPTA
Sbjct  1    MVYDYYASGAEDQWTLHENRFAFTKILFRPRILIDVSKIDMTTTVLGFKISMPIMIAPTA  60

Query  307  FQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQ  486
             QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQ
Sbjct  61   MQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQ  120

Query  487  LVRRAE  504
            LVRRAE
Sbjct  121  LVRRAE  126



>ref|XP_004504561.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase-like [Cicer 
arietinum]
Length=367

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
             ITNV EYEAIAK+KL KM +DYYASGAEDQWTL ENRNAFSRILF+PRIL+DVSKID++
Sbjct  2    NITNVSEYEAIAKEKLSKMIYDYYASGAEDQWTLRENRNAFSRILFKPRILMDVSKIDLT  61

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            T VLGF ISMPIMIAPTA QKMAHP+GEYATARAAS AGTIMTLSSWA+SSVEEV+STGP
Sbjct  62   TNVLGFNISMPIMIAPTALQKMAHPQGEYATARAASVAGTIMTLSSWASSSVEEVSSTGP  121

Query  433  GIRFFQLYVYKDRNVVAQLVRRAE  504
            GIRF QLYV+KDR++V QL+RRAE
Sbjct  122  GIRFLQLYVFKDRSMVTQLLRRAE  145



>ref|NP_001241915.1| uncharacterized protein LOC100800520 [Glycine max]
 gb|ACU21609.1| unknown [Glycine max]
Length=348

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  127  MAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMSTTVLGFKISMPIMIAPTA  306
            M +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVSKID++ TVLGFKISMPIMIAPTA
Sbjct  1    MVYDYYASGAEDQWTLKENRNAFSRILFRPRILVDVSKIDLTATVLGFKISMPIMIAPTA  60

Query  307  FQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQ  486
             QKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEVASTGP IRFFQLYV+KDRNVVAQ
Sbjct  61   MQKMAHPEGELATARAASAAGTIMTLSSWATSSVEEVASTGPDIRFFQLYVFKDRNVVAQ  120

Query  487  LVRRAE  504
            LVRRAE
Sbjct  121  LVRRAE  126



>ref|XP_006585086.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Glycine 
max]
Length=305

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +1

Query  64   KMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKI  243
            KM  ITNV EYEA+AK+ LPKM +D+YASGAEDQWTL ENRNAFSRILFR RIL+D+SKI
Sbjct  2    KMDMITNVTEYEAVAKENLPKMVYDFYASGAEDQWTLKENRNAFSRILFRLRILVDLSKI  61

Query  244  DMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAS  423
            D++TTVLGFKISMPIMIAPTA QKMAHPEGE  TARAASAAGTIMTLSS ATSSVEEVAS
Sbjct  62   DLTTTVLGFKISMPIMIAPTAKQKMAHPEGELDTARAASAAGTIMTLSSTATSSVEEVAS  121

Query  424  TGPGIRFFQLYVYKDRNVVAQLVRRAE  504
              P   FF  YV KD+NVVAQLVRRAE
Sbjct  122  FFP--HFFFPYVLKDKNVVAQLVRRAE  146



>emb|CDX98451.1| BnaC05g39240D [Brassica napus]
Length=306

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 127/149 (85%), Gaps = 15/149 (10%)
 Frame = +1

Query  73   EITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMS  252
            EITNV EYEAIAK+KLPKM          D+WTL ENRNAF+RILFRPRILIDVSKIDM+
Sbjct  2    EITNVTEYEAIAKEKLPKM----------DEWTLQENRNAFARILFRPRILIDVSKIDMT  51

Query  253  TTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGP  432
            TT+LGFKISMPIM+APTA QKMAHPEGEYATARAASAAGTIMTLSSW TSSVEEVASTGP
Sbjct  52   TTILGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWTTSSVEEVASTGP  111

Query  433  G-----IRFFQLYVYKDRNVVAQLVRRAE  504
            G     IRFFQL VYK+R VV QLVRRAE
Sbjct  112  GIRFFQIRFFQLQVYKNRKVVEQLVRRAE  140



>ref|XP_008668180.1| PREDICTED: hydroxyacid oxidase 1 isoform X4 [Zea mays]
 gb|ACF81488.1| unknown [Zea mays]
 tpg|DAA35947.1| TPA: hypothetical protein ZEAMMB73_697207 [Zea mays]
Length=366

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV +YE +AK+KLPKM +D+YA GAEDQWTL EN+ AFS+ILFRPR+LIDVS ID
Sbjct  1    MALITNVSDYEELAKQKLPKMVYDFYAGGAEDQWTLKENKEAFSKILFRPRVLIDVSHID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MST++LG+KISMPIM+APTA  K+AH EGE A+A+AA+AAGTIMTLSSW++ S+EEV+S 
Sbjct  61   MSTSILGYKISMPIMVAPTALHKLAHQEGEVASAQAAAAAGTIMTLSSWSSCSIEEVSSI  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
             PG+RFFQL V+KDR++V QLVRRAE
Sbjct  121  APGLRFFQLSVFKDRDIVQQLVRRAE  146



>gb|EYU33378.1| hypothetical protein MIMGU_mgv1a009261mg [Erythranthe guttata]
Length=348

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  127  MAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMSTTVLGFKISMPIMIAPTA  306
            M +DYYASGAEDQWTL ENRNAFSRILFRPRIL+DVS ID++TT++G+KISMPIM+APTA
Sbjct  1    MVYDYYASGAEDQWTLHENRNAFSRILFRPRILVDVSNIDITTTIMGYKISMPIMVAPTA  60

Query  307  FQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQ  486
             QKMAHPEGE+ATARAASAAGTIMTLSSW TSSVEEVASTGPG RFFQLYV+KDRNVV Q
Sbjct  61   MQKMAHPEGEFATARAASAAGTIMTLSSWGTSSVEEVASTGPGTRFFQLYVFKDRNVVKQ  120

Query  487  LVRRAE  504
            LVRRAE
Sbjct  121  LVRRAE  126



>ref|XP_008668177.1| PREDICTED: hydroxyacid oxidase 1 isoform X3 [Zea mays]
Length=370

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV +YE +AK+KLPKM +D+YA GAEDQWTL EN+ AFS+ILFRPR+LIDVS ID
Sbjct  1    MALITNVSDYEELAKQKLPKMVYDFYAGGAEDQWTLKENKEAFSKILFRPRVLIDVSHID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MST++LG+KISMPIM+APTA  K+AH EGE A+A+AA+AAGTIMTLSSW++ S+EEV+S 
Sbjct  61   MSTSILGYKISMPIMVAPTALHKLAHQEGEVASAQAAAAAGTIMTLSSWSSCSIEEVSSI  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
             PG+RFFQL V+KDR++V QLVRRAE
Sbjct  121  APGLRFFQLSVFKDRDIVQQLVRRAE  146



>ref|XP_008668179.1| PREDICTED: hydroxyacid oxidase 1 isoform X1 [Zea mays]
 gb|ACF86334.1| unknown [Zea mays]
 tpg|DAA35948.1| TPA: hydroxyacid oxidase 1 isoform 1 [Zea mays]
 tpg|DAA35949.1| TPA: hydroxyacid oxidase 1 isoform 2 [Zea mays]
Length=368

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV +YE +AK+KLPKM +D+YA GAEDQWTL EN+ AFS+ILFRPR+LIDVS ID
Sbjct  1    MALITNVSDYEELAKQKLPKMVYDFYAGGAEDQWTLKENKEAFSKILFRPRVLIDVSHID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MST++LG+KISMPIM+APTA  K+AH EGE A+A+AA+AAGTIMTLSSW++ S+EEV+S 
Sbjct  61   MSTSILGYKISMPIMVAPTALHKLAHQEGEVASAQAAAAAGTIMTLSSWSSCSIEEVSSI  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
             PG+RFFQL V+KDR++V QLVRRAE
Sbjct  121  APGLRFFQLSVFKDRDIVQQLVRRAE  146



>ref|XP_008668174.1| PREDICTED: hydroxyacid oxidase 1 isoform X2 [Zea mays]
 ref|XP_008668175.1| PREDICTED: hydroxyacid oxidase 1 isoform X2 [Zea mays]
 ref|XP_008668176.1| PREDICTED: hydroxyacid oxidase 1 isoform X2 [Zea mays]
 tpg|DAA35950.1| TPA: hypothetical protein ZEAMMB73_697207 [Zea mays]
Length=372

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV +YE +AK+KLPKM +D+YA GAEDQWTL EN+ AFS+ILFRPR+LIDVS ID
Sbjct  1    MALITNVSDYEELAKQKLPKMVYDFYAGGAEDQWTLKENKEAFSKILFRPRVLIDVSHID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MST++LG+KISMPIM+APTA  K+AH EGE A+A+AA+AAGTIMTLSSW++ S+EEV+S 
Sbjct  61   MSTSILGYKISMPIMVAPTALHKLAHQEGEVASAQAAAAAGTIMTLSSWSSCSIEEVSSI  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
             PG+RFFQL V+KDR++V QLVRRAE
Sbjct  121  APGLRFFQLSVFKDRDIVQQLVRRAE  146



>ref|XP_002447119.1| hypothetical protein SORBIDRAFT_06g029000 [Sorghum bicolor]
 gb|EES11447.1| hypothetical protein SORBIDRAFT_06g029000 [Sorghum bicolor]
Length=367

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITN+ +YE +A++KLPKM +D+YA GAEDQWTL EN+ AFS+ILFRPR+LIDVS+ID
Sbjct  1    MALITNLSDYEELARQKLPKMVYDFYAGGAEDQWTLKENKEAFSKILFRPRVLIDVSRID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MST++LG+KISMPIM+APTA  K+AH EGE A+A+A +AAGTIMTLSSW++ S+EEV S+
Sbjct  61   MSTSILGYKISMPIMVAPTALHKLAHREGEVASAQATAAAGTIMTLSSWSSCSIEEVNSS  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
             PG+RFFQL V+KDR++V QLVRRAE
Sbjct  121  APGLRFFQLSVFKDRDIVQQLVRRAE  146



>ref|NP_001152347.1| hydroxyacid oxidase 1 [Zea mays]
 gb|ACG47158.1| hydroxyacid oxidase 1 [Zea mays]
Length=368

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV +YE +A++KLPKM +D+YA GAEDQWTL EN+ AFS+IL RPR+LIDVS ID
Sbjct  1    MALITNVSDYEELAEQKLPKMVYDFYAGGAEDQWTLKENKGAFSKILVRPRVLIDVSHID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MST++LG+KISMPIM+APTA  K+AH EGE A+A+AA+AAGTIMTLSSW++ S+EEV+S+
Sbjct  61   MSTSILGYKISMPIMVAPTALHKLAHQEGEVASAQAAAAAGTIMTLSSWSSCSIEEVSSS  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
             PG+RFFQL V+KDR++V QLVRRAE
Sbjct  121  APGLRFFQLSVFKDRDIVQQLVRRAE  146



>emb|CAH66797.1| H0215F08.8 [Oryza sativa Indica Group]
Length=276

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  +TNV EYE +AK KLPKM +D+YA+GAEDQWTL EN  AFSRILF+PR+L+DVS ID
Sbjct  1    MALVTNVCEYEELAKHKLPKMVYDFYAAGAEDQWTLRENSEAFSRILFQPRVLVDVSCID  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MS +VLG+ ISMPIMIAPTA  K+AHPEGE ATARAA+AA TIMTLSSW++ S+EEV   
Sbjct  61   MSMSVLGYNISMPIMIAPTALHKLAHPEGELATARAAAAAETIMTLSSWSSCSIEEVNLA  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG+RFFQL +YKDRN+V QL++RAE
Sbjct  121  GPGVRFFQLSIYKDRNLVQQLIQRAE  146



>gb|KHG00837.1| Peroxisomal [Gossypium arboreum]
Length=399

 Score =   213 bits (541),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 124/177 (70%), Gaps = 31/177 (18%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV EYE IAK+KLPKM +DYYASGAEDQWTL ENRNAFSRILFRPRILIDVSKI+
Sbjct  1    MEMITNVSEYEVIAKEKLPKMVYDYYASGAEDQWTLKENRNAFSRILFRPRILIDVSKIN  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYata----------raasaaGTIM------  378
            M TT+LGF+ISMPIM+APTA QKMAHPEG Y  +                G +       
Sbjct  61   MMTTILGFRISMPIMVAPTAMQKMAHPEGTYGCSWKRHYNLYRKENVQQLGQLQMLEQSW  120

Query  379  ---------------TLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAE  504
                           TLS++A SSVEEVAST  GIRFFQLYV+KDRN+VAQLVRRAE
Sbjct  121  FASLRLTVNSVRNRSTLSTYANSSVEEVASTRSGIRFFQLYVHKDRNLVAQLVRRAE  177



>ref|XP_004976860.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2-like isoform 
X1 [Setaria italica]
Length=370

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +1

Query  64   KMGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKI  243
            +M  ITNV +YE +AK+KL KM +D+YA+GAEDQ TL ENR AFSRILFRPR+LIDVS I
Sbjct  3    EMALITNVSDYEELAKQKLSKMVYDFYAAGAEDQRTLKENREAFSRILFRPRVLIDVSCI  62

Query  244  DMSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAS  423
            +MS +VLG+ ISMPIM+APTA  K+AHPEGE A+ARA +AAGTIM LSSW++ S+EEV S
Sbjct  63   NMSMSVLGYNISMPIMVAPTALHKLAHPEGEVASARATAAAGTIMMLSSWSSYSIEEVNS  122

Query  424  TGPGIRFFQLYVYKDRNVVAQLVRRAE  504
            +GPG+RFFQL V+KDRN V QLVRRAE
Sbjct  123  SGPGLRFFQLSVFKDRNFVQQLVRRAE  149



>ref|XP_004976861.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2-like isoform 
X2 [Setaria italica]
 ref|XP_004976862.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2-like isoform 
X3 [Setaria italica]
 ref|XP_004976863.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO2-like isoform 
X4 [Setaria italica]
Length=367

 Score =   209 bits (532),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +1

Query  67   MGEITNVMEYEAIAKKKLPKMAFDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKID  246
            M  ITNV +YE +AK+KL KM +D+YA+GAEDQ TL ENR AFSRILFRPR+LIDVS I+
Sbjct  1    MALITNVSDYEELAKQKLSKMVYDFYAAGAEDQRTLKENREAFSRILFRPRVLIDVSCIN  60

Query  247  MSTTVLGFKISMPIMIAPTAFQKMAHPEGEYataraasaaGTIMTLSSWATSSVEEVAST  426
            MS +VLG+ ISMPIM+APTA  K+AHPEGE A+ARA +AAGTIM LSSW++ S+EEV S+
Sbjct  61   MSMSVLGYNISMPIMVAPTALHKLAHPEGEVASARATAAAGTIMMLSSWSSYSIEEVNSS  120

Query  427  GPGIRFFQLYVYKDRNVVAQLVRRAE  504
            GPG+RFFQL V+KDRN V QLVRRAE
Sbjct  121  GPGLRFFQLSVFKDRNFVQQLVRRAE  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905