BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F23

Length=423
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010690130.1|  PREDICTED: GDSL esterase/lipase APG-like           189   7e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009612468.1|  PREDICTED: GDSL esterase/lipase APG                186   2e-54   Nicotiana tomentosiformis
ref|XP_008375835.1|  PREDICTED: GDSL esterase/lipase APG-like           186   2e-54   Malus domestica [apple tree]
dbj|BAM08277.1|  zinc finger protein                                    186   2e-54   Malus domestica [apple tree]
ref|XP_009344493.1|  PREDICTED: GDSL esterase/lipase APG-like           186   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_008358081.1|  PREDICTED: GDSL esterase/lipase APG-like           186   3e-54   
ref|XP_008380836.1|  PREDICTED: GDSL esterase/lipase APG-like           186   3e-54   
ref|XP_009337919.1|  PREDICTED: GDSL esterase/lipase APG-like           185   4e-54   Pyrus x bretschneideri [bai li]
ref|XP_009759976.1|  PREDICTED: GDSL esterase/lipase APG                185   4e-54   Nicotiana sylvestris
emb|CDO97957.1|  unnamed protein product                                184   7e-54   Coffea canephora [robusta coffee]
ref|XP_008228396.1|  PREDICTED: GDSL esterase/lipase APG                184   1e-53   Prunus mume [ume]
ref|XP_010654595.1|  PREDICTED: GDSL esterase/lipase APG-like           182   3e-53   Vitis vinifera
ref|XP_003597654.1|  GDSL esterase/lipase APG                           182   4e-53   Medicago truncatula
ref|XP_006343026.1|  PREDICTED: GDSL esterase/lipase APG-like           182   4e-53   Solanum tuberosum [potatoes]
ref|XP_009343018.1|  PREDICTED: GDSL esterase/lipase APG-like           182   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_006298028.1|  hypothetical protein CARUB_v10014074mg             182   5e-53   Capsella rubella
ref|XP_004235632.1|  PREDICTED: GDSL esterase/lipase APG-like           182   5e-53   Solanum lycopersicum
gb|KDO38517.1|  hypothetical protein CISIN_1g018227mg                   178   6e-53   Citrus sinensis [apfelsine]
gb|KDO38518.1|  hypothetical protein CISIN_1g018227mg                   178   6e-53   Citrus sinensis [apfelsine]
ref|XP_007215590.1|  hypothetical protein PRUPE_ppa007650mg             182   7e-53   Prunus persica
ref|XP_003543615.1|  PREDICTED: GDSL esterase/lipase APG-like           181   8e-53   Glycine max [soybeans]
gb|KHN30020.1|  GDSL esterase/lipase APG                                181   8e-53   Glycine soja [wild soybean]
ref|XP_010465660.1|  PREDICTED: GDSL esterase/lipase APG                181   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010504217.1|  PREDICTED: GDSL esterase/lipase APG-like           181   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010487495.1|  PREDICTED: GDSL esterase/lipase APG-like           181   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006406840.1|  hypothetical protein EUTSA_v10021008mg             181   2e-52   Eutrema salsugineum [saltwater cress]
ref|XP_010267093.1|  PREDICTED: GDSL esterase/lipase APG-like           181   2e-52   Nelumbo nucifera [Indian lotus]
gb|KDO38516.1|  hypothetical protein CISIN_1g018227mg                   178   2e-52   Citrus sinensis [apfelsine]
ref|XP_007150584.1|  hypothetical protein PHAVU_005G164800g             180   2e-52   Phaseolus vulgaris [French bean]
ref|XP_004964566.1|  PREDICTED: GDSL esterase/lipase APG-like           180   3e-52   Setaria italica
gb|KHN39266.1|  GDSL esterase/lipase APG                                180   3e-52   Glycine soja [wild soybean]
ref|NP_001242561.1|  uncharacterized protein LOC100815273 precursor     180   4e-52   
ref|XP_009408845.1|  PREDICTED: GDSL esterase/lipase APG-like           180   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002436473.1|  hypothetical protein SORBIDRAFT_10g003340          179   6e-52   Sorghum bicolor [broomcorn]
ref|XP_010062556.1|  PREDICTED: GDSL esterase/lipase APG                179   6e-52   Eucalyptus grandis [rose gum]
gb|KFK38989.1|  hypothetical protein AALP_AA3G185500                    179   7e-52   Arabis alpina [alpine rockcress]
ref|XP_010244385.1|  PREDICTED: GDSL esterase/lipase APG-like           179   8e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010098171.1|  GDSL esterase/lipase APG                           179   8e-52   Morus notabilis
gb|KDO38512.1|  hypothetical protein CISIN_1g018227mg                   177   9e-52   Citrus sinensis [apfelsine]
ref|NP_001136705.1|  hypothetical protein precursor                     178   1e-51   Zea mays [maize]
gb|KDO38513.1|  hypothetical protein CISIN_1g018227mg                   177   1e-51   Citrus sinensis [apfelsine]
ref|XP_010545663.1|  PREDICTED: GDSL esterase/lipase APG                179   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_008654481.1|  PREDICTED: uncharacterized protein LOC100216...    180   1e-51   Zea mays [maize]
ref|NP_188258.1|  GDSL esterase/lipase                                  178   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486794.1|  PREDICTED: GDSL esterase/lipase APG-like           178   2e-51   Cicer arietinum [garbanzo]
ref|XP_006426844.1|  hypothetical protein CICLE_v10025938mg             178   2e-51   Citrus clementina [clementine]
ref|XP_006465718.1|  PREDICTED: GDSL esterase/lipase APG-like           178   2e-51   Citrus sinensis [apfelsine]
emb|CAB81548.2|  putative proline-rich protein APG isolog               177   3e-51   Cicer arietinum [garbanzo]
ref|XP_002883003.1|  GDSL-motif lipase/hydrolase family protein         177   3e-51   
ref|XP_009146144.1|  PREDICTED: GDSL esterase/lipase APG                177   4e-51   Brassica rapa
gb|KHN32662.1|  GDSL esterase/lipase APG                                175   5e-51   Glycine soja [wild soybean]
gb|AFW83670.1|  hypothetical protein ZEAMMB73_889110                    172   6e-51   
ref|XP_004510325.1|  PREDICTED: GDSL esterase/lipase APG-like           177   6e-51   Cicer arietinum [garbanzo]
gb|ACJ84797.1|  unknown                                                 173   6e-51   Medicago truncatula
ref|XP_006343027.1|  PREDICTED: GDSL esterase/lipase APG-like           177   6e-51   Solanum tuberosum [potatoes]
gb|KHN05319.1|  GDSL esterase/lipase APG                                176   9e-51   Glycine soja [wild soybean]
gb|ACU24285.1|  unknown                                                 176   9e-51   Glycine max [soybeans]
ref|XP_007135613.1|  hypothetical protein PHAVU_010G143600g             177   1e-50   Phaseolus vulgaris [French bean]
ref|XP_002515932.1|  zinc finger protein, putative                      176   1e-50   Ricinus communis
ref|XP_011072453.1|  PREDICTED: GDSL esterase/lipase APG                176   1e-50   Sesamum indicum [beniseed]
ref|XP_004235633.1|  PREDICTED: GDSL esterase/lipase APG-like           177   1e-50   Solanum lycopersicum
emb|CDY30167.1|  BnaC05g36950D                                          176   1e-50   Brassica napus [oilseed rape]
ref|XP_011008871.1|  PREDICTED: GDSL esterase/lipase APG                176   2e-50   Populus euphratica
ref|XP_006369216.1|  hypothetical protein POPTR_0001s19240g             174   2e-50   
ref|XP_010925408.1|  PREDICTED: GDSL esterase/lipase APG                175   3e-50   Elaeis guineensis
ref|XP_003531641.2|  PREDICTED: GDSL esterase/lipase APG-like           176   3e-50   
ref|XP_004302841.1|  PREDICTED: GDSL esterase/lipase APG                173   1e-49   Fragaria vesca subsp. vesca
ref|XP_003627082.1|  GDSL esterase/lipase APG                           172   3e-49   Medicago truncatula
gb|EMS47165.1|  GDSL esterase/lipase APG                                172   3e-49   Triticum urartu
ref|XP_002298249.2|  putative proline-rich protein APG isolog           172   3e-49   Populus trichocarpa [western balsam poplar]
gb|KDP40834.1|  hypothetical protein JCGZ_24833                         172   4e-49   Jatropha curcas
ref|XP_008793255.1|  PREDICTED: GDSL esterase/lipase APG                172   5e-49   Phoenix dactylifera
ref|XP_008447571.1|  PREDICTED: GDSL esterase/lipase APG-like           171   8e-49   Cucumis melo [Oriental melon]
gb|EYU21440.1|  hypothetical protein MIMGU_mgv1a009146mg                171   8e-49   Erythranthe guttata [common monkey flower]
gb|EYU21439.1|  hypothetical protein MIMGU_mgv1a009146mg                171   1e-48   Erythranthe guttata [common monkey flower]
gb|KJB56732.1|  hypothetical protein B456_009G138200                    167   1e-48   Gossypium raimondii
ref|XP_009388555.1|  PREDICTED: GDSL esterase/lipase APG-like           171   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG15938.1|  GDSL esterase/lipase APG -like protein                  170   2e-48   Gossypium arboreum [tree cotton]
ref|NP_001056808.1|  Os06g0148200                                       170   3e-48   
ref|XP_004486795.1|  PREDICTED: GDSL esterase/lipase APG-like           169   3e-48   
gb|AAB63641.1|  Proline-rich protein APG isolog                         168   5e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006826756.1|  hypothetical protein AMTR_s00136p00069360          169   5e-48   
ref|XP_006655787.1|  PREDICTED: GDSL esterase/lipase APG-like           169   5e-48   Oryza brachyantha
gb|KJB56736.1|  hypothetical protein B456_009G138200                    167   7e-48   Gossypium raimondii
ref|XP_007024353.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    169   7e-48   
gb|KJB56734.1|  hypothetical protein B456_009G138200                    167   8e-48   Gossypium raimondii
emb|CAN65530.1|  hypothetical protein VITISV_039629                     168   9e-48   Vitis vinifera
ref|XP_006426845.1|  hypothetical protein CICLE_v10025957mg             167   2e-47   Citrus clementina [clementine]
gb|KJB56735.1|  hypothetical protein B456_009G138200                    167   2e-47   Gossypium raimondii
gb|KJB56733.1|  hypothetical protein B456_009G138200                    167   3e-47   Gossypium raimondii
ref|XP_004516916.1|  PREDICTED: GDSL esterase/lipase APG-like           167   3e-47   Cicer arietinum [garbanzo]
ref|XP_003557194.1|  PREDICTED: GDSL esterase/lipase APG                167   3e-47   Brachypodium distachyon [annual false brome]
gb|KJB70371.1|  hypothetical protein B456_011G070000                    167   4e-47   Gossypium raimondii
ref|XP_002277514.1|  PREDICTED: GDSL esterase/lipase APG                167   5e-47   Vitis vinifera
gb|KJB70369.1|  hypothetical protein B456_011G070000                    167   5e-47   Gossypium raimondii
ref|XP_002313641.2|  GDSL-motif lipase family protein                   166   5e-47   Populus trichocarpa [western balsam poplar]
emb|CBI36031.3|  unnamed protein product                                166   6e-47   Vitis vinifera
ref|XP_004149175.1|  PREDICTED: GDSL esterase/lipase APG-like           166   8e-47   
ref|XP_011044241.1|  PREDICTED: GDSL esterase/lipase At5g22810          166   8e-47   Populus euphratica
gb|KJB70370.1|  hypothetical protein B456_011G070000                    166   1e-46   Gossypium raimondii
gb|EPS71085.1|  hypothetical protein M569_03672                         165   1e-46   Genlisea aurea
gb|KHG07525.1|  GDSL esterase/lipase APG -like protein                  165   1e-46   Gossypium arboreum [tree cotton]
ref|XP_010495383.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     159   4e-46   
gb|KDO42514.1|  hypothetical protein CISIN_1g040658mg                   161   8e-46   Citrus sinensis [apfelsine]
gb|EMT10375.1|  GDSL esterase/lipase APG                                163   9e-46   
ref|XP_011089987.1|  PREDICTED: GDSL esterase/lipase At5g22810          163   9e-46   
ref|XP_006382055.1|  hypothetical protein POPTR_0006s256601g            155   1e-45   
gb|KJB56729.1|  hypothetical protein B456_009G138200                    162   2e-45   Gossypium raimondii
ref|XP_010242974.1|  PREDICTED: GDSL esterase/lipase At5g22810          161   4e-45   Nelumbo nucifera [Indian lotus]
ref|XP_006484945.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     161   4e-45   Citrus sinensis [apfelsine]
ref|XP_006400789.1|  hypothetical protein EUTSA_v10015700mg             161   4e-45   
ref|XP_006465717.1|  PREDICTED: GDSL esterase/lipase APG-like iso...    161   5e-45   Citrus sinensis [apfelsine]
ref|NP_197672.1|  GDSL esterase/lipase                                  160   6e-45   
sp|Q9FFC6.3|GDL78_ARATH  RecName: Full=GDSL esterase/lipase At5g2...    161   6e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009796088.1|  PREDICTED: GDSL esterase/lipase At5g22810          161   7e-45   Nicotiana sylvestris
ref|XP_002872020.1|  predicted protein                                  160   9e-45   
ref|XP_010689974.1|  PREDICTED: GDSL esterase/lipase At5g22810          160   1e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002271400.1|  PREDICTED: GDSL esterase/lipase At5g22810          160   1e-44   Vitis vinifera
ref|XP_009337386.1|  PREDICTED: GDSL esterase/lipase At5g22810          160   2e-44   Pyrus x bretschneideri [bai li]
gb|KFK27616.1|  hypothetical protein AALP_AA8G406700                    160   2e-44   Arabis alpina [alpine rockcress]
ref|XP_010493379.1|  PREDICTED: GDSL esterase/lipase At5g22810          159   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_007015991.1|  GDSL esterase/lipase isoform 1                     159   5e-44   Theobroma cacao [chocolate]
ref|XP_007015992.1|  GDSL esterase/lipase isoform 2                     155   7e-44   
gb|KJB09007.1|  hypothetical protein B456_001G118700                    156   9e-44   Gossypium raimondii
ref|XP_006838752.1|  hypothetical protein AMTR_s00002p00255920          158   9e-44   Amborella trichopoda
gb|KDP34349.1|  hypothetical protein JCGZ_11232                         158   1e-43   Jatropha curcas
gb|KHG22657.1|  hypothetical protein F383_04802                         157   1e-43   Gossypium arboreum [tree cotton]
ref|XP_010558217.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     157   1e-43   Tarenaya hassleriana [spider flower]
emb|CDO97958.1|  unnamed protein product                                158   1e-43   Coffea canephora [robusta coffee]
ref|XP_010098864.1|  GDSL esterase/lipase                               157   1e-43   Morus notabilis
ref|XP_006289497.1|  hypothetical protein CARUB_v10003031mg             157   2e-43   
ref|XP_004251004.1|  PREDICTED: GDSL esterase/lipase At5g22810          157   2e-43   
ref|XP_002515934.1|  zinc finger protein, putative                      157   2e-43   Ricinus communis
gb|KCW89297.1|  hypothetical protein EUGRSUZ_A01587                     156   2e-43   Eucalyptus grandis [rose gum]
ref|XP_003540212.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     157   3e-43   Glycine max [soybeans]
ref|XP_010050200.1|  PREDICTED: GDSL esterase/lipase At5g03820          156   3e-43   Eucalyptus grandis [rose gum]
gb|KJB09006.1|  hypothetical protein B456_001G118700                    156   4e-43   Gossypium raimondii
ref|XP_009625753.1|  PREDICTED: GDSL esterase/lipase At5g22810 is...    156   4e-43   Nicotiana tomentosiformis
ref|XP_006424380.1|  hypothetical protein CICLE_v10027727mg             162   4e-43   
ref|XP_010493512.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     155   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006349065.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     156   6e-43   Solanum tuberosum [potatoes]
emb|CDY09169.1|  BnaA02g05950D                                          156   6e-43   Brassica napus [oilseed rape]
ref|XP_003551088.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     155   7e-43   Glycine max [soybeans]
emb|CDY50286.1|  BnaC02g45410D                                          155   7e-43   Brassica napus [oilseed rape]
gb|KHN21470.1|  GDSL esterase/lipase                                    155   8e-43   Glycine soja [wild soybean]
ref|XP_010558978.1|  PREDICTED: GDSL esterase/lipase At3g53100          155   1e-42   Tarenaya hassleriana [spider flower]
emb|CBI17099.3|  unnamed protein product                                160   2e-42   Vitis vinifera
gb|KHN27690.1|  GDSL esterase/lipase                                    154   2e-42   Glycine soja [wild soybean]
ref|XP_010247794.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     154   2e-42   Nelumbo nucifera [Indian lotus]
ref|XP_008366379.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     154   2e-42   
ref|XP_009780981.1|  PREDICTED: GDSL esterase/lipase At5g03820          150   3e-42   Nicotiana sylvestris
ref|XP_006366788.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     154   3e-42   Solanum tuberosum [potatoes]
ref|XP_002873116.1|  GDSL-motif lipase/hydrolase family protein         154   3e-42   
ref|XP_006482367.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     154   3e-42   Citrus sinensis [apfelsine]
gb|KDO60993.1|  hypothetical protein CISIN_1g036829mg                   154   3e-42   Citrus sinensis [apfelsine]
ref|XP_004303055.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     154   4e-42   Fragaria vesca subsp. vesca
ref|XP_008226994.1|  PREDICTED: GDSL esterase/lipase At5g22810          154   4e-42   Prunus mume [ume]
ref|XP_004295642.1|  PREDICTED: GDSL esterase/lipase At5g22810          154   4e-42   Fragaria vesca subsp. vesca
ref|XP_009126566.1|  PREDICTED: GDSL esterase/lipase At5g22810          154   5e-42   Brassica rapa
ref|XP_006430343.1|  hypothetical protein CICLE_v10013829mg             153   5e-42   Citrus clementina [clementine]
ref|XP_009340968.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     153   7e-42   Pyrus x bretschneideri [bai li]
ref|XP_002527431.1|  zinc finger protein, putative                      153   8e-42   Ricinus communis
gb|ABK21582.1|  unknown                                                 152   1e-41   Picea sitchensis
ref|XP_007150122.1|  hypothetical protein PHAVU_005G128600g             152   1e-41   Phaseolus vulgaris [French bean]
ref|XP_010045272.1|  PREDICTED: GDSL esterase/lipase At5g22810          152   1e-41   Eucalyptus grandis [rose gum]
ref|XP_004246904.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     152   1e-41   Solanum lycopersicum
gb|KDP40835.1|  hypothetical protein JCGZ_24834                         152   2e-41   Jatropha curcas
ref|XP_010923281.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     152   2e-41   Elaeis guineensis
gb|KHN38683.1|  GDSL esterase/lipase                                    151   2e-41   Glycine soja [wild soybean]
gb|AFK42211.1|  unknown                                                 152   2e-41   Lotus japonicus
ref|XP_009625752.1|  PREDICTED: GDSL esterase/lipase At5g22810 is...    151   3e-41   Nicotiana tomentosiformis
ref|XP_004143292.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     151   3e-41   Cucumis sativus [cucumbers]
ref|XP_004156262.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     151   3e-41   
ref|XP_006398840.1|  hypothetical protein EUTSA_v10013969mg             151   3e-41   
ref|XP_007027551.1|  GDSL-like Lipase/Acylhydrolase family protein      153   3e-41   
ref|XP_003538180.1|  PREDICTED: GDSL esterase/lipase At5g22810          151   4e-41   Glycine max [soybeans]
ref|XP_009593509.1|  PREDICTED: GDSL esterase/lipase At5g03820-li...    150   5e-41   Nicotiana tomentosiformis
ref|XP_002436480.1|  hypothetical protein SORBIDRAFT_10g003420          150   6e-41   
ref|XP_010933399.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     150   8e-41   Elaeis guineensis
ref|XP_002284087.2|  PREDICTED: GDSL esterase/lipase At5g03820-like     150   1e-40   Vitis vinifera
ref|XP_009589481.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     150   1e-40   
ref|XP_009397028.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     149   1e-40   
emb|CBI30208.3|  unnamed protein product                                150   1e-40   Vitis vinifera
ref|NP_196002.1|  GDSL esterase/lipase                                  150   1e-40   
ref|XP_009776666.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     149   1e-40   Nicotiana sylvestris
ref|XP_006286643.1|  hypothetical protein CARUB_v10002513mg             149   2e-40   Capsella rubella
ref|XP_008462518.1|  PREDICTED: GDSL esterase/lipase At5g03820          149   2e-40   
ref|XP_007132365.1|  hypothetical protein PHAVU_011G088700g             149   2e-40   Phaseolus vulgaris [French bean]
ref|XP_004964856.1|  PREDICTED: GDSL esterase/lipase APG-like           149   3e-40   Setaria italica
ref|XP_006338923.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     149   3e-40   Solanum tuberosum [potatoes]
ref|XP_011094449.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     148   4e-40   Sesamum indicum [beniseed]
ref|XP_010683957.1|  PREDICTED: GDSL esterase/lipase At5g03820          148   4e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002528628.1|  zinc finger protein, putative                      148   5e-40   Ricinus communis
ref|XP_004487544.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     148   6e-40   Cicer arietinum [garbanzo]
ref|XP_004249641.1|  PREDICTED: GDSL esterase/lipase At5g03820          147   8e-40   Solanum lycopersicum
ref|XP_007207052.1|  hypothetical protein PRUPE_ppa007967mg             147   9e-40   
emb|CDP14394.1|  unnamed protein product                                147   1e-39   Coffea canephora [robusta coffee]
ref|XP_004155946.1|  PREDICTED: GDSL esterase/lipase APG-like           147   2e-39   
ref|XP_009125521.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     147   2e-39   Brassica rapa
ref|XP_008794047.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     147   2e-39   Phoenix dactylifera
gb|KJB16733.1|  hypothetical protein B456_002G245100                    145   2e-39   Gossypium raimondii
gb|KHG27777.1|  hypothetical protein F383_16365                         146   3e-39   Gossypium arboreum [tree cotton]
gb|KDP29224.1|  hypothetical protein JCGZ_16613                         146   4e-39   Jatropha curcas
gb|KJB16732.1|  hypothetical protein B456_002G245100                    145   4e-39   Gossypium raimondii
ref|NP_001140661.1|  hypothetical protein precursor                     146   4e-39   Zea mays [maize]
ref|XP_011101470.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     145   4e-39   Sesamum indicum [beniseed]
ref|XP_010490874.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     145   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_011018853.1|  PREDICTED: GDSL esterase/lipase At5g03820          145   6e-39   Populus euphratica
emb|CDP17381.1|  unnamed protein product                                144   7e-39   Coffea canephora [robusta coffee]
emb|CDY04898.1|  BnaAnng00800D                                          145   8e-39   
ref|NP_196001.2|  GDSL esterase/lipase                                  145   8e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KJB56728.1|  hypothetical protein B456_009G138200                    144   1e-38   Gossypium raimondii
gb|ACG42669.1|  hypothetical protein                                    144   2e-38   Zea mays [maize]
ref|XP_006381340.1|  hypothetical protein POPTR_0006s11970g             144   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_008387479.1|  PREDICTED: GDSL esterase/lipase At5g03820-like     144   2e-38   
gb|KEH38918.1|  GDSL-like lipase/acylhydrolase                          144   2e-38   Medicago truncatula
ref|XP_010100155.1|  GDSL esterase/lipase                               144   2e-38   Morus notabilis
emb|CDP15327.1|  unnamed protein product                                143   3e-38   Coffea canephora [robusta coffee]
ref|XP_009389038.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    144   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009389037.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    144   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010092821.1|  GDSL esterase/lipase                               141   6e-38   
ref|XP_010452277.1|  PREDICTED: GDSL esterase/lipase At5g03820          142   1e-37   Camelina sativa [gold-of-pleasure]
gb|EYU41566.1|  hypothetical protein MIMGU_mgv1a008897mg                142   1e-37   Erythranthe guttata [common monkey flower]
emb|CDX80889.1|  BnaC03g01430D                                          140   5e-37   
ref|XP_009130784.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    140   6e-37   Brassica rapa
ref|XP_009130783.1|  PREDICTED: GDSL esterase/lipase At5g03810-li...    140   6e-37   Brassica rapa
ref|XP_006403725.1|  hypothetical protein EUTSA_v10010500mg             139   9e-37   
ref|XP_004145774.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     139   1e-36   Cucumis sativus [cucumbers]
emb|CDY11271.1|  BnaA03g01070D                                          139   2e-36   Brassica napus [oilseed rape]
gb|KDO38511.1|  hypothetical protein CISIN_1g018227mg                   138   2e-36   Citrus sinensis [apfelsine]
ref|XP_008458651.1|  PREDICTED: GDSL esterase/lipase At5g22810          137   8e-36   Cucumis melo [Oriental melon]
ref|XP_002515937.1|  zinc finger protein, putative                      137   1e-35   Ricinus communis
ref|XP_010515794.1|  PREDICTED: GDSL esterase/lipase At3g53100-li...    133   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006656639.1|  PREDICTED: GDSL esterase/lipase APG-like           136   2e-35   
ref|XP_006291405.1|  hypothetical protein CARUB_v10017544mg             135   2e-35   Capsella rubella
ref|XP_002877901.1|  GDSL-motif lipase/hydrolase family protein         135   3e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_009139436.1|  PREDICTED: GDSL esterase/lipase At3g53100 is...    135   3e-35   Brassica rapa
emb|CDX76226.1|  BnaA04g04900D                                          135   3e-35   
gb|KJB26682.1|  hypothetical protein B456_004G254700                    135   3e-35   Gossypium raimondii
ref|XP_003561182.1|  PREDICTED: GDSL esterase/lipase APG-like           135   4e-35   Brachypodium distachyon [annual false brome]
emb|CDX95394.1|  BnaC04g27640D                                          135   4e-35   
emb|CAB85501.1|  putative protein                                       134   5e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABZ85654.1|  truncated At5g03810                                     129   6e-35   Arabidopsis thaliana [mouse-ear cress]
gb|EMT26145.1|  GDSL esterase/lipase APG                                134   8e-35   
ref|NP_001142139.1|  uncharacterized protein LOC100274304 precursor     134   1e-34   Zea mays [maize]
gb|KFK34547.1|  hypothetical protein AALP_AA5G160400                    134   1e-34   Arabis alpina [alpine rockcress]
ref|XP_003561180.2|  PREDICTED: GDSL esterase/lipase APG-like           135   1e-34   
ref|XP_010515793.1|  PREDICTED: GDSL esterase/lipase At3g53100-li...    132   2e-34   Camelina sativa [gold-of-pleasure]
ref|NP_001241778.1|  anther-specific proline-rich protein APG pre...    133   2e-34   
gb|EMS52953.1|  GDSL esterase/lipase APG                                133   2e-34   Triticum urartu
gb|EMT28018.1|  GDSL esterase/lipase APG                                130   3e-34   
ref|XP_004982165.1|  PREDICTED: GDSL esterase/lipase At5g03820-li...    132   4e-34   Setaria italica
ref|XP_002466664.1|  hypothetical protein SORBIDRAFT_01g011850          132   4e-34   Sorghum bicolor [broomcorn]
dbj|BAJ89672.1|  predicted protein                                      132   4e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAB64213.1|  putative protein                                       132   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004506128.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     132   4e-34   Cicer arietinum [garbanzo]
ref|NP_190878.2|  GDSL esterase/lipase                                  132   6e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006650413.1|  PREDICTED: GDSL esterase/lipase At5g03810-like     132   7e-34   Oryza brachyantha
ref|XP_008462404.1|  PREDICTED: GDSL esterase/lipase APG isoform X5     132   8e-34   
ref|XP_010426939.1|  PREDICTED: GDSL esterase/lipase At3g53100-like     131   9e-34   Camelina sativa [gold-of-pleasure]
ref|XP_003561212.2|  PREDICTED: GDSL esterase/lipase At5g03810-like     131   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_010109948.1|  GDSL esterase/lipase                               131   2e-33   Morus notabilis
gb|ABZ85655.1|  At5g03810                                               129   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004141668.1|  PREDICTED: GDSL esterase/lipase APG-like           131   2e-33   Cucumis sativus [cucumbers]
gb|ABZ85648.1|  At5g03810                                               128   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010100153.1|  GDSL esterase/lipase                               127   2e-33   
ref|XP_004982164.1|  PREDICTED: GDSL esterase/lipase At5g03820-li...    131   3e-33   
ref|XP_009139435.1|  PREDICTED: GDSL esterase/lipase At3g53100 is...    130   4e-33   Brassica rapa
gb|ABZ85649.1|  At5g03810                                               127   5e-33   Arabidopsis thaliana [mouse-ear cress]
gb|ABZ85657.1|  At5g03810                                               127   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008462401.1|  PREDICTED: probable LRR receptor-like serine...    132   2e-32   
ref|XP_008462399.1|  PREDICTED: probable LRR receptor-like serine...    132   2e-32   
ref|XP_008462402.1|  PREDICTED: probable LRR receptor-like serine...    132   2e-32   
ref|XP_008462403.1|  PREDICTED: probable LRR receptor-like serine...    132   2e-32   Cucumis melo [Oriental melon]
gb|KEH29406.1|  GDSL-like lipase/acylhydrolase                          124   3e-32   Medicago truncatula
emb|CBI36023.3|  unnamed protein product                                122   3e-32   Vitis vinifera
gb|EMT10908.1|  GDSL esterase/lipase                                    125   2e-31   
ref|XP_004506129.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     124   3e-31   Cicer arietinum [garbanzo]
gb|ABK26273.1|  unknown                                                 124   5e-31   Picea sitchensis
ref|XP_004499293.1|  PREDICTED: GDSL esterase/lipase EXL3-like          124   6e-31   
gb|KEH29925.1|  GDSL-like lipase/acylhydrolase                          124   7e-31   
ref|XP_006852535.1|  hypothetical protein AMTR_s00021p00183530          122   1e-30   
gb|KEH29917.1|  GDSL-like lipase/acylhydrolase                          122   2e-30   
gb|EAY91425.1|  hypothetical protein OsI_13052                          122   3e-30   
gb|EAZ28161.1|  hypothetical protein OsJ_12134                          122   3e-30   
ref|NP_001050914.1|  Os03g0683800                                       122   4e-30   
ref|XP_004488333.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     121   6e-30   
ref|XP_010052242.1|  PREDICTED: GDSL esterase/lipase At5g45950          120   2e-29   
gb|AFK46089.1|  unknown                                                 117   3e-29   
ref|XP_010111929.1|  GDSL esterase/lipase                               116   6e-29   
ref|XP_007017007.1|  GDSL-like Lipase/Acylhydrolase family protei...    119   9e-29   
ref|XP_003589534.1|  GDSL esterase/lipase                               117   2e-28   
ref|XP_002528324.1|  zinc finger protein, putative                      117   2e-28   
ref|XP_010111862.1|  GDSL esterase/lipase                               120   2e-28   
ref|XP_003528475.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     117   2e-28   
gb|ABK26503.1|  unknown                                                 117   2e-28   
ref|XP_010494752.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    114   3e-28   
ref|XP_010539839.1|  PREDICTED: GDSL esterase/lipase EXL3-like          116   4e-28   
ref|XP_009784175.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     114   6e-28   
ref|XP_004505116.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     115   6e-28   
ref|XP_009776386.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    113   7e-28   
ref|XP_009385218.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     115   9e-28   
ref|XP_008799468.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     115   9e-28   
ref|XP_011096387.1|  PREDICTED: GDSL esterase/lipase At5g45950          115   1e-27   
ref|XP_010943280.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     114   1e-27   
ref|XP_008439785.1|  PREDICTED: GDSL esterase/lipase At5g45960          115   2e-27   
ref|XP_007160639.1|  hypothetical protein PHAVU_001G004300g             114   2e-27   
ref|XP_004134939.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     114   2e-27   
ref|XP_010511070.1|  PREDICTED: GDSL esterase/lipase At1g58430          114   2e-27   
gb|EMS63525.1|  GDSL esterase/lipase EXL3                               114   2e-27   
gb|EMT30559.1|  GDSL esterase/lipase EXL3                               114   2e-27   
gb|KEH30938.1|  GDSL-like lipase/acylhydrolase                          114   3e-27   
dbj|BAD43087.1|  putative GDSL-motif lipase/hydrolase                   114   3e-27   
ref|NP_178536.1|  GDSL esterase/lipase                                  114   3e-27   
gb|AAM65485.1|  putative GDSL-motif lipase/hydrolase                    114   3e-27   
ref|XP_011080712.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     114   4e-27   
ref|XP_010101540.1|  GDSL esterase/lipase                               114   4e-27   
ref|XP_010494751.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    114   4e-27   
gb|KHN12627.1|  GDSL esterase/lipase EXL3                               113   4e-27   
gb|ACN40345.1|  unknown                                                 113   5e-27   
ref|XP_009793062.1|  PREDICTED: GDSL esterase/lipase At5g45950 is...    113   5e-27   
dbj|BAJ87048.1|  predicted protein                                      113   5e-27   
ref|XP_003550433.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    113   5e-27   
ref|XP_011003477.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     113   5e-27   
ref|XP_009615525.1|  PREDICTED: GDSL esterase/lipase At5g45950          113   5e-27   
emb|CDP05715.1|  unnamed protein product                                113   6e-27   
gb|KDP23987.1|  hypothetical protein JCGZ_25375                         113   6e-27   
ref|XP_006298032.1|  hypothetical protein CARUB_v10014077mg             113   6e-27   
gb|KFK31786.1|  hypothetical protein AALP_AA6G158100                    112   7e-27   
ref|XP_010532997.1|  PREDICTED: GDSL esterase/lipase At2g04570          113   7e-27   
ref|XP_001775976.1|  predicted protein                                  113   7e-27   
gb|KHN39410.1|  GDSL esterase/lipase EXL3                               112   7e-27   
gb|KHN21100.1|  GDSL esterase/lipase                                    110   7e-27   
ref|XP_004491083.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     113   7e-27   
gb|ABK21631.1|  unknown                                                 113   7e-27   
ref|XP_002883649.1|  GDSL-motif lipase/hydrolase family protein         112   7e-27   
ref|XP_009344497.1|  PREDICTED: GDSL esterase/lipase At5g22810-like     108   8e-27   
ref|XP_009776385.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    112   9e-27   
ref|XP_003545022.1|  PREDICTED: GDSL esterase/lipase EXL3               112   9e-27   
ref|XP_009776384.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    112   9e-27   
gb|ACU19367.1|  unknown                                                 112   9e-27   
ref|XP_010928403.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     112   1e-26   
ref|XP_010467017.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     112   1e-26   
ref|XP_009776383.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    112   1e-26   
gb|KHG19996.1|  hypothetical protein F383_02890                         112   1e-26   
ref|XP_010488704.1|  PREDICTED: GDSL esterase/lipase At2g04570          112   1e-26   
ref|XP_002277279.1|  PREDICTED: GDSL esterase/lipase At5g45950          112   1e-26   
ref|XP_004305968.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     112   1e-26   
ref|XP_006361071.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     112   2e-26   
ref|XP_006377451.1|  GDSL-motif lipase/hydrolase family protein         112   2e-26   
ref|XP_011083479.1|  PREDICTED: uncharacterized protein LOC105166004    114   2e-26   
ref|XP_010518560.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     112   2e-26   
ref|XP_010252591.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    111   2e-26   
ref|XP_003545614.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     111   2e-26   
ref|XP_009395858.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     111   2e-26   
ref|XP_009398920.1|  PREDICTED: GDSL esterase/lipase EXL3-like          111   2e-26   
ref|XP_010441648.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     111   2e-26   
ref|XP_006301174.1|  hypothetical protein CARUB_v10021573mg             111   2e-26   
ref|XP_009606234.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     111   2e-26   
ref|XP_002964035.1|  hypothetical protein SELMODRAFT_438768             111   3e-26   
ref|XP_011021005.1|  PREDICTED: GDSL esterase/lipase At2g31550-like     111   3e-26   
ref|XP_010279185.1|  PREDICTED: GDSL esterase/lipase At5g45950-like     111   3e-26   
gb|EAY84073.1|  hypothetical protein OsI_05454                          111   3e-26   
ref|XP_010252590.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    111   3e-26   
ref|XP_003570760.2|  PREDICTED: GDSL esterase/lipase EXL3-like          111   3e-26   
ref|XP_001775537.1|  predicted protein                                  111   3e-26   
ref|XP_010933356.1|  PREDICTED: GDSL esterase/lipase EXL3-like          111   3e-26   
dbj|BAD07804.1|  putative family II extracellular lipase 3 (EXL3)       111   3e-26   
ref|XP_006296461.1|  hypothetical protein CARUB_v10025645mg             111   3e-26   
emb|CDY55498.1|  BnaA05g34360D                                          111   3e-26   
ref|XP_010529179.1|  PREDICTED: GDSL esterase/lipase At5g45960 is...    111   3e-26   
gb|KJB19562.1|  hypothetical protein B456_003G108700                    110   3e-26   
gb|EMS62537.1|  GDSL esterase/lipase EXL3                               111   3e-26   
ref|XP_007148085.1|  hypothetical protein PHAVU_006G179500g             110   4e-26   
ref|XP_004509383.1|  PREDICTED: GDSL esterase/lipase EXL3-like          110   4e-26   
ref|XP_006852534.1|  hypothetical protein AMTR_s00021p00182700          111   4e-26   
ref|XP_008807138.1|  PREDICTED: GDSL esterase/lipase EXL3               111   4e-26   
ref|XP_010470254.1|  PREDICTED: GDSL esterase/lipase At1g58430-like     110   4e-26   
ref|NP_001239864.1|  uncharacterized protein LOC100809260 precursor     110   4e-26   
gb|EYU45990.1|  hypothetical protein MIMGU_mgv1a026832mg                110   4e-26   
ref|XP_009804685.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     110   5e-26   
ref|XP_010103641.1|  GDSL esterase/lipase                               110   5e-26   
gb|KHN09073.1|  GDSL esterase/lipase EXL3                               110   5e-26   
ref|XP_006377450.1|  hypothetical protein POPTR_0011s06030g             110   6e-26   
emb|CDY53653.1|  BnaC04g52870D                                          110   6e-26   
ref|XP_004502157.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     110   6e-26   
ref|XP_009142896.1|  PREDICTED: GDSL esterase/lipase At2g42990          110   6e-26   
gb|KJB19560.1|  hypothetical protein B456_003G108700                    110   6e-26   
ref|XP_011045879.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    110   6e-26   
gb|KJB76243.1|  hypothetical protein B456_012G079700                    110   6e-26   
gb|EPS73918.1|  hypothetical protein M569_00836                         110   6e-26   
ref|XP_010501533.1|  PREDICTED: GDSL esterase/lipase At1g20120          110   6e-26   
gb|KJB57454.1|  hypothetical protein B456_009G165200                    110   6e-26   
ref|XP_006828972.1|  hypothetical protein AMTR_s00001p00237870          109   6e-26   
ref|XP_006344610.1|  PREDICTED: GDSL esterase/lipase At2g31550-like     110   6e-26   
ref|XP_011086020.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     110   7e-26   
gb|KHN45938.1|  GDSL esterase/lipase EXL3                               110   7e-26   
ref|XP_006342238.1|  PREDICTED: uncharacterized protein LOC102603803    112   8e-26   
ref|XP_009136143.1|  PREDICTED: GDSL esterase/lipase At2g04570          110   8e-26   
ref|XP_011085484.1|  PREDICTED: GDSL esterase/lipase At2g04570          110   8e-26   
ref|XP_011045880.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    110   8e-26   
ref|XP_006367195.1|  PREDICTED: GDSL esterase/lipase At5g45950-like     110   8e-26   
ref|XP_010459696.1|  PREDICTED: GDSL esterase/lipase At1g20120-li...    110   8e-26   
ref|XP_004134848.1|  PREDICTED: GDSL esterase/lipase EXL3-like          110   8e-26   
ref|XP_004248462.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     110   8e-26   
emb|CDY15057.1|  BnaC03g44180D                                          110   8e-26   
ref|XP_004158854.1|  PREDICTED: GDSL esterase/lipase EXL3-like          110   8e-26   
gb|KHN47206.1|  GDSL esterase/lipase                                    110   8e-26   
ref|XP_010459694.1|  PREDICTED: GDSL esterase/lipase At1g20120-li...    110   9e-26   
ref|XP_002451338.1|  hypothetical protein SORBIDRAFT_04g000310          110   9e-26   
ref|XP_010459695.1|  PREDICTED: GDSL esterase/lipase At1g20120-li...    110   9e-26   
ref|XP_010320439.1|  PREDICTED: GDSL esterase/lipase EXL3 isoform X2    107   9e-26   
ref|XP_010103642.1|  GDSL esterase/lipase                               110   1e-25   
ref|XP_002305097.1|  GDSL-motif lipase/hydrolase family protein         109   1e-25   
emb|CDY69004.1|  BnaAnng29090D                                          107   1e-25   
ref|XP_008440851.1|  PREDICTED: GDSL esterase/lipase EXL3-like          109   1e-25   
ref|XP_011466833.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    109   1e-25   
ref|XP_003542710.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     109   1e-25   
ref|XP_003601542.1|  GDSL esterase/lipase                               109   1e-25   
gb|ACF88336.1|  unknown                                                 109   1e-25   
ref|XP_008784445.1|  PREDICTED: GDSL esterase/lipase At5g45950-like     109   1e-25   
ref|XP_010052243.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    109   1e-25   
ref|XP_010473948.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     107   1e-25   
gb|AAM64323.1|  anter-specific proline-rich protein APG precursor...    109   1e-25   
ref|XP_004240155.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     109   1e-25   
gb|KCW88729.1|  hypothetical protein EUGRSUZ_A01084                     108   1e-25   
ref|NP_564104.1|  GDSL esterase/lipase                                  109   1e-25   
ref|XP_010260393.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     109   1e-25   
ref|XP_010320440.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    109   1e-25   
gb|AFK45979.1|  unknown                                                 109   2e-25   
ref|NP_001131302.1|  uncharacterized protein LOC100192615 precursor     109   2e-25   
gb|KFK37141.1|  hypothetical protein AALP_AA4G218400                    109   2e-25   
ref|XP_011459095.1|  PREDICTED: GDSL esterase/lipase EXL3-like          109   2e-25   
ref|XP_010429438.1|  PREDICTED: GDSL esterase/lipase At2g24560          108   2e-25   
ref|XP_003542316.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     108   2e-25   
ref|XP_010414731.1|  PREDICTED: GDSL esterase/lipase At1g58430-like     108   2e-25   
gb|KDP26412.1|  hypothetical protein JCGZ_17570                         109   2e-25   
gb|EYU36800.1|  hypothetical protein MIMGU_mgv1a0249802mg               105   2e-25   
ref|XP_010067942.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     108   2e-25   
ref|XP_002863438.1|  GDSL-motif lipase/hydrolase family protein         108   2e-25   
emb|CDY53562.1|  BnaC04g55740D                                          107   2e-25   
gb|AFW69693.1|  hypothetical protein ZEAMMB73_552382                    109   2e-25   
ref|XP_010266977.1|  PREDICTED: GDSL esterase/lipase At3g14820-like     111   2e-25   
ref|NP_001242159.1|  uncharacterized protein LOC100812614 precursor     108   2e-25   
ref|XP_010510188.1|  PREDICTED: GDSL esterase/lipase At2g31550-like     108   2e-25   
gb|KHN18936.1|  GDSL esterase/lipase                                    108   2e-25   
ref|XP_006418560.1|  hypothetical protein EUTSA_v10002592mg             108   2e-25   
ref|XP_010477243.1|  PREDICTED: GDSL esterase/lipase At1g20120          108   2e-25   
gb|AFW69692.1|  LOW QUALITY PROTEIN: anther-specific proline-rich...    109   3e-25   
gb|EYU28037.1|  hypothetical protein MIMGU_mgv1a008421mg                108   3e-25   
gb|KHG24677.1|  hypothetical protein F383_10020                         108   3e-25   
gb|KDP30830.1|  hypothetical protein JCGZ_13773                         108   3e-25   
ref|XP_004243509.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     108   3e-25   
ref|XP_002277615.2|  PREDICTED: GDSL esterase/lipase At1g58430          108   3e-25   
emb|CAN59818.1|  hypothetical protein VITISV_020322                     108   3e-25   
ref|XP_007136106.1|  hypothetical protein PHAVU_009G018300g             108   3e-25   
ref|XP_009363464.1|  PREDICTED: GDSL esterase/lipase EXL3-like          108   3e-25   
ref|XP_009103357.1|  PREDICTED: GDSL esterase/lipase At1g20120          108   3e-25   
ref|XP_010686363.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    108   3e-25   
ref|XP_009392112.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     108   3e-25   
ref|XP_008806090.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     108   4e-25   
gb|KHN09072.1|  GDSL esterase/lipase                                    108   4e-25   
dbj|BAA88267.1|  RXF26                                                  108   4e-25   
ref|XP_010326173.1|  PREDICTED: GDSL esterase/lipase At2g30310-li...    108   4e-25   
gb|AAM64923.1|  proline-rich protein, putative                          108   4e-25   
gb|KHG15434.1|  hypothetical protein F383_19515                         108   4e-25   
gb|AEM36344.1|  At1g58430                                               108   4e-25   
ref|NP_176139.1|  anther-specific proline-rich protein RXF26            108   4e-25   
gb|KJB42834.1|  hypothetical protein B456_007G169400                    107   4e-25   
ref|XP_009589386.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     108   4e-25   
gb|KJB57456.1|  hypothetical protein B456_009G165300                    108   4e-25   
ref|XP_009400370.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     107   4e-25   
gb|KHN35532.1|  GDSL esterase/lipase EXL3                               107   4e-25   
ref|XP_010916044.1|  PREDICTED: GDSL esterase/lipase At5g45950          107   5e-25   
ref|XP_003616833.1|  GDSL esterase/lipase                               107   5e-25   
ref|XP_004232946.1|  PREDICTED: GDSL esterase/lipase At5g45950          107   5e-25   
ref|XP_009408725.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     107   5e-25   
ref|XP_003548834.1|  PREDICTED: GDSL esterase/lipase EXL3-like          107   5e-25   
gb|KEH26279.1|  GDSL-like lipase/acylhydrolase                          104   5e-25   
ref|XP_009605224.1|  PREDICTED: GDSL esterase/lipase At5g42170-like     108   5e-25   
gb|KHN35535.1|  GDSL esterase/lipase                                    104   5e-25   
ref|XP_007049207.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    107   5e-25   
ref|XP_010686364.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    107   5e-25   
ref|XP_004246974.1|  PREDICTED: GDSL esterase/lipase At2g30310-li...    107   5e-25   
ref|XP_011003064.1|  PREDICTED: GDSL esterase/lipase EXL3-like          107   5e-25   
ref|XP_006648199.1|  PREDICTED: GDSL esterase/lipase EXL3-like          107   5e-25   
gb|EMT07246.1|  GDSL esterase/lipase                                    107   5e-25   
ref|XP_002279335.1|  PREDICTED: GDSL esterase/lipase EXL3               107   6e-25   
gb|KHG24596.1|  GDSL esterase/lipase EXL3 -like protein                 107   6e-25   
gb|KJB63492.1|  hypothetical protein B456_010G002300                    107   6e-25   
ref|XP_008357836.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     107   6e-25   
emb|CBI19910.3|  unnamed protein product                                107   6e-25   
ref|NP_001130165.1|  uncharacterized protein LOC100191259 precursor     107   6e-25   
gb|ACU24478.1|  unknown                                                 107   6e-25   
ref|XP_004951174.1|  PREDICTED: GDSL esterase/lipase EXL3-like          107   6e-25   
ref|XP_010033517.1|  PREDICTED: GDSL esterase/lipase EXL3-like          107   6e-25   
ref|XP_009802938.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     107   6e-25   
gb|KHG24676.1|  hypothetical protein F383_10019                         107   6e-25   
gb|KCW53198.1|  hypothetical protein EUGRSUZ_J02472                     107   6e-25   
ref|XP_010320539.1|  PREDICTED: GDSL esterase/lipase EXL3-like          109   6e-25   



>ref|XP_010690130.1| PREDICTED: GDSL esterase/lipase APG-like [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVPAII FGDS+VDVGNN+YV T+FKADYPPYGRDFA+H+PTGRFCNGKLATDITADT
Sbjct  26   QSLVPAIITFGDSTVDVGNNDYVATLFKADYPPYGRDFANHKPTGRFCNGKLATDITADT  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLSPQA+G+NLLIGANFASAASGYD+KTALL +AI LS
Sbjct  86   LGFTSYPPAYLSPQASGQNLLIGANFASAASGYDDKTALLSHAISLS  132



>ref|XP_009612468.1| PREDICTED: GDSL esterase/lipase APG [Nicotiana tomentosiformis]
Length=354

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVNRQPTGRFCNGKLATDITADTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSPQA+GKNLLIG NFASAA+GYD+KTA+L +AIPLS
Sbjct  88   FTTYPSAYLSPQASGKNLLIGTNFASAAAGYDDKTAILNHAIPLS  132



>ref|XP_008375835.1| PREDICTED: GDSL esterase/lipase APG-like [Malus domestica]
Length=357

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  32   MGCRFGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRD  211
            +   FG VL   FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKADYPPYGRD
Sbjct  6    LSAAFGLVLVFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKADYPPYGRD  65

Query  212  FASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKT  391
            F +HQPTGRFCNGKLATDITADTLGFS+YP AYLSPQA+GKNLLIGANFASAASGYD+K 
Sbjct  66   FVNHQPTGRFCNGKLATDITADTLGFSTYPPAYLSPQASGKNLLIGANFASAASGYDDKA  125

Query  392  ALLXNAIPLS  421
            A L +AIPLS
Sbjct  126  ATLSHAIPLS  135



>dbj|BAM08277.1| zinc finger protein [Malus domestica]
Length=358

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  44   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  223
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  11   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  70

Query  224  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLX  403
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L 
Sbjct  71   QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  130

Query  404  NAIPLS  421
            +AIPLS
Sbjct  131  HAIPLS  136



>ref|XP_009344493.1| PREDICTED: GDSL esterase/lipase APG-like [Pyrus x bretschneideri]
Length=358

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  44   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  223
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  11   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  70

Query  224  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLX  403
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L 
Sbjct  71   QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  130

Query  404  NAIPLS  421
            +AIPLS
Sbjct  131  HAIPLS  136



>ref|XP_008358081.1| PREDICTED: GDSL esterase/lipase APG-like [Malus domestica]
Length=388

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  44   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  223
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  41   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  100

Query  224  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLX  403
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L 
Sbjct  101  QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  160

Query  404  NAIPLS  421
            +AIPLS
Sbjct  161  HAIPLS  166



>ref|XP_008380836.1| PREDICTED: GDSL esterase/lipase APG-like [Malus domestica]
Length=388

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  44   FGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASH  223
            FG VLA  FV        +  LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF SH
Sbjct  41   FGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVSH  100

Query  224  QPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLX  403
            QPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L 
Sbjct  101  QPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLN  160

Query  404  NAIPLS  421
            +AIPLS
Sbjct  161  HAIPLS  166



>ref|XP_009337919.1| PREDICTED: GDSL esterase/lipase APG-like [Pyrus x bretschneideri]
Length=357

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  32   MGCRFGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRD  211
            +   FG VLA  FV        +  LVPAI+ FGDS+VDVGNNN++ TIFKADYPPYGRD
Sbjct  6    LSAAFGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNNFLPTIFKADYPPYGRD  65

Query  212  FASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKT  391
            F +HQPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLLIGANFASAASGYD+K 
Sbjct  66   FVNHQPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDDKA  125

Query  392  ALLXNAIPLS  421
            A L +AIPLS
Sbjct  126  ATLSHAIPLS  135



>ref|XP_009759976.1| PREDICTED: GDSL esterase/lipase APG [Nicotiana sylvestris]
Length=354

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVNRQPTGRFCNGKLATDITADTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSPQA+GKNLLIG NFASAA+GYD+KTA+L +AIPLS
Sbjct  88   FTTYPPAYLSPQASGKNLLIGTNFASAAAGYDDKTAVLNHAIPLS  132



>emb|CDO97957.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   184 bits (468),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 100/110 (91%), Gaps = 3/110 (3%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITA--  274
            QPLVPA+I FGDS+VDVGNNNY+ T+FKADYPPYGRDF +HQPTGRFCNGKLATDIT   
Sbjct  28   QPLVPALITFGDSAVDVGNNNYLPTLFKADYPPYGRDFINHQPTGRFCNGKLATDITGKY  87

Query  275  -DTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
             DTLGF++YP AYLSPQA+GKNLLIGANFASAASGYD+KTA L +AIPLS
Sbjct  88   TDTLGFTTYPPAYLSPQASGKNLLIGANFASAASGYDDKTAYLSHAIPLS  137



>ref|XP_008228396.1| PREDICTED: GDSL esterase/lipase APG [Prunus mume]
Length=360

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITADTLG
Sbjct  34   LVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVNHQPTGRFCNGKLATDITADTLG  93

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSPQA+GKNLLIGANFASAASGYDEK A L +AIPLS
Sbjct  94   FTTYPPAYLSPQASGKNLLIGANFASAASGYDEKAATLNHAIPLS  138



>ref|XP_010654595.1| PREDICTED: GDSL esterase/lipase APG-like [Vitis vinifera]
 emb|CAN65529.1| hypothetical protein VITISV_039628 [Vitis vinifera]
 emb|CBI36030.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITADTLG
Sbjct  30   LVPAIITFGDSAVDVGNNDYLLTIFKANYPPYGRDFINHQPTGRFCNGKLATDITADTLG  89

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +YP AYLSP+A+GKNLLIGANFASA SGYD+KTA+L +AIPLS
Sbjct  90   FKTYPPAYLSPKASGKNLLIGANFASAGSGYDDKTAILSHAIPLS  134



>ref|XP_003597654.1| GDSL esterase/lipase APG [Medicago truncatula]
 gb|AES67905.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=354

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPAI+ FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF SH+PTGRFCNGKLATDITA+TLG
Sbjct  28   VVPAIVTFGDSAVDVGNNDYLFTLFKANYPPYGRDFVSHKPTGRFCNGKLATDITAETLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F SY  AYLSPQATGKNLLIGANFASAASGYDEK A+L +AIPLS
Sbjct  88   FKSYAPAYLSPQATGKNLLIGANFASAASGYDEKAAILNHAIPLS  132



>ref|XP_006343026.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum tuberosum]
Length=359

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  33   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVTRQPTGRFCNGKLATDITADTLG  92

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLLIG NFASAA+G+D+KTA+L +AIP S
Sbjct  93   FTTYPAAYLSPEASGKNLLIGTNFASAAAGFDDKTAILNHAIPFS  137



>ref|XP_009343018.1| PREDICTED: GDSL esterase/lipase APG-like [Pyrus x bretschneideri]
Length=357

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  32   MGCRFGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRD  211
            +   FG VLA  FV        +  LVPAI+ FGDS+VDVGNNN++ TIFKA+YPPYGRD
Sbjct  6    LSAAFGLVLAFAFVIGGNYAQESTTLVPAIMTFGDSAVDVGNNNFLPTIFKANYPPYGRD  65

Query  212  FASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKT  391
            F +HQPTGRFCNGKLATDITADTLGF++YP AYLSPQA+GKNLL+GANFASAASGYD+K 
Sbjct  66   FVNHQPTGRFCNGKLATDITADTLGFTTYPPAYLSPQASGKNLLMGANFASAASGYDDKA  125

Query  392  ALLXNAIPLS  421
            A L +AIPLS
Sbjct  126  ATLSHAIPLS  135



>ref|XP_006298028.1| hypothetical protein CARUB_v10014074mg [Capsella rubella]
 gb|EOA30926.1| hypothetical protein CARUB_v10014074mg [Capsella rubella]
Length=353

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL +AIPL
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPL  130



>ref|XP_004235632.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum lycopersicum]
Length=359

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HT+FKA+YPPYGRDF + QPTGRFCNGKLATDITADTLG
Sbjct  33   LVPAIITFGDSAVDVGNNDYIHTLFKANYPPYGRDFVTRQPTGRFCNGKLATDITADTLG  92

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLLIG NFASAA+G+D+KTA+L +AIP S
Sbjct  93   FTTYPAAYLSPEASGKNLLIGTNFASAAAGFDDKTAILNHAIPFS  137



>gb|KDO38517.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=219

 Score =   178 bits (451),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L +AI L+
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLT  138



>gb|KDO38518.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=220

 Score =   178 bits (451),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L +AI L+
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLT  138



>ref|XP_007215590.1| hypothetical protein PRUPE_ppa007650mg [Prunus persica]
 gb|EMJ16789.1| hypothetical protein PRUPE_ppa007650mg [Prunus persica]
Length=360

 Score =   182 bits (461),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITADTLG
Sbjct  34   LVPAIMTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVNHQPTGRFCNGKLATDITADTLG  93

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSPQA+G NLLIGANFASAASGYDEK A L +AIPLS
Sbjct  94   FTTYPPAYLSPQASGNNLLIGANFASAASGYDEKAATLNHAIPLS  138



>ref|XP_003543615.1| PREDICTED: GDSL esterase/lipase APG-like [Glycine max]
Length=353

 Score =   181 bits (460),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFINHQPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F SY  AYLSPQA+GKNLLIGANFASAASGYDEK A+L +AIPLS
Sbjct  87   FKSYAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHAIPLS  131



>gb|KHN30020.1| GDSL esterase/lipase APG [Glycine soja]
Length=353

 Score =   181 bits (460),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFINHQPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F SY  AYLSPQA+GKNLLIGANFASAASGYDEK A+L +AIPLS
Sbjct  87   FKSYAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHAIPLS  131



>ref|XP_010465660.1| PREDICTED: GDSL esterase/lipase APG [Camelina sativa]
Length=354

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+ +AIPL
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPL  130



>ref|XP_010504217.1| PREDICTED: GDSL esterase/lipase APG-like [Camelina sativa]
Length=353

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+ +AIPL
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPL  130



>ref|XP_010487495.1| PREDICTED: GDSL esterase/lipase APG-like [Camelina sativa]
Length=366

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  40   LVPAIMTFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  99

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+ +AIPL
Sbjct  100  FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPL  143



>ref|XP_006406840.1| hypothetical protein EUTSA_v10021008mg [Eutrema salsugineum]
 dbj|BAJ33787.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48293.1| hypothetical protein EUTSA_v10021008mg [Eutrema salsugineum]
Length=358

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  32   LVPAIMTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKPTGRFCNGKLATDITAETLG  91

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL +AIPL
Sbjct  92   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPL  135



>ref|XP_010267093.1| PREDICTED: GDSL esterase/lipase APG-like [Nelumbo nucifera]
Length=354

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TIFKADYPPYGRDF +H+ TGRFCNGKLATDITA+TLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLATIFKADYPPYGRDFVNHEATGRFCNGKLATDITAETLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            FS+YP AYLSP+A+GKNLLIGANFASA SGYD+KT+LL +AIPLS
Sbjct  88   FSTYPPAYLSPKASGKNLLIGANFASAGSGYDDKTSLLSHAIPLS  132



>gb|KDO38516.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=273

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L +AI L+
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLT  138



>ref|XP_007150584.1| hypothetical protein PHAVU_005G164800g [Phaseolus vulgaris]
 gb|ESW22578.1| hypothetical protein PHAVU_005G164800g [Phaseolus vulgaris]
Length=353

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNHQPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F S+  AYLSPQA+GKNLLIGANFASAASGYDEK A+L +AIPLS
Sbjct  87   FKSFAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHAIPLS  131



>ref|XP_004964566.1| PREDICTED: GDSL esterase/lipase APG-like [Setaria italica]
Length=357

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++ FGDSSVDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  29   QPLVPAVMTFGDSSVDVGNNDYLHTIIKANFPPYGRDFANHVATGRFCNGKLATDITADT  88

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLS
Sbjct  89   LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLS  135



>gb|KHN39266.1| GDSL esterase/lipase APG [Glycine soja]
Length=353

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDFA+HQPTGRFCNGKLATD TADTLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFANHQPTGRFCNGKLATDFTADTLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +Y  AYLSPQA+GKNLLIGANFASAASGYDE  A L +AIPLS
Sbjct  87   FKTYAPAYLSPQASGKNLLIGANFASAASGYDENAATLNHAIPLS  131



>ref|NP_001242561.1| uncharacterized protein LOC100815273 precursor [Glycine max]
 gb|ACU20309.1| unknown [Glycine max]
Length=353

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDFA+HQPTGRFCNGKLATD TADTLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFANHQPTGRFCNGKLATDFTADTLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +Y  AYLSPQA+GKNLLIGANFASAASGYDE  A L +AIPLS
Sbjct  87   FKTYAPAYLSPQASGKNLLIGANFASAASGYDENAATLNHAIPLS  131



>ref|XP_009408845.1| PREDICTED: GDSL esterase/lipase APG-like [Musa acuminata subsp. 
malaccensis]
Length=359

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TIFKAD+PPYGRDF +H+PTGRFCNGKLATDITADTLG
Sbjct  33   LVPAIITFGDSTVDVGNNDYLKTIFKADFPPYGRDFKNHKPTGRFCNGKLATDITADTLG  92

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            FSSYP AYLSP+A+GKNLLIGANFASAASGY + TA L +AIPLS
Sbjct  93   FSSYPSAYLSPEASGKNLLIGANFASAASGYYDDTAYLYHAIPLS  137



>ref|XP_002436473.1| hypothetical protein SORBIDRAFT_10g003340 [Sorghum bicolor]
 gb|EER87840.1| hypothetical protein SORBIDRAFT_10g003340 [Sorghum bicolor]
Length=360

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++ FGDS+VDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  32   QPLVPAVLTFGDSTVDVGNNDYLHTILKANFPPYGRDFANHVATGRFCNGKLATDITADT  91

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLS
Sbjct  92   LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLS  138



>ref|XP_010062556.1| PREDICTED: GDSL esterase/lipase APG [Eucalyptus grandis]
 gb|KCW69695.1| hypothetical protein EUGRSUZ_F03090 [Eucalyptus grandis]
Length=356

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNNNY+ TIF+A+YPPYGRDFA+H+PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSAVDVGNNNYLPTIFRANYPPYGRDFANHKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+ +P AYLSP+A+GKNLLIGANFASAASGYDEK ALL +AI L
Sbjct  91   FTKFPPAYLSPEASGKNLLIGANFASAASGYDEKAALLNHAIAL  134



>gb|KFK38989.1| hypothetical protein AALP_AA3G185500 [Arabis alpina]
Length=352

 Score =   179 bits (454),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPAII FGDS VDVGNNNY+ TIF+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  26   VVPAIITFGDSVVDVGNNNYLPTIFRADYPPYGRDFANHKATGRFCNGKLATDITAETLG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL +AIPL
Sbjct  86   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPL  129



>ref|XP_010244385.1| PREDICTED: GDSL esterase/lipase APG-like [Nelumbo nucifera]
Length=358

 Score =   179 bits (454),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDSSVDVGNN+YV T FKA+YPPYGRDF + +PTGRFCNGKLATDITA+TLG
Sbjct  32   LVPAIITFGDSSVDVGNNDYVTTFFKANYPPYGRDFINRKPTGRFCNGKLATDITAETLG  91

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSPQA+GKNLLIGANFASA SGYD+KTALL + IPLS
Sbjct  92   FTTYPPAYLSPQASGKNLLIGANFASAGSGYDDKTALLSHVIPLS  136



>ref|XP_010098171.1| GDSL esterase/lipase APG [Morus notabilis]
 gb|EXB74608.1| GDSL esterase/lipase APG [Morus notabilis]
Length=353

 Score =   179 bits (453),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPA+IAFGDSSVDVGNNNY  T+FKA+YPPYGRDF +HQ TGRFCNGKLATD+TA+TLG
Sbjct  28   LVPAVIAFGDSSVDVGNNNYRPTLFKANYPPYGRDFINHQATGRFCNGKLATDLTAETLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F  YP AYLSP+A+GKNLLIGANFASAA+GYDEK ++L +AIPLS
Sbjct  88   FKKYPAAYLSPEASGKNLLIGANFASAAAGYDEKASVLNHAIPLS  132



>gb|KDO38512.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=302

 Score =   177 bits (450),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L +AI L+
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLT  138



>ref|NP_001136705.1| hypothetical protein precursor [Zea mays]
 gb|ACF82439.1| unknown [Zea mays]
Length=341

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDSSVDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  29   QPLVPALFTFGDSSVDVGNNDYLHTIIKANFPPYGRDFANHVATGRFCNGKLATDITADT  88

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLS
Sbjct  89   LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLS  135



>gb|KDO38513.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=319

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L +AI L+
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLT  138



>ref|XP_010545663.1| PREDICTED: GDSL esterase/lipase APG [Tarenaya hassleriana]
Length=357

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNNNY+ TIF+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSAVDVGNNNYLPTIFRADYPPYGRDFANHEATGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F++YP AYLSPQA+GKNLLIGANFASAASGYD K A++ +AIPL
Sbjct  91   FTAYPPAYLSPQASGKNLLIGANFASAASGYDPKPAIINHAIPL  134



>ref|XP_008654481.1| PREDICTED: uncharacterized protein LOC100216840 isoform X1 [Zea 
mays]
 gb|AFW83669.1| hypothetical protein ZEAMMB73_889110 [Zea mays]
Length=420

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDSSVDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  92   QPLVPALFTFGDSSVDVGNNDYLHTIIKANFPPYGRDFANHVATGRFCNGKLATDITADT  151

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+ +AIPLS
Sbjct  152  LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYHAIPLS  198



>ref|NP_188258.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9LU14.1|APG2_ARATH RecName: Full=GDSL esterase/lipase APG; AltName: Full=Extracellular 
lipase APG; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01276.1| proline-rich protein APG-like; GDSL-motif lipase/hydrolase-like 
protein [Arabidopsis thaliana]
 gb|AAL77704.1| AT3g16370/MYA6_18 [Arabidopsis thaliana]
 gb|AAO11525.1| At3g16370/MYA6_18 [Arabidopsis thaliana]
 gb|AEE75804.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=353

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKATGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL +AIPL
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPL  130



>ref|XP_004486794.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=353

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF +H+ TGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNHKSTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F SY  AYLSPQATGKNLLIGANFASAASGYDEK ++L +AIPLS
Sbjct  87   FKSYAPAYLSPQATGKNLLIGANFASAASGYDEKASILNHAIPLS  131



>ref|XP_006426844.1| hypothetical protein CICLE_v10025938mg [Citrus clementina]
 gb|ESR40084.1| hypothetical protein CICLE_v10025938mg [Citrus clementina]
 gb|KDO38514.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=359

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  92

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L +AI L+
Sbjct  93   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLT  138



>ref|XP_006465718.1| PREDICTED: GDSL esterase/lipase APG-like [Citrus sinensis]
Length=357

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD TADTL
Sbjct  31   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDFTADTL  90

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF +Y  AYLSPQATGKNLLIGANFASA SGYD++T+ L +AI L+
Sbjct  91   GFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLT  136



>emb|CAB81548.2| putative proline-rich protein APG isolog [Cicer arietinum]
Length=350

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  24   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNKQPTGRFCNGKLATDITAETLG  83

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F+S+  AYLSPQA+GKNLLIGANFASAASGYDEK A+L +A+PLS
Sbjct  84   FTSFAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHALPLS  128



>ref|XP_002883003.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59262.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=353

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIMTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKATGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K AL+ +AIPL
Sbjct  87   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPL  130



>ref|XP_009146144.1| PREDICTED: GDSL esterase/lipase APG [Brassica rapa]
 emb|CDY56196.1| BnaA05g36890D [Brassica napus]
Length=358

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            L P +I FGDS VDVGNNNY+ T+F+ADYPPYGRDFA H+PTGRFCNGKLATDITA+TLG
Sbjct  32   LFPGMIIFGDSVVDVGNNNYLPTLFRADYPPYGRDFAGHKPTGRFCNGKLATDITAETLG  91

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL +AIPL
Sbjct  92   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPL  135



>gb|KHN32662.1| GDSL esterase/lipase APG [Glycine soja]
Length=295

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VD+GNN+Y+ T+FKA+YPPYGRDF++HQPTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDIGNNDYLPTLFKANYPPYGRDFSNHQPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F S+  AYLSPQA+GKNLLIG NFASAASG DEK A+L +AIPLS
Sbjct  87   FKSFAPAYLSPQASGKNLLIGGNFASAASGNDEKAAILNHAIPLS  131



>gb|AFW83670.1| hypothetical protein ZEAMMB73_889110 [Zea mays]
Length=211

 Score =   172 bits (437),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDSSVDVGNN+Y+HTI KA++PPYGRDFA+H  TGRFCNGKLATDITADT
Sbjct  92   QPLVPALFTFGDSSVDVGNNDYLHTIIKANFPPYGRDFANHVATGRFCNGKLATDITADT  151

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF++YP AYLSPQA+G+NLLIGANFASA SGY + TAL+  +I  S
Sbjct  152  LGFTTYPAAYLSPQASGQNLLIGANFASAGSGYYDHTALMYVSIIRS  198



>ref|XP_004510325.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=356

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  30   LVPAIITFGDSAVDVGNNDYLPTLFKANYPPYGRDFVNKQPTGRFCNGKLATDITAETLG  89

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F+S+  AYLSPQA+GKNLLIGANFASAASGYDEK A+L +A+PLS
Sbjct  90   FTSFAPAYLSPQASGKNLLIGANFASAASGYDEKAAILNHALPLS  134



>gb|ACJ84797.1| unknown [Medicago truncatula]
 gb|AFK43797.1| unknown [Medicago truncatula]
Length=236

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATD TA+TLG
Sbjct  29   LVPAIMTFGDSAVDVGNNDYLPTLFKANYPPYGRDFTNKQPTGRFCNGKLATDFTAETLG  88

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F+S+  AYLSPQA+GKNLL+GANFASAASGYDEK A L +AIPLS
Sbjct  89   FTSFAPAYLSPQASGKNLLLGANFASAASGYDEKAATLNHAIPLS  133



>ref|XP_006343027.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum tuberosum]
Length=387

 Score =   177 bits (450),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+ DVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKL TD+TAD LG
Sbjct  61   LVPAIITFGDSASDVGNNDYIITLFKANYPPYGRDFVTHQPTGRFCNGKLVTDMTADALG  120

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLLIG NFASAA+GYD+KTA+L +AIPLS
Sbjct  121  FTTYPAAYLSPEASGKNLLIGTNFASAAAGYDDKTAILNHAIPLS  165



>gb|KHN05319.1| GDSL esterase/lipase APG [Glycine soja]
Length=354

 Score =   176 bits (447),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDF +HQPTGRFCNGKLATD TADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFVNHQPTGRFCNGKLATDFTADTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +Y  AYLSP A+GKNLLIGANFASAASGYDE  A L +AIPLS
Sbjct  88   FKTYAPAYLSPHASGKNLLIGANFASAASGYDENAATLNHAIPLS  132



>gb|ACU24285.1| unknown [Glycine max]
Length=354

 Score =   176 bits (447),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDF +HQPTGRFCNGKLATD TADTLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFVNHQPTGRFCNGKLATDFTADTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +Y  AYLSP A+GKNLLIGANFASAASGYDE  A L +AIPLS
Sbjct  88   FKTYAPAYLSPHASGKNLLIGANFASAASGYDENAATLNHAIPLS  132



>ref|XP_007135613.1| hypothetical protein PHAVU_010G143600g [Phaseolus vulgaris]
 gb|ESW07607.1| hypothetical protein PHAVU_010G143600g [Phaseolus vulgaris]
Length=384

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNNNY+ T FKADYPPYGRDF++HQPTGRFCNGKLATDITA+TLG
Sbjct  58   LVPAIITFGDSVVDVGNNNYLPTFFKADYPPYGRDFSNHQPTGRFCNGKLATDITAETLG  117

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +Y  AYLSPQA+GKNLLIGANFASAASGYDE  A L +AI LS
Sbjct  118  FKTYAPAYLSPQASGKNLLIGANFASAASGYDENAATLNHAITLS  162



>ref|XP_002515932.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF46352.1| zinc finger protein, putative [Ricinus communis]
Length=353

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TI+KA+YPPYGRDF +H+PTGRFCNGKLATDITA+TLG
Sbjct  28   LVPAIITFGDSAVDVGNNDYLPTIYKANYPPYGRDFVNHKPTGRFCNGKLATDITAETLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +Y  AYLSP A+GKNLLIGANFASAASGYDEK A+L +AIPLS
Sbjct  88   FKTYAPAYLSPDASGKNLLIGANFASAASGYDEKAAMLNHAIPLS  132



>ref|XP_011072453.1| PREDICTED: GDSL esterase/lipase APG [Sesamum indicum]
Length=350

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 105/139 (76%), Gaps = 14/139 (10%)
 Frame = +2

Query  5    IISHTIS*KMGCRFGEVLavifvaafivgggaQPLVPAIIAFGDSSVDVGNNNYVHTIFK  184
            ++++T++  + C FG                   LVPAII FGDS VDVGNN+Y+HTIFK
Sbjct  4    VLAYTLAVALFCSFGNAQVT--------------LVPAIITFGDSVVDVGNNDYIHTIFK  49

Query  185  ADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQATGKNLLIGANFAS  364
            A+YPPYGRDF + + TGRFCNGKLATDITA+ LGF+SYP AYLSPQA+GKNLL+G+NFAS
Sbjct  50   ANYPPYGRDFKNQEATGRFCNGKLATDITAENLGFTSYPPAYLSPQASGKNLLLGSNFAS  109

Query  365  AASGYDEKTALLXNAIPLS  421
            A +GYDE T+LL + IPLS
Sbjct  110  AGAGYDEHTSLLSHVIPLS  128



>ref|XP_004235633.1| PREDICTED: GDSL esterase/lipase APG-like [Solanum lycopersicum]
Length=417

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+ DVGNN+Y+ T+FKA+YPPYGRDF +HQPTGRFCNGKL TD+TAD LG
Sbjct  91   LVPAIITFGDSASDVGNNDYIITLFKANYPPYGRDFVTHQPTGRFCNGKLVTDMTADALG  150

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLLIG NFASAA+GYD+KTA+L +AIPLS
Sbjct  151  FTTYPAAYLSPEASGKNLLIGTNFASAAAGYDDKTAILNHAIPLS  195



>emb|CDY30167.1| BnaC05g36950D [Brassica napus]
Length=354

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            L P ++ FGDS VDVGNNNY+ T+F+ADYPPYGRDFA H+PTGRFCNGKLATDITA+TLG
Sbjct  28   LFPGMMIFGDSVVDVGNNNYLPTLFRADYPPYGRDFAGHKPTGRFCNGKLATDITAETLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+ YP AYLSP+A+GKNLLIGANFASAASGYD+K ALL +AIPL
Sbjct  88   FTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPL  131



>ref|XP_011008871.1| PREDICTED: GDSL esterase/lipase APG [Populus euphratica]
Length=352

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF  H+PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTIFKANYPPYGRDFVDHKPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F SY  AYLSP+A+GKNLLIG+NFASAASGYDE+ A L +AIPLS
Sbjct  87   FKSYAPAYLSPEASGKNLLIGSNFASAASGYDERAAALNHAIPLS  131



>ref|XP_006369216.1| hypothetical protein POPTR_0001s19240g [Populus trichocarpa]
 gb|ERP65785.1| hypothetical protein POPTR_0001s19240g [Populus trichocarpa]
Length=329

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            L PAII+FGDSSVDVGNNN++ TIFKA+YPPYGRDFA+H+PTGRFCNGKL  DITA+ LG
Sbjct  27   LFPAIISFGDSSVDVGNNNHLSTIFKANYPPYGRDFANHKPTGRFCNGKLTIDITAEALG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +Y  AYLSP+A+GKNLLIG NFASAASGYD+KTA L NAIPLS
Sbjct  87   FKTYAPAYLSPEASGKNLLIGVNFASAASGYDDKTAFLNNAIPLS  131



>ref|XP_010925408.1| PREDICTED: GDSL esterase/lipase APG [Elaeis guineensis]
Length=365

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HTIFKA+YPPYGRDF +HQ TGRFCNGKLATDITA+TLG
Sbjct  39   LVPAIITFGDSTVDVGNNDYIHTIFKANYPPYGRDFVNHQATGRFCNGKLATDITANTLG  98

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F+SYP AYLSPQA+G NLL+G NFASAASGY + TA L +AIPLS
Sbjct  99   FTSYPPAYLSPQASGNNLLMGVNFASAASGYYDGTAYLNHAIPLS  143



>ref|XP_003531641.2| PREDICTED: GDSL esterase/lipase APG-like [Glycine max]
Length=393

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ T+FKADYPPYGRDF +HQPTGRFCNGKLATD TADTLG
Sbjct  67   LVPAIITFGDSAVDVGNNDYLPTLFKADYPPYGRDFVNHQPTGRFCNGKLATDFTADTLG  126

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +Y  AYLSP A+GKNLLIGANFASAASGYDE  A L +AIPLS
Sbjct  127  FKTYAPAYLSPHASGKNLLIGANFASAASGYDENAATLNHAIPLS  171



>ref|XP_004302841.1| PREDICTED: GDSL esterase/lipase APG [Fragaria vesca subsp. vesca]
Length=357

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI  FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF +H+ TGRFCNGKLATDITADTLG
Sbjct  31   LVPAIFTFGDSAVDVGNNDYLPTIFKANYPPYGRDFVNHKATGRFCNGKLATDITADTLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F  YP AYLSPQA+GKNLLIGANFASAASGYDEK A L +AI L
Sbjct  91   FKLYPAAYLSPQASGKNLLIGANFASAASGYDEKAAYLNHAISL  134



>ref|XP_003627082.1| GDSL esterase/lipase APG [Medicago truncatula]
 gb|AET01558.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=355

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS+VDVGNN+Y+ T+FKA+YPPYGRDF + QPTGRFCNGKLATD TA+TLG
Sbjct  29   LVPAIMTFGDSAVDVGNNDYLPTLFKANYPPYGRDFTNKQPTGRFCNGKLATDFTAETLG  88

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F+S+  AYLSPQA+GKNLL+GANFASAASGYDEK A L +AIPLS
Sbjct  89   FTSFAPAYLSPQASGKNLLLGANFASAASGYDEKAATLNHAIPLS  133



>gb|EMS47165.1| GDSL esterase/lipase APG [Triticum urartu]
Length=351

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP +  FGDSSVD+GNN+Y+HT+ KAD+PPYGRDF +   TGRFCNGKLATDITADT
Sbjct  23   QPLVPGVFTFGDSSVDIGNNDYLHTLIKADFPPYGRDFPNRVATGRFCNGKLATDITADT  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLSPQA+GKNLLIGANFASA SGY + TAL+ +AIP S
Sbjct  83   LGFTSYPPAYLSPQASGKNLLIGANFASAGSGYYDHTALMYHAIPFS  129



>ref|XP_002298249.2| putative proline-rich protein APG isolog [Populus trichocarpa]
 gb|ABK95990.1| unknown [Populus trichocarpa]
 gb|EEE83054.2| putative proline-rich protein APG isolog [Populus trichocarpa]
Length=352

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+ TIFKA+YPPYGRDF   +PTGRFCNGKLATDITA+TLG
Sbjct  27   LVPAIITFGDSAVDVGNNDYLPTIFKANYPPYGRDFVDQKPTGRFCNGKLATDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F SY  AYLSP A+GKNLLIG+NFASAASGYDEK A L +AIPLS
Sbjct  87   FKSYAPAYLSPDASGKNLLIGSNFASAASGYDEKAAALNHAIPLS  131



>gb|KDP40834.1| hypothetical protein JCGZ_24833 [Jatropha curcas]
Length=352

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPAII FGDS+VDVGNN+Y+ TI+KA+YPPYGRDF +HQPTGRFCNGKLATDITA++LG
Sbjct  27   VVPAIITFGDSAVDVGNNDYLPTIYKANYPPYGRDFVNHQPTGRFCNGKLATDITAESLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F +YP AYLSP A+GKNLLIGANFASAASGYD+K A + +AIPL
Sbjct  87   FKTYPPAYLSPDASGKNLLIGANFASAASGYDDKAATVNHAIPL  130



>ref|XP_008793255.1| PREDICTED: GDSL esterase/lipase APG [Phoenix dactylifera]
Length=358

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNN+Y+HT FKA+ PPYGRDF +HQ TGRFCNGKLATDITA+TLG
Sbjct  32   LVPAIITFGDSTVDVGNNDYIHTAFKANCPPYGRDFVNHQATGRFCNGKLATDITANTLG  91

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+SYP AYLSPQA+GKNLL+G NFASAASGY ++TA L +AIPL
Sbjct  92   FTSYPPAYLSPQASGKNLLMGVNFASAASGYYDETAYLNHAIPL  135



>ref|XP_008447571.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis melo]
Length=354

 Score =   171 bits (433),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VDVGNNNY++TI+KA+YPPYG+DF +HQPTGRFCNGKLATD TA TLG
Sbjct  28   LVPAIITFGDSAVDVGNNNYLYTIYKANYPPYGKDFVNHQPTGRFCNGKLATDFTAQTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F ++P+ YLSP+A+GKNLLIG NFASAASGYDE  ALL +A+ L
Sbjct  88   FKTFPLPYLSPEASGKNLLIGVNFASAASGYDENAALLNHALSL  131



>gb|EYU21440.1| hypothetical protein MIMGU_mgv1a009146mg [Erythranthe guttata]
Length=342

 Score =   171 bits (432),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKADYPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  25   LVPAIITFGDSVVDVGNNDYIPTIFKADYPPYGRDFKNKQPTGRFCNGKLATDITAETLG  84

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F+S+   YLSPQA+GKNLL+GANFASA +GYD+ T+LL + IPLS
Sbjct  85   FTSFAPPYLSPQASGKNLLLGANFASAGAGYDDHTSLLSHVIPLS  129



>gb|EYU21439.1| hypothetical protein MIMGU_mgv1a009146mg [Erythranthe guttata]
Length=351

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKADYPPYGRDF + QPTGRFCNGKLATDITA+TLG
Sbjct  25   LVPAIITFGDSVVDVGNNDYIPTIFKADYPPYGRDFKNKQPTGRFCNGKLATDITAETLG  84

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F+S+   YLSPQA+GKNLL+GANFASA +GYD+ T+LL + IPLS
Sbjct  85   FTSFAPPYLSPQASGKNLLLGANFASAGAGYDDHTSLLSHVIPLS  129



>gb|KJB56732.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=237

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++ +AI L+
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLT  135



>ref|XP_009388555.1| PREDICTED: GDSL esterase/lipase APG-like [Musa acuminata subsp. 
malaccensis]
Length=358

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPA+I FGDS+VDVGNN+Y+ T+F+AD+PPYGRDF +H+PTGRFCNGKLATD+TADTLG
Sbjct  32   LVPALITFGDSTVDVGNNDYLKTVFRADFPPYGRDFKNHEPTGRFCNGKLATDLTADTLG  91

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSPQA+GKNLLIGANFASA SG  ++T+ L +AIPL+
Sbjct  92   FTTYPPAYLSPQASGKNLLIGANFASAGSGLYDETSYLSHAIPLT  136



>gb|KHG15938.1| GDSL esterase/lipase APG -like protein [Gossypium arboreum]
Length=356

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLLIGANFASA SGYD+K +++ +AI L+
Sbjct  91   FTTYPPAYLSPEASGKNLLIGANFASAGSGYDDKASMVNHAITLT  135



>ref|NP_001056808.1| Os06g0148200 [Oryza sativa Japonica Group]
 gb|AAP33477.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAD68619.1| putative nodulin [Oryza sativa Japonica Group]
 dbj|BAD68792.1| putative nodulin [Oryza sativa Japonica Group]
 dbj|BAF18722.1| Os06g0148200 [Oryza sativa Japonica Group]
 gb|EAY99692.1| hypothetical protein OsI_21674 [Oryza sativa Indica Group]
 dbj|BAG87362.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98734.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65086.1| hypothetical protein OsJ_20126 [Oryza sativa Japonica Group]
Length=351

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++ FGDSSVDVGNN+Y+ TI KA++PPYGRDF +  PTGRFCNGKLATDITA+T
Sbjct  23   QPLVPAVMTFGDSSVDVGNNDYLKTIIKANFPPYGRDFKNQVPTGRFCNGKLATDITAET  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF SY  AYLSP A+GKNLLIGANFASA SGY + TALL +AIPLS
Sbjct  83   LGFESYAPAYLSPDASGKNLLIGANFASAGSGYYDHTALLYHAIPLS  129



>ref|XP_004486795.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=352

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVPAII FGDS+VDVGNN+ + TIFK++YPPYGRDF + +PTGRFCNGKLATDITADT
Sbjct  24   QSLVPAIITFGDSTVDVGNNDNLSTIFKSNYPPYGRDFLNQEPTGRFCNGKLATDITADT  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF++Y  AYLS QATGKNLL+GANFASAASGYDE +A    AIPLS
Sbjct  84   LGFTNYAPAYLSSQATGKNLLLGANFASAASGYDENSATFYGAIPLS  130



>gb|AAB63641.1| Proline-rich protein APG isolog [Arabidopsis thaliana]
Length=322

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  122  IAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYP  301
            + FGDS VDVGNNNY+ T+F+ADYPPYGRDFA+H+ TGRFCNGKLATDITA+TLGF+ YP
Sbjct  1    MTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKATGRFCNGKLATDITAETLGFTKYP  60

Query  302  VAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
             AYLSP+A+GKNLLIGANFASAASGYD+K ALL +AIPL
Sbjct  61   PAYLSPEASGKNLLIGANFASAASGYDDKAALLNHAIPL  99



>ref|XP_006826756.1| hypothetical protein AMTR_s00136p00069360 [Amborella trichopoda]
 gb|ERM93993.1| hypothetical protein AMTR_s00136p00069360 [Amborella trichopoda]
Length=349

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVPAII FGDS+VDVGNN+Y+ TIFKAD+PPYGRDF +  PTGRFCNGKLATDITA+T
Sbjct  22   QALVPAIITFGDSAVDVGNNDYLPTIFKADFPPYGRDFVNRSPTGRFCNGKLATDITAET  81

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+S+P AYLS QA+GKNLLIGANFAS ASGY +KTA L +AI LS
Sbjct  82   LGFTSFPPAYLSSQASGKNLLIGANFASGASGYYDKTAYLYHAISLS  128



>ref|XP_006655787.1| PREDICTED: GDSL esterase/lipase APG-like [Oryza brachyantha]
Length=351

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP ++ FGDSSVDVGNN+Y+HTI KA++PPYGRDF +   TGRFCNGKLATDITA+T
Sbjct  23   QPLVPGVMTFGDSSVDVGNNDYLHTIIKANFPPYGRDFKNGAATGRFCNGKLATDITAET  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF SY  AYLSP+A+GKNLLIGANFASA SGY + TALL +AIPLS
Sbjct  83   LGFESYAPAYLSPEASGKNLLIGANFASAGSGYYDHTALLYHAIPLS  129



>gb|KJB56736.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=300

 Score =   167 bits (423),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++ +AI L+
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLT  135



>ref|XP_007024353.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY26975.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=354

 Score =   169 bits (427),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDF +HQPTGRFCNGKLATDITA TLG
Sbjct  29   VVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFDNHQPTGRFCNGKLATDITAKTLG  88

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLLIGANFASA SGYD+  A L +AI L+
Sbjct  89   FTTYPPAYLSPEASGKNLLIGANFASAGSGYDDNAATLNHAITLT  133



>gb|KJB56734.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=296

 Score =   167 bits (423),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++ +AI L+
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLT  135



>emb|CAN65530.1| hypothetical protein VITISV_039629 [Vitis vinifera]
Length=355

 Score =   168 bits (426),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+I FGDS+VD GNNNY  T FKA+Y PYG+DF SHQPTGRFCNGKLATDITAD LG
Sbjct  30   IVPALILFGDSAVDSGNNNYFPTAFKANYLPYGKDFISHQPTGRFCNGKLATDITADILG  89

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +YP AYLSPQATGKNLL+GANF SAA+GYD+ TA++ +AIPLS
Sbjct  90   FKTYPPAYLSPQATGKNLLVGANFGSAAAGYDDNTAIINHAIPLS  134



>ref|XP_006426845.1| hypothetical protein CICLE_v10025957mg [Citrus clementina]
 gb|ESR40085.1| hypothetical protein CICLE_v10025957mg [Citrus clementina]
Length=355

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII+FGDSSVDVGNNN++ T FKA+YPPYGRDF +HQPTGRFC+GKL TD TADTL
Sbjct  29   PLVPAIISFGDSSVDVGNNNHLLTYFKANYPPYGRDFINHQPTGRFCDGKLVTDFTADTL  88

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF +Y  AYLSPQAT KNLLIGANFASA SGYD  T+++ +AI L+
Sbjct  89   GFKTYAPAYLSPQATRKNLLIGANFASAGSGYDGNTSIINHAISLT  134



>gb|KJB56735.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=356

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++ +AI L+
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLT  135



>gb|KJB56733.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=364

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ +++ +AI L+
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLT  135



>ref|XP_004516916.1| PREDICTED: GDSL esterase/lipase APG-like [Cicer arietinum]
Length=352

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVPAII FGDS+VDVGNN+ + T+FK+++PPYGRDF + +PTGRFCNGKLATDITADT
Sbjct  24   QTLVPAIITFGDSAVDVGNNDNLPTLFKSNHPPYGRDFLNQEPTGRFCNGKLATDITADT  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SY  AYLS QATGKNLL+GANFASAASGYDE +A    AIPLS
Sbjct  84   LGFTSYAPAYLSSQATGKNLLLGANFASAASGYDENSATFNGAIPLS  130



>ref|XP_003557194.1| PREDICTED: GDSL esterase/lipase APG [Brachypodium distachyon]
Length=352

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP +  FGDSSVDVGNN+Y+HT+ KAD+PPYGRDF     TGRFCNGKLATDITADT
Sbjct  24   QPLVPGLFTFGDSSVDVGNNDYLHTLIKADFPPYGRDFQGRVATGRFCNGKLATDITADT  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLSP+A+G+NLLIGANFASA SGY + TAL+ +AI  +
Sbjct  84   LGFTSYPPAYLSPEASGQNLLIGANFASAGSGYYDHTALMYHAISFT  130



>gb|KJB70371.1| hypothetical protein B456_011G070000 [Gossypium raimondii]
Length=353

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L +AI LS
Sbjct  91   FTTYPPAYLSPEASGNNLLIGANFASAGSGYDDRAASLNHAITLS  135



>ref|XP_002277514.1| PREDICTED: GDSL esterase/lipase APG [Vitis vinifera]
Length=355

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PA+I FGDS+VD GNNNY  T FKA+Y PYG+DF SHQPTGRFCNGKLATDITAD LG
Sbjct  30   IAPAMILFGDSAVDSGNNNYFPTAFKANYLPYGKDFISHQPTGRFCNGKLATDITADILG  89

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +YP AYLSPQATGKNLL+GANF SAA+GYD+ TA++ +AIPLS
Sbjct  90   FETYPPAYLSPQATGKNLLVGANFGSAAAGYDDNTAIINHAIPLS  134



>gb|KJB70369.1| hypothetical protein B456_011G070000 [Gossypium raimondii]
Length=356

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L +AI LS
Sbjct  91   FTTYPPAYLSPEASGNNLLIGANFASAGSGYDDRAASLNHAITLS  135



>ref|XP_002313641.2| GDSL-motif lipase family protein [Populus trichocarpa]
 gb|EEE87596.2| GDSL-motif lipase family protein [Populus trichocarpa]
Length=352

 Score =   166 bits (421),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLA+D+TA+ 
Sbjct  25   QPLVPAMFIFGDSVVDAGNNNHLYTIIKANFPPYGRDFVNHKPTGRFCNGKLASDLTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A GKNLLIGANFASAASGY E TA L +AIPLS
Sbjct  85   LGFTSYPPAYLSKKARGKNLLIGANFASAASGYYETTAKLYHAIPLS  131



>emb|CBI36031.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PA+I FGDS+VD GNNNY  T FKA+Y PYG+DF SHQPTGRFCNGKLATDITAD LG
Sbjct  38   IAPAMILFGDSAVDSGNNNYFPTAFKANYLPYGKDFISHQPTGRFCNGKLATDITADILG  97

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +YP AYLSPQATGKNLL+GANF SAA+GYD+ TA++ +AIPLS
Sbjct  98   FETYPPAYLSPQATGKNLLVGANFGSAAAGYDDNTAIINHAIPLS  142



>ref|XP_004149175.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis sativus]
 ref|XP_004170192.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis sativus]
 gb|KGN58016.1| hypothetical protein Csa_3G434970 [Cucumis sativus]
Length=354

 Score =   166 bits (420),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS+VDVGNNNY++T+FKA++ PYG+DF +HQPTGRFCNGKLATD TA TLG
Sbjct  28   LVPAIMTFGDSAVDVGNNNYLYTVFKANHLPYGKDFVNHQPTGRFCNGKLATDFTAQTLG  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F ++P+ YLSP+A+GKNLLIG NFASAASGYDE  ALL +A+ L
Sbjct  88   FKTFPLPYLSPEASGKNLLIGVNFASAASGYDENAALLNHALSL  131



>ref|XP_011044241.1| PREDICTED: GDSL esterase/lipase At5g22810 [Populus euphratica]
Length=352

 Score =   166 bits (420),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLA+D+TA+ 
Sbjct  25   QPLVPAMFIFGDSVVDAGNNNHLYTIVKANFPPYGRDFVNHKPTGRFCNGKLASDLTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A GKNLLIGANFASAASGY E TA L +AIPLS
Sbjct  85   LGFTSYPPAYLSKKARGKNLLIGANFASAASGYYETTAKLYHAIPLS  131



>gb|KJB70370.1| hypothetical protein B456_011G070000 [Gossypium raimondii]
Length=394

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L +AI LS
Sbjct  91   FTTYPPAYLSPEASGNNLLIGANFASAGSGYDDRAASLNHAITLS  135



>gb|EPS71085.1| hypothetical protein M569_03672, partial [Genlisea aurea]
Length=327

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS+VD GNN+Y+ T+F+AD+PPYGRDF +  PTGRF NGKL TD+TADTLG
Sbjct  1    LVPAIIIFGDSAVDTGNNDYIPTVFRADHPPYGRDFKNKLPTGRFSNGKLVTDLTADTLG  60

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F+SYP AYL P+A+GK LL+GANFASA SGYDE+TALL + IPL+
Sbjct  61   FTSYPAAYLGPEASGKRLLVGANFASAGSGYDERTALLSSVIPLN  105



>gb|KHG07525.1| GDSL esterase/lipase APG -like protein [Gossypium arboreum]
Length=357

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAI+ FGDS VDVGNN+Y+ TIF+A+YPPYGRDFA+ +P+GRFCNGKLATDITA+TLG
Sbjct  31   LVPAILTFGDSVVDVGNNDYLPTIFRANYPPYGRDFANQKPSGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+G NLLIGANFASA SGYD++ A L +AI LS
Sbjct  91   FTTYPPAYLSPEASGSNLLIGANFASAGSGYDDRAASLNHAITLS  135



>ref|XP_010495383.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Camelina sativa]
Length=184

 Score =   159 bits (403),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS VDVGNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  31   QPLVPSMFIFGDSVVDVGNNNDIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            LGF+SYP AYLS +A GKNLL GANFASAASGY + TA L +AI L
Sbjct  91   LGFTSYPQAYLSKKAKGKNLLTGANFASAASGYYDGTAKLYSAISL  136



>gb|KDO42514.1| hypothetical protein CISIN_1g040658mg, partial [Citrus sinensis]
Length=287

 Score =   161 bits (408),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY++TI KA++ PYGRDF  H+PTGRFCNGKLA D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDAGNNNYIYTIVKANFRPYGRDFVHHKPTGRFCNGKLAADFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+SYP AYLS +A GKNLLIGANFAS ASGY E TA L +AIPLS
Sbjct  84   IGFTSYPPAYLSEEAKGKNLLIGANFASGASGYYETTAKLYHAIPLS  130



>gb|EMT10375.1| GDSL esterase/lipase APG [Aegilops tauschii]
Length=351

 Score =   163 bits (413),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP +  FGDSSVD+GNN+ +H + KAD+PPYGR F +   TGRFCNGKLATDITADT
Sbjct  23   QPLVPGVFTFGDSSVDIGNNDSLHPLIKADFPPYGRAFPNRVATGRFCNGKLATDITADT  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLSPQA+GKNLLIGANFASA SGY + TAL+ +AIP S
Sbjct  83   LGFTSYPPAYLSPQASGKNLLIGANFASAGSGYYDHTALMYHAIPFS  129



>ref|XP_011089987.1| PREDICTED: GDSL esterase/lipase At5g22810 [Sesamum indicum]
Length=338

 Score =   163 bits (412),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++ FGDS VDVGNNN + TI KA++PPYGRDF  H+PTGRFCNGKLA+D TA+ 
Sbjct  11   QPLVPALLIFGDSVVDVGNNNNLETIVKANFPPYGRDFIKHKPTGRFCNGKLASDFTAEN  70

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS QA GKNLLIGANFAS +SGY + TA + N IPLS
Sbjct  71   LGFTSYPPAYLSKQARGKNLLIGANFASGSSGYYDTTAKIYNTIPLS  117



>ref|XP_006382055.1| hypothetical protein POPTR_0006s256601g, partial [Populus trichocarpa]
 gb|ERP59852.1| hypothetical protein POPTR_0006s256601g, partial [Populus trichocarpa]
Length=106

 Score =   155 bits (392),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            L PAII+FGDSSVDVGNNN++ TIFKA+YPPYGRDFA+H+PTGRFCNGKL  DITA+ L 
Sbjct  8    LFPAIISFGDSSVDVGNNNHLSTIFKANYPPYGRDFANHKPTGRFCNGKLTIDITAEALR  67

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALL  400
            F +Y  AYL P+A+GKNLLIG NFASAASGYD+KT  L
Sbjct  68   FKTYAPAYLIPEASGKNLLIGVNFASAASGYDDKTDFL  105



>gb|KJB56729.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=354

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 95/105 (90%), Gaps = 2/105 (2%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDITA+TLG
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDITAETLG  90

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F++YP AYLSP+A+GKNLL+GANFASA SGYD++ ++  +AI L+
Sbjct  91   FTTYPPAYLSPEASGKNLLLGANFASAGSGYDDEASM--HAITLT  133



>ref|XP_010242974.1| PREDICTED: GDSL esterase/lipase At5g22810 [Nelumbo nucifera]
Length=352

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN ++T+ KA++PPYGRDF  H+PTGRFCNGKLA+D TA+ 
Sbjct  25   QPLVPALCIFGDSVVDVGNNNNLYTLVKANFPPYGRDFTKHRPTGRFCNGKLASDFTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF++YP AYLSP+A G NLLIGANFASA+SGY ++TA L +AIPL+
Sbjct  85   LGFTTYPPAYLSPEARGNNLLIGANFASASSGYYDRTAQLYDAIPLT  131



>ref|XP_006484945.1| PREDICTED: GDSL esterase/lipase At5g22810-like, partial [Citrus 
sinensis]
Length=351

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY++TI KA++ PYGRDF  H+PTGRFCNGKLA D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDAGNNNYIYTIVKANFRPYGRDFVHHKPTGRFCNGKLAADFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+SYP AYLS +A GKNLLIGANFAS ASGY E TA L +AIPLS
Sbjct  84   IGFTSYPPAYLSEEAKGKNLLIGANFASGASGYYETTAKLYHAIPLS  130



>ref|XP_006400789.1| hypothetical protein EUTSA_v10015700mg [Eutrema salsugineum]
 gb|ESQ42242.1| hypothetical protein EUTSA_v10015700mg [Eutrema salsugineum]
Length=336

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  4    QPLVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  63

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            LGF+SYP AYLS +A G+NLLIGANFASAASGY + TA L +AI L
Sbjct  64   LGFTSYPQAYLSKKAKGRNLLIGANFASAASGYYDGTAKLYSAISL  109



>ref|XP_006465717.1| PREDICTED: GDSL esterase/lipase APG-like isoform X1 [Citrus sinensis]
Length=355

 Score =   161 bits (407),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAI++FGDSSVDVGNNN++ T FKA+YPPYGR+F  HQPTGRF +GKL TD TADTL
Sbjct  29   PLVPAIVSFGDSSVDVGNNNHLLTYFKANYPPYGREFIDHQPTGRFSDGKLVTDFTADTL  88

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF +Y  AYLS QATGKNLLIGANFASA SGYD  T+++ +AI L+
Sbjct  89   GFKTYAPAYLSSQATGKNLLIGANFASAGSGYDGNTSIINHAISLT  134



>ref|NP_197672.1| GDSL esterase/lipase [Arabidopsis thaliana]
 dbj|BAB10602.1| GDSL-motif lipase/hydrolase-like protein [Arabidopsis thaliana]
 gb|AED93082.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=337

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPAI  FGDS VDVGNNN ++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ 
Sbjct  7    QPLVPAIFIFGDSVVDVGNNNDIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAEN  66

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            LGF SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L
Sbjct  67   LGFKSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISL  112



>sp|Q9FFC6.3|GDL78_ARATH RecName: Full=GDSL esterase/lipase At5g22810; AltName: Full=Extracellular 
lipase At5g22810; Flags: Precursor [Arabidopsis 
thaliana]
Length=362

 Score =   161 bits (407),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPAI  FGDS VDVGNNN ++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ 
Sbjct  32   QPLVPAIFIFGDSVVDVGNNNDIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAEN  91

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            LGF SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L
Sbjct  92   LGFKSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISL  137



>ref|XP_009796088.1| PREDICTED: GDSL esterase/lipase At5g22810 [Nicotiana sylvestris]
Length=352

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY+ TI KA++PPYGRDF  H PTGRFCNGKLA+D TA+ 
Sbjct  25   QPLVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKHTPTGRFCNGKLASDFTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + TA L +AIPLS
Sbjct  85   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTARLYDAIPLS  131



>ref|XP_002872020.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48279.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=337

 Score =   160 bits (405),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN ++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ 
Sbjct  7    QPLVPAMFIFGDSVVDVGNNNDIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAEN  66

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            LGF+SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L
Sbjct  67   LGFTSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISL  112



>ref|XP_010689974.1| PREDICTED: GDSL esterase/lipase At5g22810 [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QP+VPA+  FGDS VDVGNNN +HTI K+D+ PYGRDF+ HQPTGRFCNGKLATD TA+T
Sbjct  27   QPIVPALFIFGDSVVDVGNNNNLHTIVKSDFLPYGRDFSYHQPTGRFCNGKLATDFTAET  86

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+SY  AYLS +ATG+NLLIGANFASA+SGY   T  + N IPLS
Sbjct  87   IGFTSYQPAYLSTEATGENLLIGANFASASSGYHASTPKIYNTIPLS  133



>ref|XP_002271400.1| PREDICTED: GDSL esterase/lipase At5g22810 [Vitis vinifera]
Length=351

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS+VD GNNN++ TI KA++PPYGRDF SH+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSAVDAGNNNHLDTIVKANFPPYGRDFISHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+SYP AYLS +A G NLLIGANFASAASGY   TA L NAI LS
Sbjct  84   IGFTSYPPAYLSKEAKGNNLLIGANFASAASGYYHTTAKLSNAISLS  130



>ref|XP_009337386.1| PREDICTED: GDSL esterase/lipase At5g22810 [Pyrus x bretschneideri]
Length=350

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN+++T+ KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  21   QPLVPAMFVFGDSVVDAGNNNHLYTLIKANFPPYGRDFVNHKPTGRFCNGKLASDFTAEN  80

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A GKNLLIGANF SA SGY E TA L NAI L+
Sbjct  81   LGFTSYPPAYLSKEANGKNLLIGANFGSAGSGYYEYTAKLYNAISLN  127



>gb|KFK27616.1| hypothetical protein AALP_AA8G406700 [Arabis alpina]
Length=364

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP++  FGDS VDVGNNN ++TI KA++PPYGRDF  HQPTGRFCNGKLATD TA+ 
Sbjct  34   QSLVPSMFIFGDSVVDVGNNNNIYTIVKANFPPYGRDFTRHQPTGRFCNGKLATDFTAEN  93

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A GKNLLIGANFASAASGY + TA L +AI L+
Sbjct  94   LGFTSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLA  140



>ref|XP_010493379.1| PREDICTED: GDSL esterase/lipase At5g22810 [Camelina sativa]
Length=361

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS VDVGNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  31   QPLVPSMFIFGDSVVDVGNNNEIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            LGF+SYP AYLS +A GKNLL GANFASAASGY + TA L +AI L
Sbjct  91   LGFTSYPQAYLSKKAKGKNLLTGANFASAASGYYDGTAKLYSAISL  136



>ref|XP_007015991.1| GDSL esterase/lipase isoform 1 [Theobroma cacao]
 gb|EOY33610.1| GDSL esterase/lipase isoform 1 [Theobroma cacao]
Length=355

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  28   QPLVPAMFIFGDSVVDAGNNNNLYTIIKANFPPYGRDFVNHKPTGRFCNGKLASDFTAEN  87

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+SYP AYLS QA GKNLLIGANFASA+SGY E TA L + + LS
Sbjct  88   IGFTSYPPAYLSKQAEGKNLLIGANFASASSGYYETTAKLYHTLSLS  134



>ref|XP_007015992.1| GDSL esterase/lipase isoform 2, partial [Theobroma cacao]
 gb|EOY33611.1| GDSL esterase/lipase isoform 2, partial [Theobroma cacao]
Length=254

 Score =   155 bits (393),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  28   QPLVPAMFIFGDSVVDAGNNNNLYTIIKANFPPYGRDFVNHKPTGRFCNGKLASDFTAEN  87

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALL  400
            +GF+SYP AYLS QA GKNLLIGANFASA+SGY E TA L
Sbjct  88   IGFTSYPPAYLSKQAEGKNLLIGANFASASSGYYETTAKL  127



>gb|KJB09007.1| hypothetical protein B456_001G118700 [Gossypium raimondii]
Length=293

 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN ++TI KAD+PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDVGNNNNLYTIIKADFPPYGRDFLNHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+ YP AYLS +A G NLLIGANFASA+SGY E TA L + + LS
Sbjct  84   IGFTDYPPAYLSKKAKGNNLLIGANFASASSGYYETTAKLYHTLSLS  130



>ref|XP_006838752.1| hypothetical protein AMTR_s00002p00255920 [Amborella trichopoda]
 gb|ERN01321.1| hypothetical protein AMTR_s00002p00255920 [Amborella trichopoda]
Length=348

 Score =   158 bits (399),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++ FGDS+ D GNNN ++T+ KA++PPYGRDF  H PTGRFCNGKLATDITADT
Sbjct  21   QPLVPAMMIFGDSTADCGNNNGLYTLVKANFPPYGRDFVDHSPTGRFCNGKLATDITADT  80

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP  YL  Q   KN LIGANFASAASGY ++TA L +AIPLS
Sbjct  81   LGFTSYPPPYLGSQPAPKNFLIGANFASAASGYYDRTAQLYHAIPLS  127



>gb|KDP34349.1| hypothetical protein JCGZ_11232 [Jatropha curcas]
Length=351

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS +D GNNN+++TI KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVIDAGNNNHLYTIVKANFPPYGRDFINHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+SYP AYLS +A G NLLIGANFASAASG+ + TA L +AIPLS
Sbjct  84   IGFTSYPPAYLSKEAHGTNLLIGANFASAASGFYDTTAKLYHAIPLS  130



>gb|KHG22657.1| hypothetical protein F383_04802 [Gossypium arboreum]
Length=307

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN ++TI KAD+PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDVGNNNNLYTIIKADFPPYGRDFLNHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+ YP AYLS +A G NLLIGANFASA+SGY E TA L + + LS
Sbjct  84   IGFTDYPPAYLSKKAKGNNLLIGANFASASSGYYETTAKLYHTLSLS  130



>ref|XP_010558217.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Tarenaya hassleriana]
Length=354

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VDVGNNN ++T+ KA++PPYGRDFASH PTGRFCNGKLATD TAD 
Sbjct  26   QPLVPALIIMGDSVVDVGNNNNLNTLVKANFPPYGRDFASHIPTGRFCNGKLATDFTADF  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF SYP AYLS +A GKNLL GANFAS ASG D+ TA + NAI L+
Sbjct  86   LGFPSYPPAYLSREARGKNLLTGANFASGASGLDDGTARIYNAISLN  132



>emb|CDO97958.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 89/115 (77%), Gaps = 9/115 (8%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDI----  268
            +PLVPA+I FGDS VDVGNNN++ T FKA++ PYGRDFASHQ TGRFCNGKL TD     
Sbjct  25   KPLVPALIIFGDSDVDVGNNNHLSTFFKANFAPYGRDFASHQATGRFCNGKLVTDFTGKL  84

Query  269  -----TADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
                 TADTLGF+ YP AYLSP A+GK+LLIGANF SA SGYDEKTA +  AI L
Sbjct  85   QFKNPTADTLGFTFYPPAYLSPHASGKSLLIGANFGSAGSGYDEKTASINQAISL  139



>ref|XP_010098864.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB75952.1| GDSL esterase/lipase [Morus notabilis]
Length=353

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVP ++ FGDS VD GNNNY++T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  28   PLVPGLMIFGDSVVDTGNNNYLYTLVKANFPPYGRDFVTHKPTGRFCNGKLATDFTAEYL  87

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AYLSP+A GK LL GANFAS ASGY ++TA L  AI L+
Sbjct  88   GFTSYPPAYLSPEAKGKKLLTGANFASGASGYYDRTAQLYRAISLT  133



>ref|XP_006289497.1| hypothetical protein CARUB_v10003031mg [Capsella rubella]
 gb|EOA22395.1| hypothetical protein CARUB_v10003031mg [Capsella rubella]
Length=337

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS  DVGNNN ++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  7    QPLVPSMFIFGDSVADVGNNNDIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  66

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            LGF+SYP AYLS +A G+NLLIGANFASAASGY + TA L  AI L
Sbjct  67   LGFTSYPQAYLSKKAKGRNLLIGANFASAASGYYDDTAKLYGAISL  112



>ref|XP_004251004.1| PREDICTED: GDSL esterase/lipase At5g22810 [Solanum lycopersicum]
Length=355

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY+ TI KA++PPYGRDF    PTGRFCNGKLA+D TA+ 
Sbjct  28   QPLVPALFIFGDSVVDAGNNNYLKTIIKANFPPYGRDFPKKIPTGRFCNGKLASDFTAEN  87

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + TA L +AIPLS
Sbjct  88   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTARLYDAIPLS  134



>ref|XP_002515934.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF46354.1| zinc finger protein, putative [Ricinus communis]
Length=354

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PAI  FGDS++DVGNNNY+ T +KA+YPPYGRDFASH+PTGRFC+GKL +DITA+TLG
Sbjct  27   IFPAIFTFGDSAMDVGNNNYLSTFYKANYPPYGRDFASHEPTGRFCDGKLVSDITAETLG  86

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F +Y  AYLSP A+G+NLLIGA+FASAASGYD+K+++  +AI L
Sbjct  87   FKTYAPAYLSPDASGENLLIGASFASAASGYDDKSSIRNDAITL  130



>gb|KCW89297.1| hypothetical protein EUGRSUZ_A01587, partial [Eucalyptus grandis]
Length=331

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VD GNNN ++T+ KA++PPYGRDFASH PTGRFCNGKLATD TA+ L
Sbjct  5    PLVPALCIFGDSVVDAGNNNDLYTLVKANFPPYGRDFASHNPTGRFCNGKLATDFTAENL  64

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            GF+SY  AYLS +ATGKNLLIGANFASAASGY ++TA L  +I L
Sbjct  65   GFTSYQPAYLSREATGKNLLIGANFASAASGYLDRTAQLYQSISL  109



>ref|XP_003540212.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Glycine max]
Length=350

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTIVKANFPPYGRDFKNHNPTGRFCNGKLASDYTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLS
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLS  129



>ref|XP_010050200.1| PREDICTED: GDSL esterase/lipase At5g03820 [Eucalyptus grandis]
Length=351

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VD GNNN ++T+ KA++PPYGRDFASH PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNDLYTLVKANFPPYGRDFASHNPTGRFCNGKLATDFTAENL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            GF+SY  AYLS +ATGKNLLIGANFASAASGY ++TA L  +I L
Sbjct  85   GFTSYQPAYLSREATGKNLLIGANFASAASGYLDRTAQLYQSISL  129



>gb|KJB09006.1| hypothetical protein B456_001G118700 [Gossypium raimondii]
Length=351

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN ++TI KAD+PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPAMFIFGDSVVDVGNNNNLYTIIKADFPPYGRDFLNHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+ YP AYLS +A G NLLIGANFASA+SGY E TA L + + LS
Sbjct  84   IGFTDYPPAYLSKKAKGNNLLIGANFASASSGYYETTAKLYHTLSLS  130



>ref|XP_009625753.1| PREDICTED: GDSL esterase/lipase At5g22810 isoform X2 [Nicotiana 
tomentosiformis]
Length=352

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QP VPA+  FGDS VD GNNNY+ TI KA++PPYGRDF  H PTGRFCNGKLA+D TA+ 
Sbjct  25   QPSVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKHIPTGRFCNGKLASDFTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + T+ L +AIPLS
Sbjct  85   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTSRLYDAIPLS  131



>ref|XP_006424380.1| hypothetical protein CICLE_v10027727mg [Citrus clementina]
 gb|ESR37620.1| hypothetical protein CICLE_v10027727mg [Citrus clementina]
Length=1058

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY++TI KA++ PYGRDF  H+PTGRFCNGKLA D TA+ 
Sbjct  731  QPLVPAMFIFGDSVVDAGNNNYIYTIVKANFRPYGRDFVHHKPTGRFCNGKLAADFTAEN  790

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+SYP AYLS +A GKNLLIGANFAS ASGY E TA L +AIPLS
Sbjct  791  IGFTSYPPAYLSEEAKGKNLLIGANFASGASGYYETTAKLYHAIPLS  837



>ref|XP_010493512.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Camelina sativa]
Length=341

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS VDV NNN ++TI KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  31   QPLVPSMFIFGDSVVDVANNNEIYTIVKANFPPYGRDFTTHKPTGRFCNGKLATDFTAEN  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            LGF+SYP AYLS +A G+NLL GANFASAASGY + TA L +AI L
Sbjct  91   LGFTSYPQAYLSKKAKGRNLLTGANFASAASGYYDGTAKLYSAISL  136



>ref|XP_006349065.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Solanum tuberosum]
Length=353

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNNY+ TI KA++PPYGRDF    PTGRFCNGKLA+D TA+ 
Sbjct  26   QPLVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKQIPTGRFCNGKLASDFTAEN  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A GKNLLIGANFAS +SGY + T+ L +AIPLS
Sbjct  86   LGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTSRLYDAIPLS  132



>emb|CDY09169.1| BnaA02g05950D [Brassica napus]
Length=361

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ LG
Sbjct  34   LVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAENLG  93

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+SYP AYLS +A G+NLLIGANFASAASGY + TA L +AI L
Sbjct  94   FTSYPQAYLSKKAKGRNLLIGANFASAASGYYDGTAKLYSAISL  137



>ref|XP_003551088.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Glycine max]
Length=350

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN+++T+ KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTVVKANFPPYGRDFKNHNPTGRFCNGKLASDYTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLS
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLS  129



>emb|CDY50286.1| BnaC02g45410D [Brassica napus]
Length=360

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ LG
Sbjct  33   LVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAENLG  92

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+SYP AYLS +A G+NLLIGANFASAASGY + TA L +AI L
Sbjct  93   FTSYPQAYLSKKAKGRNLLIGANFASAASGYYDGTAKLYSAISL  136



>gb|KHN21470.1| GDSL esterase/lipase [Glycine soja]
Length=359

 Score =   155 bits (393),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN+++T+ KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTVVKANFPPYGRDFKNHNPTGRFCNGKLASDYTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLS
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLS  129



>ref|XP_010558978.1| PREDICTED: GDSL esterase/lipase At3g53100 [Tarenaya hassleriana]
Length=351

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q +VPAII FGDS VDVGNNN++ TI K+++PPYGRDF +  PTGRFCNGKLA D +A+ 
Sbjct  24   QSIVPAIIIFGDSIVDVGNNNFLLTIVKSNFPPYGRDFINRTPTGRFCNGKLAVDFSAEY  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
             GFSSYP AYLSPQATG+NLLIGANFASA+SGY + TA L  +IPL+
Sbjct  84   TGFSSYPPAYLSPQATGQNLLIGANFASASSGYYDATAALFGSIPLT  130



>emb|CBI17099.3| unnamed protein product [Vitis vinifera]
Length=1026

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS+VD GNNN++ TI KA++PPYGRDF SH+PTGRFCNGKLA+D TA+ 
Sbjct  699  QPLVPAMFIFGDSAVDAGNNNHLDTIVKANFPPYGRDFISHKPTGRFCNGKLASDFTAEN  758

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+SYP AYLS +A G NLLIGANFASAASGY   TA L NAI LS
Sbjct  759  IGFTSYPPAYLSKEAKGNNLLIGANFASAASGYYHTTAKLSNAISLS  805



>gb|KHN27690.1| GDSL esterase/lipase [Glycine soja]
Length=345

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN+++TI KA++PPYGRD  +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNHLYTIVKANFPPYGRDLKNHNPTGRFCNGKLASDYTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYL+ +A G NLL GANFASAASGY + TA L +AIPLS
Sbjct  83   LGFTSYPPAYLNLKAKGNNLLNGANFASAASGYYDPTAKLYHAIPLS  129



>ref|XP_010247794.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Nelumbo nucifera]
Length=351

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF + + TGRFCNGKLATD  A+T
Sbjct  24   QPLVPALCIFGDSVVDVGNNNNLLTLVKANFPPYGRDFTTQRATGRFCNGKLATDFAAET  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF++Y  AYLS +ATG NLLIGANFASAASGY ++TA L +AIPL+
Sbjct  84   LGFTTYQPAYLSQEATGSNLLIGANFASAASGYYDRTAQLYDAIPLT  130



>ref|XP_008366379.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Malus domestica]
Length=350

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN+++T+ KA++PPYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  21   QPLVPAMFIFGDSVVDAGNNNHLYTVIKANFPPYGRDFVNHKPTGRFCNGKLASDFTAEN  80

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A G NLLIGANF SA SGY E TA L + I L+
Sbjct  81   LGFTSYPPAYLSKEANGTNLLIGANFGSAGSGYYEYTAKLYDVISLN  127



>ref|XP_009780981.1| PREDICTED: GDSL esterase/lipase At5g03820 [Nicotiana sylvestris]
Length=210

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHKPTGRFCNGKLATDFTAEYL  83

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            GF+SYP AYLS +A GK +L G NFASA+SGY E+TA L  A+ L
Sbjct  84   GFTSYPPAYLSREARGKRILTGVNFASASSGYYERTAKLYRALTL  128



>ref|XP_006366788.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum tuberosum]
Length=350

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TAD L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHKPTGRFCNGKLATDFTADYL  83

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AYLS +A GK +L G NFASAASGY E+TA L  A+ L+
Sbjct  84   GFTSYPPAYLSREARGKRVLTGVNFASAASGYYERTARLFRALTLT  129



>ref|XP_002873116.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49375.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=343

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN+++T+ KA++PPYGRDF +H  TGRF NGKLATD TA++
Sbjct  15   QPLVPALIIMGDSVVDAGNNNHLNTLVKANFPPYGRDFFAHNATGRFSNGKLATDFTAES  74

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPVAYLS +A G NLL GANFAS ASG+D+ TAL  NAI L+
Sbjct  75   LGFTSYPVAYLSQEANGTNLLTGANFASGASGFDDGTALFYNAITLN  121



>ref|XP_006482367.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Citrus sinensis]
Length=347

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  20   QPLVPALIIFGDSIVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  79

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A G  LL G NFASAASG  ++TA L  AIPL+
Sbjct  80   LGFTSYPPAYLSQEAKGNILLTGVNFASAASGLYDRTAQLYRAIPLT  126



>gb|KDO60993.1| hypothetical protein CISIN_1g036829mg [Citrus sinensis]
Length=347

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  20   QPLVPALIIFGDSIVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  79

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A G  LL G NFASAASG  ++TA L  AIPL+
Sbjct  80   LGFTSYPPAYLSQEAKGNILLTGVNFASAASGLYDRTAQLYRAIPLT  126



>ref|XP_004303055.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Fragaria vesca 
subsp. vesca]
Length=350

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALFIFGDSVVDVGNNNNLSTVIKANFPPYGRDFVNHKPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF++Y  AYLS +A+GKNLL GANFASAASG+ + TALL N+I L+
Sbjct  86   GFTTYQPAYLSQEASGKNLLTGANFASAASGFYDPTALLYNSISLT  131



>ref|XP_008226994.1| PREDICTED: GDSL esterase/lipase At5g22810 [Prunus mume]
Length=351

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN V TI KA++ PYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPALFLFGDSVVDAGNNNNVETIIKANFNPYGRDFVNHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A GKNLLIGANFASA SGY + TA L + I L+
Sbjct  84   LGFTSYPPAYLSKEAAGKNLLIGANFASAGSGYYDSTAKLYHTISLN  130



>ref|XP_004295642.1| PREDICTED: GDSL esterase/lipase At5g22810 [Fragaria vesca subsp. 
vesca]
Length=353

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN + T+ K+++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  26   QPLVPAMFIFGDSVVDVGNNNDLLTLVKSNFPPYGRDFINHNPTGRFCNGKLASDFTAEN  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SY  AYLS +ATGKNLLIGANFASA SGY E TA L  AI LS
Sbjct  86   LGFTSYQPAYLSGEATGKNLLIGANFASAGSGYYEATAKLFGAISLS  132



>ref|XP_009126566.1| PREDICTED: GDSL esterase/lipase At5g22810 [Brassica rapa]
Length=361

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVP++  FGDS VDVGNNN+++TI KA++PPYGRDF +H PTGRFCNGKLATD TA+ LG
Sbjct  34   LVPSMFIFGDSVVDVGNNNHIYTIVKANFPPYGRDFTTHTPTGRFCNGKLATDFTAENLG  93

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F+SYP AYLS +A G+NLLIGANFASAAS Y + TA L +AI L
Sbjct  94   FTSYPQAYLSKKAKGRNLLIGANFASAASAYYDGTAKLYSAISL  137



>ref|XP_006430343.1| hypothetical protein CICLE_v10013829mg [Citrus clementina]
 gb|ESR43583.1| hypothetical protein CICLE_v10013829mg [Citrus clementina]
Length=347

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  20   QPLVPALIIFGDSIVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  79

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS +A G  LL G NFASAASG  ++TA L  AIPL+
Sbjct  80   LGFTSYPPAYLSQEAKGNILLSGVNFASAASGLYDRTAQLYRAIPLT  126



>ref|XP_009340968.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Pyrus x bretschneideri]
Length=350

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            +PLVPA+I FGDS  DVGNNN + T  KA++PPYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  24   EPLVPALIIFGDSVADVGNNNNLTTPIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEY  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLSP+A G+NLL G NFASAASGY + T  L NA+ L+
Sbjct  84   LGFTSYPPAYLSPEAKGQNLLTGVNFASAASGYWDYTPFLYNALSLT  130



>ref|XP_002527431.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34923.1| zinc finger protein, putative [Ricinus communis]
Length=359

 Score =   153 bits (386),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN+++TI KA++PPYGRDFA+H+ TGRFCNGKLA+D TA+ 
Sbjct  32   QPLVPAMFIFGDSVVDAGNNNHLYTIVKANFPPYGRDFANHKSTGRFCNGKLASDFTAEN  91

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+SYP AYLS +A G NLLIGANFAS ASG+ + TA L +AI L+
Sbjct  92   IGFTSYPPAYLSKEAEGTNLLIGANFASGASGFYDSTAKLYHAISLT  138



>gb|ABK21582.1| unknown [Picea sitchensis]
Length=350

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS+VDVGNNNY+ T+ K+++PPYGRDF +H PTGRFC+G+LATD  A+T
Sbjct  23   QPLVPALFIFGDSTVDVGNNNYLFTLVKSNFPPYGRDFDTHNPTGRFCDGRLATDYVAET  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+S+P AYLSPQA+G+NLL G NFAS ASG  + TA   NAI ++
Sbjct  83   LGFTSFPPAYLSPQASGQNLLTGVNFASGASGIYDDTAQRSNAISMT  129



>ref|XP_007150122.1| hypothetical protein PHAVU_005G128600g [Phaseolus vulgaris]
 gb|ESW22116.1| hypothetical protein PHAVU_005G128600g [Phaseolus vulgaris]
Length=350

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS  DVGNNN + TI KA++PPYGRDF +H PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFIFGDSVFDVGNNNQLSTIVKANFPPYGRDFNNHTPTGRFCNGKLASDYTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYL+ +  GKNLL GANFASAASGY + TA L +AIPLS
Sbjct  83   LGFTSYPPAYLNLKVKGKNLLNGANFASAASGYYDPTAKLYHAIPLS  129



>ref|XP_010045272.1| PREDICTED: GDSL esterase/lipase At5g22810 [Eucalyptus grandis]
 gb|KCW87433.1| hypothetical protein EUGRSUZ_B03904 [Eucalyptus grandis]
Length=361

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVP++  FGDS VD GNNN+++TI KA++PPYGRDF  HQPTGRFCNGK A D TA+ 
Sbjct  28   QPLVPSMFVFGDSVVDTGNNNHLYTIVKANFPPYGRDFIKHQPTGRFCNGKTAADFTAEN  87

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +GF+SYP AYLS +A GK+LLIGANFASA+SGY + TA L + I L+
Sbjct  88   IGFTSYPPAYLSQKAKGKHLLIGANFASASSGYYDSTAKLYHTISLT  134



>ref|XP_004246904.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum lycopersicum]
Length=350

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVNHKPTGRFCNGKLATDYTAEYL  83

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AYLS +A GK +L G NFASAASGY E+TA L  A+ L+
Sbjct  84   GFTSYPPAYLSREARGKKVLTGVNFASAASGYYERTARLFRALTLT  129



>gb|KDP40835.1| hypothetical protein JCGZ_24834 [Jatropha curcas]
Length=359

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            + LVPAII FGDS +DVGNN+Y+ T FKA+Y PYG+DF +H+PTGRFCNGKL +DI A+T
Sbjct  28   ETLVPAIITFGDSGLDVGNNDYLPTKFKANYSPYGKDFLNHRPTGRFCNGKLISDIIAET  87

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            +GF +YP AYLS  A+G+NLLIGA+FASAASG+D+K  +  NAIPL
Sbjct  88   MGFKTYPPAYLSRDASGENLLIGASFASAASGFDDKIVIANNAIPL  133



>ref|XP_010923281.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Elaeis guineensis]
Length=358

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP +I FGDS VDVGNNN+  T+ KAD+PPYGRDF  H PTGRFCNGKLATD T + 
Sbjct  31   QSLVPGVIIFGDSVVDVGNNNHRLTLVKADFPPYGRDFIHHTPTGRFCNGKLATDFTVEN  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            LGF+SYP AYLS QA GKNLL G NF S ASGY E T++L N I L
Sbjct  91   LGFTSYPPAYLSEQARGKNLLSGVNFGSGASGYLESTSILYNVISL  136



>gb|KHN38683.1| GDSL esterase/lipase [Glycine soja]
Length=318

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPAI  FGDS VDVGNNN+  TI KA++PPYGRDF +H PTGRFCNGKLATD  AD 
Sbjct  23   QPLVPAIFTFGDSIVDVGNNNHQLTIVKANFPPYGRDFENHFPTGRFCNGKLATDFIADI  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SY  AYL+ +  GKNLL GANFASA+SGY E T+ L ++IPLS
Sbjct  83   LGFTSYQPAYLNLKTKGKNLLNGANFASASSGYFELTSKLYSSIPLS  129



>gb|AFK42211.1| unknown [Lotus japonicus]
Length=350

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN + TI K+++ PYGRDF +HQPTGRFCNGKLATD+TA+ 
Sbjct  23   QPLVPALFIFGDSVVDVGNNNQLPTIVKSNFLPYGRDFQNHQPTGRFCNGKLATDLTAEN  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AY++ +  G NLL GANFAS ASGY E TA L +AIPLS
Sbjct  83   LGFTSYPPAYMNLKTKGNNLLNGANFASGASGYYEPTAKLYHAIPLS  129



>ref|XP_009625752.1| PREDICTED: GDSL esterase/lipase At5g22810 isoform X1 [Nicotiana 
tomentosiformis]
Length=353

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDIT-AD  277
            QP VPA+  FGDS VD GNNNY+ TI KA++PPYGRDF  H PTGRFCNGKLA+D T A+
Sbjct  25   QPSVPALFIFGDSVVDAGNNNYLKTIVKANFPPYGRDFPKHIPTGRFCNGKLASDFTAAE  84

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
             LGF+SYP AYLS +A GKNLLIGANFAS +SGY + T+ L +AIPLS
Sbjct  85   NLGFTSYPPAYLSKKAKGKNLLIGANFASGSSGYYDTTSRLYDAIPLS  132



>ref|XP_004143292.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Cucumis sativus]
 gb|KGN48218.1| hypothetical protein Csa_6G449250 [Cucumis sativus]
Length=351

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H PTGRFCNGKLATDITA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLLTVVKANFPPYGRDFVTHAPTGRFCNGKLATDITAELL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GFSSYP AYLS  ATG  LL GANFASAASG+ + TA L +A+ L+
Sbjct  86   GFSSYPPAYLSQDATGNKLLTGANFASAASGFYDGTAQLYHAVSLT  131



>ref|XP_004156262.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Cucumis sativus]
Length=351

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H PTGRFCNGKLATDITA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLLTVVKANFPPYGRDFVTHAPTGRFCNGKLATDITAELL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GFSSYP AYLS  ATG  LL GANFASAASG+ + TA L +A+ L+
Sbjct  86   GFSSYPPAYLSQDATGNKLLTGANFASAASGFYDGTAQLYHAVSLT  131



>ref|XP_006398840.1| hypothetical protein EUTSA_v10013969mg [Eutrema salsugineum]
 gb|ESQ40293.1| hypothetical protein EUTSA_v10013969mg [Eutrema salsugineum]
Length=352

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN+ +T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ 
Sbjct  24   QPLVPALIIMGDSVVDAGNNNHRNTLIKANFPPYGRDFFAHNATGRFSNGKLATDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPVAYLS +A G NLL GANFAS ASG+ + TALL NAI L+
Sbjct  84   LGFTSYPVAYLSQEANGTNLLTGANFASGASGFHDDTALLYNAITLN  130



>ref|XP_007027551.1| GDSL-like Lipase/Acylhydrolase family protein [Theobroma cacao]
 gb|EOY08053.1| GDSL-like Lipase/Acylhydrolase family protein [Theobroma cacao]
Length=465

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN ++T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  139  PLVPAVIIFGDSVVDVGNNNNLNTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  198

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AYLS  A G +LL GANFASAASG  ++TA L  AIPL+
Sbjct  199  GFTSYPPAYLSRDARGNDLLTGANFASAASGLYDRTANLYRAIPLT  244



>ref|XP_003538180.1| PREDICTED: GDSL esterase/lipase At5g22810 [Glycine max]
Length=353

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPAI  FGDS VDVGNNN+  TI KA++PPYGRDF +H PTGRFCNGKLATD  AD 
Sbjct  26   QPLVPAIFTFGDSIVDVGNNNHQLTIVKANFPPYGRDFENHFPTGRFCNGKLATDFIADI  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SY  AYL+ +  GKNLL GANFASA+SGY E T+ L ++IPLS
Sbjct  86   LGFTSYQPAYLNLKTKGKNLLNGANFASASSGYFELTSKLYSSIPLS  132



>ref|XP_009593509.1| PREDICTED: GDSL esterase/lipase At5g03820-like isoform X1 [Nicotiana 
tomentosiformis]
Length=351

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALNIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AY SP+A GKN+L G NFASAASGY ++T  L  A+ L+
Sbjct  85   GFTSYPPAYFSPEARGKNILTGVNFASAASGYYDRTPQLYRALTLA  130



>ref|XP_002436480.1| hypothetical protein SORBIDRAFT_10g003420 [Sorghum bicolor]
 gb|EER87847.1| hypothetical protein SORBIDRAFT_10g003420 [Sorghum bicolor]
Length=346

 Score =   150 bits (379),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 90/108 (83%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  277
            QP+VPA+I+FGDS++DVGNNNY+   +FKADY PYG+DF SH+ TGRF +GK+ TDITA+
Sbjct  17   QPIVPAVISFGDSTIDVGNNNYLPGAVFKADYAPYGQDFVSHEATGRFSDGKIVTDITAE  76

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            TLGF SY   YLSPQA+GKNLLIGANFASAAS Y + TA + +AI L+
Sbjct  77   TLGFESYAPPYLSPQASGKNLLIGANFASAASSYYDDTAAMYDAITLT  124



>ref|XP_010933399.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Elaeis guineensis]
Length=358

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP ++ FGDS VDVGNNN   T+ KA++PPYGRDFA+H PTGRFCNGKLATD T + 
Sbjct  31   QGLVPGVMIFGDSVVDVGNNNNRLTLVKANFPPYGRDFANHIPTGRFCNGKLATDFTVEN  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS QATGKNLL GANFAS ASGY + T+ L  AI L+
Sbjct  91   LGFTSYPPAYLSEQATGKNLLSGANFASGASGYLDSTSTLYGAISLN  137



>ref|XP_002284087.2| PREDICTED: GDSL esterase/lipase At5g03820-like [Vitis vinifera]
Length=351

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VD GNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNNLATLVKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP  YLS +A GKNLL GANFASA+SGY ++TA L  AI L+
Sbjct  85   GFTSYPPPYLSQEAQGKNLLQGANFASASSGYYDRTAQLYRAISLT  130



>ref|XP_009589481.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Nicotiana tomentosiformis]
Length=350

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  24   PLVPALCIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  83

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            GF+SYP AYLS +A GK +L G NFASA+SGY E+TA L  A+ L
Sbjct  84   GFTSYPPAYLSREARGKRILTGINFASASSGYYERTANLYRALTL  128



>ref|XP_009397028.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Musa acuminata 
subsp. malaccensis]
Length=347

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP +I FGDS VD GNNN++ T+ +A++PPYGRDFA H PTGRFCNGKLATD T + 
Sbjct  20   QGLVPGVIIFGDSVVDAGNNNHLSTLVRANFPPYGRDFAQHSPTGRFCNGKLATDFTVEN  79

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS  ATG NLL GANFASAASGY + TA L  AI L+
Sbjct  80   LGFTSYPPAYLSQDATGNNLLHGANFASAASGYLDSTANLYQAISLT  126



>emb|CBI30208.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VD GNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNNLATLVKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP  YLS +A GKNLL GANFASA+SGY ++TA L  AI L+
Sbjct  85   GFTSYPPPYLSQEAQGKNLLQGANFASASSGYYDRTAQLYRAISLT  130



>ref|NP_196002.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9LZC5.1|GDL73_ARATH RecName: Full=GDSL esterase/lipase At5g03820; AltName: Full=Extracellular 
lipase At5g03820; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB85502.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08608.1| proline-rich protein APG-like [Arabidopsis thaliana]
 gb|AED90658.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=354

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            +PLVPA+I  GDS VD GNNN ++T+ KA++PPYGRDF +H  TGRF NGKLATD TA++
Sbjct  25   EPLVPALIIMGDSVVDAGNNNRLNTLIKANFPPYGRDFLAHNATGRFSNGKLATDFTAES  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPV YLS +A G NLL GANFAS ASGYD+ TA+  NAI L+
Sbjct  85   LGFTSYPVPYLSQEANGTNLLTGANFASGASGYDDGTAIFYNAITLN  131



>ref|XP_009776666.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Nicotiana sylvestris]
Length=351

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALNIFGDSVVDVGNNNNLSTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AY SP+A GKN++ G NFASAASGY ++T  L  A+ L+
Sbjct  85   GFTSYPPAYFSPEARGKNIITGVNFASAASGYYDRTPQLYRALTLA  130



>ref|XP_006286643.1| hypothetical protein CARUB_v10002513mg [Capsella rubella]
 gb|EOA19541.1| hypothetical protein CARUB_v10002513mg [Capsella rubella]
Length=353

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN + T+ KA++PPYGRDF +H  TGRF NGKLATD TA++
Sbjct  25   QPLVPALIIMGDSVVDAGNNNRLGTLVKANFPPYGRDFFAHNATGRFSNGKLATDFTAES  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPVAYLS  A G NLL GANFAS ASG+ + TALL NAI L+
Sbjct  85   LGFTSYPVAYLSQDANGTNLLTGANFASGASGFHDGTALLYNAITLN  131



>ref|XP_008462518.1| PREDICTED: GDSL esterase/lipase At5g03820 [Cucumis melo]
Length=351

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF +H PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLLTVVKANFPPYGRDFVTHTPTGRFCNGKLATDFTAENL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GFSSYP AYLS  ATG  LL GANFASAASG+ + TA L +A+ L+
Sbjct  86   GFSSYPPAYLSQDATGNKLLTGANFASAASGFYDGTAQLYHAVSLT  131



>ref|XP_007132365.1| hypothetical protein PHAVU_011G088700g [Phaseolus vulgaris]
 gb|ESW04359.1| hypothetical protein PHAVU_011G088700g [Phaseolus vulgaris]
Length=365

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNN+  T+ KA++PPYGRD+ +H PTGRFCNGKLATD TA+ 
Sbjct  38   QPLVPALFIFGDSVVDVGNNNHQITVIKANFPPYGRDYENHDPTGRFCNGKLATDFTAEV  97

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+S P AYL+    G NLL GANFASA+SGY E TA L N IPLS
Sbjct  98   LGFTSSPPAYLNLNTKGNNLLNGANFASASSGYYEPTAKLYNTIPLS  144



>ref|XP_004964856.1| PREDICTED: GDSL esterase/lipase APG-like [Setaria italica]
Length=357

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 88/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  277
            QPLVPA+I+FGDS++DVGNNNY+   +FKADY PYG +F   +PTGRF +GK+ TDITA+
Sbjct  28   QPLVPAVISFGDSTIDVGNNNYLPRAVFKADYAPYGENFVRQEPTGRFSDGKIVTDITAE  87

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            TLGF SY   YLSPQA+GKNLLIGANFASAAS Y + TA + +AI L+
Sbjct  88   TLGFESYAPPYLSPQASGKNLLIGANFASAASSYYDDTAAVYDAITLT  135



>ref|XP_006338923.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Solanum tuberosum]
Length=348

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  22   PLVPALNIFGDSVVDVGNNNNLTTLIKANFLPYGRDFVTHRPTGRFCNGKLATDFTAEYL  81

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF++YP AYLSP+A G+N+L G NFASAASGY E+T  L  A+ L+
Sbjct  82   GFTTYPPAYLSPEARGRNILTGVNFASAASGYYERTPQLYRALTLA  127



>ref|XP_011094449.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Sesamum indicum]
Length=351

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VD GNNN + T+ KA++PPYGRDF SH+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALCIFGDSVVDAGNNNNLQTLIKANFPPYGRDFVSHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AYLS +A G+N+L G NFASAASGY E T  L  A+ L+
Sbjct  85   GFNSYPPAYLSQEARGRNILNGVNFASAASGYYENTPQLYRALTLT  130



>ref|XP_010683957.1| PREDICTED: GDSL esterase/lipase At5g03820 [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            +PLVP +  FGDS  D GNNN ++TI KA++PPYGRDF +H PTGRFCNGK+ATD TA+ 
Sbjct  27   EPLVPILCIFGDSVADTGNNNGLYTIIKANFPPYGRDFVTHTPTGRFCNGKIATDFTAEN  86

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGFS+YP +YL+  A G NLLIGANFASA SGY E TA L  AI L+
Sbjct  87   LGFSAYPPSYLTQAAQGNNLLIGANFASAGSGYSETTANLYRAISLT  133



>ref|XP_002528628.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF33731.1| zinc finger protein, putative [Ricinus communis]
Length=352

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            P+VPA+I FGDS VDVGNNN ++T+ KA++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PIVPALIIFGDSVVDVGNNNNLNTLIKANFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AYLS  A G+N+L G NFASAASG  + TA L +A+ L+
Sbjct  86   GFTSYPPAYLSQDAQGRNILTGVNFASAASGLYDGTATLYSAVSLT  131



>ref|XP_004487544.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Cicer arietinum]
Length=351

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN ++T+ K+++PPYGRDF  H PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPALFIFGDSVVDAGNNNNLYTVVKSNFPPYGRDFKDHMPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF++YP AYL+ +  GKNLL GANFASAASGY + TA L +AI ++
Sbjct  84   LGFTTYPPAYLNLEVKGKNLLNGANFASAASGYYDSTAKLYHAISMT  130



>ref|XP_004249641.1| PREDICTED: GDSL esterase/lipase At5g03820 [Solanum lycopersicum]
Length=348

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  22   PLVPALNIFGDSVVDVGNNNNLTTLIKANFLPYGRDFVTHRPTGRFCNGKLATDFTAEYL  81

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF++YP AYLSP+A G+N+L G NFASAASGY E+T  +  A+ L+
Sbjct  82   GFTTYPPAYLSPEARGRNILTGVNFASAASGYYERTPQIYRALTLA  127



>ref|XP_007207052.1| hypothetical protein PRUPE_ppa007967mg [Prunus persica]
 gb|EMJ08251.1| hypothetical protein PRUPE_ppa007967mg [Prunus persica]
Length=350

 Score =   147 bits (371),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN V TI KA++PPYGRDF++H+PTGRFCNGKLA+D TA+ 
Sbjct  24   QPLVPALFLFGDSVVDAGNNNNVKTIIKANFPPYGRDFSNHKPTGRFCNGKLASDFTAEN  83

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LG   YP AYLS +A GKNLLIGANFASA SGY + TA L + I L+
Sbjct  84   LGL-YYPPAYLSKEAAGKNLLIGANFASAGSGYYDSTAKLYHTISLN  129



>emb|CDP14394.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNNY+ T+ KA++PPYGRDF +H+ TGRFCNGKLATD T + 
Sbjct  23   QPLVPALYLFGDSIVDVGNNNYLETLIKANFPPYGRDFINHEATGRFCNGKLATDFTGEN  82

Query  281  LGFSSYPVAYLSPQA-TGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+ YP  YLS +A T KN+L+GANFASA SGY E TA + N + LS
Sbjct  83   LGFTDYPKPYLSNKAKTTKNMLLGANFASAGSGYYEATAKIYNTLSLS  130



>ref|XP_004155946.1| PREDICTED: GDSL esterase/lipase APG-like [Cucumis sativus]
Length=366

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            + PAI  FGDS++D+GNNN   T+FKA+Y PYG+DF +H+PTGRFCNGKL +DITA+TLG
Sbjct  40   IFPAIFTFGDSALDMGNNNNRFTMFKANYLPYGQDFTNHKPTGRFCNGKLVSDITAETLG  99

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F +YP  YLSP+A+G+NLLIG+ FASAA+GYDE+ ++   AI LS
Sbjct  100  FQTYPPPYLSPEASGRNLLIGSGFASAAAGYDEQASISNRAITLS  144



>ref|XP_009125521.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Brassica rapa]
Length=406

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKL  D TA++
Sbjct  78   QPLVPALIIIGDSVVDAGNNNHRTTLIKANFPPYGRDFFAHNSTGRFSNGKLVIDFTAES  137

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPVAYLS  A G NLL GANFAS ASG+D+ T+LL NAI L+
Sbjct  138  LGFTSYPVAYLSQDANGTNLLTGANFASGASGFDDGTSLLYNAITLN  184



>ref|XP_008794047.1| PREDICTED: GDSL esterase/lipase At5g03810-like [Phoenix dactylifera]
Length=359

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP ++ FGDS VDVGNNN   T+ KA++PPYGRDF  H PTGRFCNGKLATD T + 
Sbjct  32   QGLVPGVVIFGDSVVDVGNNNNRLTLVKANFPPYGRDFVDHAPTGRFCNGKLATDFTVEN  91

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS QATGKNLL GANFAS  +GY + T+ L  AI L+
Sbjct  92   LGFTSYPPAYLSEQATGKNLLSGANFASGGAGYLDSTSTLYGAISLN  138



>gb|KJB16733.1| hypothetical protein B456_002G245100 [Gossypium raimondii]
Length=295

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN ++T+ K+++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALIIFGDSVVDVGNNNNLNTLIKSNFPPYGRDFVNHRPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AYLS  A G  LL GANFASAASG  + TA L  AI L+
Sbjct  86   GFTSYPPAYLSRDAIGNALLTGANFASAASGLYDSTANLYRAITLT  131



>gb|KHG27777.1| hypothetical protein F383_16365 [Gossypium arboreum]
Length=352

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN ++T+ K+++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALIIFGDSVVDVGNNNNLNTLIKSNFPPYGRDFVTHRPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AYLS  A G  LL GANFASAASG  + TA L  AI L+
Sbjct  86   GFTSYPPAYLSRDAIGNALLTGANFASAASGLYDSTANLYRAITLT  131



>gb|KDP29224.1| hypothetical protein JCGZ_16613 [Jatropha curcas]
Length=353

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            +P+VPA+I FGDS VDVGNNN ++T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ 
Sbjct  26   EPIVPALIIFGDSVVDVGNNNNLNTVVKANFLPYGRDFVTHRPTGRFCNGKLATDFTAEY  85

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYLS  A G N+L G NFASAASG+ + TA L  AI L+
Sbjct  86   LGFTSYPPAYLSQDAKGSNILTGVNFASAASGFYDGTARLYGAIALT  132



>gb|KJB16732.1| hypothetical protein B456_002G245100 [Gossypium raimondii]
Length=352

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN ++T+ K+++PPYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALIIFGDSVVDVGNNNNLNTLIKSNFPPYGRDFVNHRPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AYLS  A G  LL GANFASAASG  + TA L  AI L+
Sbjct  86   GFTSYPPAYLSRDAIGNALLTGANFASAASGLYDSTANLYRAITLT  131



>ref|NP_001140661.1| hypothetical protein precursor [Zea mays]
 gb|ACF84312.1| unknown [Zea mays]
 gb|ACF84726.1| unknown [Zea mays]
 gb|AFW75507.1| hypothetical protein ZEAMMB73_189087 [Zea mays]
Length=359

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 88/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  277
            QP+VPA+I+FGDS+VDVGNNNY+   +FKADY PYG+ FA H+ TGRF +GK+ TDITA+
Sbjct  30   QPIVPAVISFGDSTVDVGNNNYLPGAVFKADYAPYGQGFARHKATGRFSDGKIVTDITAE  89

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            TLGF SY   YLSPQA+GKNLL GANFASAAS Y + TA + +AI L+
Sbjct  90   TLGFESYAPPYLSPQASGKNLLTGANFASAASSYYDDTAAMYDAITLT  137



>ref|XP_011101470.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Sesamum indicum]
Length=351

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA++ FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALLLFGDSVVDVGNNNNLQTLVKANFLPYGRDFVTHKPTGRFCNGKLATDFTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SY  AYLS +A G+N+L G NFASAASGY E T  L  A+ L+
Sbjct  86   GFTSYQPAYLSQEARGRNILTGVNFASAASGYYEPTGQLYRALTLA  131



>ref|XP_010490874.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Camelina sativa]
Length=350

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN + T+ KA++PPYGRDF  H  TGRF NGKLATD TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNRLTTLVKANFPPYGRDFFDHNATGRFTNGKLATDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPV YLS  A G NLL GANFAS ASG+ + TALL NAI L+
Sbjct  82   LGFTSYPVPYLSQDANGTNLLTGANFASGASGFLDATALLYNAITLN  128



>ref|XP_011018853.1| PREDICTED: GDSL esterase/lipase At5g03820 [Populus euphratica]
Length=351

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN + T+ KA++ PYGRD+ +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALIIFGDSVVDVGNNNNLTTLIKANFLPYGRDYVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF++YP AYLSP A+G+N+L GANFASAASG  + TA   +AI L+
Sbjct  85   GFTTYPPAYLSPDASGRNILTGANFASAASGLYDGTAQSYSAISLT  130



>emb|CDP17381.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VDVGNNNY+ T+ KA++PPYGRDF +H+ TGRFCNGKLATD T + 
Sbjct  23   QPLVPALYLFGDSIVDVGNNNYLETLIKANFPPYGRDFINHEATGRFCNGKLATDFTGEN  82

Query  281  LGFSSYPVAYLSPQA-TGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+ YP  YLS +A T KN+L+GANFASA SGY E TA +   + LS
Sbjct  83   LGFTDYPKPYLSNKAKTTKNMLLGANFASAGSGYYEATAKIYTTLSLS  130



>emb|CDY04898.1| BnaAnng00800D [Brassica napus]
Length=350

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN+     KA++PPYGRDF +H  TGRF NGKL  D TA++
Sbjct  22   QPLVPALIIMGDSVVDAGNNNHRTIFIKANFPPYGRDFFAHNSTGRFSNGKLVIDFTAES  81

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPVAYLS  A G NLL GANFAS ASG+D+ T+LL NAI L+
Sbjct  82   LGFTSYPVAYLSQDANGTNLLTGANFASGASGFDDGTSLLYNAITLN  128



>ref|NP_196001.2| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FFN0.1|GDL72_ARATH RecName: Full=GDSL esterase/lipase At5g03810; AltName: Full=Extracellular 
lipase At5g03810; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08607.1| proline-rich protein APG-like [Arabidopsis thaliana]
 gb|AED90657.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=353

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            + LVPA+I  GDS VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ 
Sbjct  25   ETLVPALIIMGDSVVDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPVAYLS +A   NLL GANFAS ASG+D+ TA+  NAI LS
Sbjct  85   LGFTSYPVAYLSQEANETNLLTGANFASGASGFDDATAIFYNAITLS  131



>gb|KJB56728.1| hypothetical protein B456_009G138200 [Gossypium raimondii]
Length=345

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 86/105 (82%), Gaps = 11/105 (10%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPAII FGDS VDVGNN+Y+ TIFKA+YPPYGRDFA+ +PTGRFCNGKLATDIT     
Sbjct  31   LVPAIITFGDSVVDVGNNDYLPTIFKANYPPYGRDFANKKPTGRFCNGKLATDIT-----  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
                  AYLSP+A+GKNLL+GANFASA SGYD++ +++ +AI L+
Sbjct  86   ------AYLSPEASGKNLLLGANFASAGSGYDDEASMVNHAITLT  124



>gb|ACG42669.1| hypothetical protein [Zea mays]
Length=358

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  277
            QP+VPAII+FGDS+VDVGNNNY+   +FKADY PYG+ FA H+ TGRF +GK+ TDITA+
Sbjct  28   QPIVPAIISFGDSTVDVGNNNYLPGAVFKADYAPYGQGFARHKATGRFSDGKIVTDITAE  87

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            TLGF SY   YLSPQA+GKNL  GANFASAAS Y + TA + +AI L+
Sbjct  88   TLGFESYAPPYLSPQASGKNLFTGANFASAASSYYDDTAAMYDAITLT  135



>ref|XP_006381340.1| hypothetical protein POPTR_0006s11970g [Populus trichocarpa]
 gb|ERP59137.1| hypothetical protein POPTR_0006s11970g [Populus trichocarpa]
Length=351

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN + T+ KA++ PYGRD+ +H+PTGRFCNGKLATD TA+ L
Sbjct  25   PLVPALIIFGDSVVDVGNNNNLTTLIKANFLPYGRDYVTHRPTGRFCNGKLATDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF++YP AYLSP A+G+N+L GANFASAASG  + TA   ++I L+
Sbjct  85   GFTTYPPAYLSPDASGRNILTGANFASAASGLYDGTAQSYSSISLT  130



>ref|XP_008387479.1| PREDICTED: GDSL esterase/lipase At5g03820-like [Malus domestica]
Length=350

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS  D GNNN + T  KA++PPYGRDF +H+PTGRFCNGKL TD TA+ L
Sbjct  25   PLVPALIIFGDSVADXGNNNNLTTPIKANFPPYGRDFVTHRPTGRFCNGKLTTDFTAEYL  84

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AYLSP+A G+NLL   NFASAASGY + T  L N + L+
Sbjct  85   GFTSYPPAYLSPEAEGQNLLTXVNFASAASGYLDYTPFLYNTLSLT  130



>gb|KEH38918.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=352

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS VD GNNN ++TI K+++PPYGRDF +  PTGRFCNGKLA D TA+ 
Sbjct  25   QPLVPALFIFGDSVVDAGNNNNLYTIVKSNFPPYGRDFNNQMPTGRFCNGKLAADFTAEN  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF++YP AYL+ Q  GKNLL GANFAS ASGY + TA L +AI L 
Sbjct  85   LGFTTYPPAYLNLQEKGKNLLNGANFASGASGYFDPTAKLYHAISLE  131



>ref|XP_010100155.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB81606.1| GDSL esterase/lipase [Morus notabilis]
Length=353

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPA+  FGDS VDVGNNN + TI KA++PPYGRDF +H+PTGRF NGKLATD  A+ L 
Sbjct  28   LVPAMFIFGDSVVDVGNNNQLATIIKANFPPYGRDFFNHRPTGRFTNGKLATDFVAEALS  87

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F+SY  AYLS QA G+NLLIGANFASA+SGY + TA L + +PLS
Sbjct  88   FTSYQPAYLSRQARGRNLLIGANFASASSGYLDATANLYHTVPLS  132



>emb|CDP15327.1| unnamed protein product [Coffea canephora]
Length=352

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+  FGDS VDVGNNN + T+ KA++PPYGRDF  H+PTGRFCNGKLATD TA+ L
Sbjct  26   PLVPALCIFGDSVVDVGNNNNLPTLIKANFPPYGRDFLGHRPTGRFCNGKLATDYTAEYL  85

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF +YP AYLS +A G ++L G NFASAASGY + TA L  AI L+
Sbjct  86   GFRAYPPAYLSQEAKGSSILTGVNFASAASGYYDGTAQLYRAISLT  131



>ref|XP_009389038.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=396

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP +I FGDS+VDVGNNN++ T+ KA++PPYGRDF  H PTGRFCNGKL TD   + 
Sbjct  66   QGLVPGVIIFGDSTVDVGNNNHLLTLVKANFPPYGRDFPHHSPTGRFCNGKLVTDFVVEV  125

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+++P AYLS +ATG NLL GANFASA+SGY + TA L  A+ L+
Sbjct  126  LGFTTHPPAYLSKEATGNNLLNGANFASASSGYLDATASLYQAVSLT  172



>ref|XP_009389037.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=401

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            Q LVP +I FGDS+VDVGNNN++ T+ KA++PPYGRDF  H PTGRFCNGKL TD   + 
Sbjct  66   QGLVPGVIIFGDSTVDVGNNNHLLTLVKANFPPYGRDFPHHSPTGRFCNGKLVTDFVVEV  125

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+++P AYLS +ATG NLL GANFASA+SGY + TA L  A+ L+
Sbjct  126  LGFTTHPPAYLSKEATGNNLLNGANFASASSGYLDATASLYQAVSLT  172



>ref|XP_010092821.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB52561.1| GDSL esterase/lipase [Morus notabilis]
Length=303

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPA+  FGDS +DVGNNN++ T+ KA++PPYGRDF +H PTGRF NGK++ DI A+TLG
Sbjct  22   LVPALFIFGDSVMDVGNNNHLPTLIKANFPPYGRDFFNHTPTGRFSNGKISADIIAETLG  81

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F+SY  AYLS +A G+NLLIGANFASAASGY E TA    AIPLS
Sbjct  82   FASYQPAYLSSEAKGENLLIGANFASAASGYYEPTANSNLAIPLS  126



>ref|XP_010452277.1| PREDICTED: GDSL esterase/lipase At5g03820 [Camelina sativa]
Length=350

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN + T+ KA++PPYGRDF  H  TGRF NGK+ATD TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNRLTTLVKANFPPYGRDFFDHNATGRFTNGKIATDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SY V YLS  A G NLL GANFAS ASG+ + TALL NAI L+
Sbjct  82   LGFTSYTVPYLSQDANGTNLLTGANFASGASGFLDATALLYNAITLN  128



>gb|EYU41566.1| hypothetical protein MIMGU_mgv1a008897mg [Erythranthe guttata]
Length=359

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPA+I FGDS VDVGNNN + T+ KA++ PYGRDF +H+PTGRF NGKLATD TA+ L
Sbjct  32   PLVPALIIFGDSVVDVGNNNNLQTLIKANFLPYGRDFVTHKPTGRFSNGKLATDFTAEYL  91

Query  284  GFSSYPVAYLSPQA-TGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF+SYP AY S +A +GKN+L G NFASAASGY ++TA L  A+ L+
Sbjct  92   GFNSYPPAYFSQEARSGKNILTGVNFASAASGYYDRTAQLYRALTLT  138



>emb|CDX80889.1| BnaC03g01430D [Brassica napus]
Length=353

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLT  129



>ref|XP_009130784.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X2 [Brassica 
rapa]
Length=353

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLT  129



>ref|XP_009130783.1| PREDICTED: GDSL esterase/lipase At5g03810-like isoform X1 [Brassica 
rapa]
Length=353

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+I  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALIIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLT  129



>ref|XP_006403725.1| hypothetical protein EUTSA_v10010500mg [Eutrema salsugineum]
 gb|ESQ45178.1| hypothetical protein EUTSA_v10010500mg [Eutrema salsugineum]
Length=351

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF +H+PTGRFCNGKLA D +A+ LG
Sbjct  26   VVPALIMFGDSIVDVGNNNNLFSIVKSNFPPYGRDFINHRPTGRFCNGKLAVDFSAEYLG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            FSSYP A+LS +A+ ++LLIGANFASA+SGY + T++   AI L+
Sbjct  86   FSSYPPAFLSREASNEDLLIGANFASASSGYYDATSVPFGAISLT  130



>ref|XP_004145774.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Cucumis sativus]
 ref|XP_004160078.1| PREDICTED: GDSL esterase/lipase At5g22810-like [Cucumis sativus]
 gb|KGN46905.1| hypothetical protein Csa_6G149950 [Cucumis sativus]
Length=348

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 85/107 (79%), Gaps = 2/107 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS +DVG NN++ T+ KA++ PYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFTFGDSVLDVGINNHLKTLIKANFLPYGRDFITHKPTGRFCNGKLASDFTAEY  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYL     GK+LLIGA+FASAASGY + TA L NA+  +
Sbjct  83   LGFTSYPQAYLG--GGGKDLLIGASFASAASGYLDTTAELYNALSFT  127



>emb|CDY11271.1| BnaA03g01070D [Brassica napus]
Length=367

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA++  GDS VD GNNN   T+ KA++PPYGRDF +H  TGRF NGKLA D TA+ 
Sbjct  22   QPLVPALLIMGDSVVDAGNNNLRLTLVKANFPPYGRDFLAHTATGRFSNGKLAIDFTAEN  81

Query  281  LGFSSYPVAYLSPQATGK-NLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYPVAYLS  A  + NLL GANFAS ASGY + T+LL NAI L+
Sbjct  82   LGFTSYPVAYLSQDAANETNLLTGANFASGASGYHDGTSLLYNAISLT  129



>gb|KDO38511.1| hypothetical protein CISIN_1g018227mg [Citrus sinensis]
Length=340

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 79/106 (75%), Gaps = 19/106 (18%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            PLVPAII FGDS+VDVGNNNY+ T+FKA+YPPYGRDF +HQPTGRFCNGKLATD      
Sbjct  33   PLVPAIITFGDSAVDVGNNNYLATLFKANYPPYGRDFINHQPTGRFCNGKLATDF-----  87

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
                          TGKNLLIGANFASA SGYD++T+ L +AI L+
Sbjct  88   --------------TGKNLLIGANFASAGSGYDDRTSYLNHAISLT  119



>ref|XP_008458651.1| PREDICTED: GDSL esterase/lipase At5g22810 [Cucumis melo]
Length=348

 Score =   137 bits (344),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 84/107 (79%), Gaps = 2/107 (2%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QPLVPA+  FGDS +DVG NN++ T+ KA++ PYGRDF +H+PTGRFCNGKLA+D TA+ 
Sbjct  23   QPLVPALFTFGDSVLDVGINNHLKTLIKANFLPYGRDFTTHKPTGRFCNGKLASDFTAEY  82

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+SYP AYL     GK+ L+GA+FASAASGY + TA L NA+  +
Sbjct  83   LGFTSYPQAYLG--GGGKDFLVGASFASAASGYLDTTAELYNALSFT  127



>ref|XP_002515937.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF46357.1| zinc finger protein, putative [Ricinus communis]
Length=369

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 14/118 (12%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKL----------  256
            + PAI  FGDS++DVGNNNY+ T +KA+YPPYGRDFASH+PTGRFC+GK           
Sbjct  28   IFPAIFTFGDSAMDVGNNNYLSTFYKANYPPYGRDFASHEPTGRFCDGKXDLLDRSYLFC  87

Query  257  ----ATDITADTLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
                   + A+TLGF +Y  AYLSP A+G+NLLIGA+FASAASGYD+K+++  +AI L
Sbjct  88   SCMNQFLLAAETLGFKTYAPAYLSPDASGENLLIGASFASAASGYDDKSSIRNHAITL  145



>ref|XP_010515794.1| PREDICTED: GDSL esterase/lipase At3g53100-like isoform X2 [Camelina 
sativa]
Length=208

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF   +PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIMFGDSIVDVGNNNNLLSIVKSNFPPYGRDFIDQRPTGRFCNGKLAVDFSAEYLG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            FSSYP A+LS +A  +N  IGANFASA+SGY + T++   AI L+
Sbjct  86   FSSYPPAFLSREARNENFSIGANFASASSGYYDATSVPFGAISLT  130



>ref|XP_006656639.1| PREDICTED: GDSL esterase/lipase APG-like [Oryza brachyantha]
Length=356

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTL  283
            +VPA+ +FGDS++DVGNNNY+   +FKA+Y PYG +F   +PTGRF +GK+ TDITA+TL
Sbjct  29   IVPAVFSFGDSTIDVGNNNYLPGAVFKANYVPYGVNFHRRRPTGRFSDGKIVTDITAETL  88

Query  284  GFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            GF SY   YLSPQA+GKNLL+GANFASAAS Y + TA + +AI L+
Sbjct  89   GFESYAPPYLSPQASGKNLLLGANFASAASSYHDDTAAMYDAITLT  134



>ref|XP_006291405.1| hypothetical protein CARUB_v10017544mg [Capsella rubella]
 gb|EOA24303.1| hypothetical protein CARUB_v10017544mg [Capsella rubella]
Length=351

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF + +PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIIFGDSIVDVGNNNNLLSIVKSNFPPYGRDFINQRPTGRFCNGKLAVDFSAEYLG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            FSSYP A+LS +A  +N LIGANFASA+SGY + T++   AI L+
Sbjct  86   FSSYPPAFLSREARNENFLIGANFASASSGYYDATSVPFGAISLT  130



>ref|XP_002877901.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH54160.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=351

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF   +PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIMFGDSIVDVGNNNNLLSIVKSNFPPYGRDFIDQRPTGRFCNGKLAVDFSAEYLG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            FSSYP A+LS +A+ + LLIGANFASA+SGY + T++   AI L+
Sbjct  86   FSSYPPAFLSREASNETLLIGANFASASSGYYDATSVPFGAISLT  130



>ref|XP_009139436.1| PREDICTED: GDSL esterase/lipase At3g53100 isoform X2 [Brassica 
rapa]
Length=351

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF +  PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIMFGDSIVDVGNNNNLLSIVKSNFPPYGRDFTNQTPTGRFCNGKLAVDFSAEYLG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            FSSYP A+L+ +A  ++ LIGANFASA+SGY + T++   AIPL+
Sbjct  86   FSSYPPAFLNREARNEDFLIGANFASASSGYYDATSVPFGAIPLT  130



>emb|CDX76226.1| BnaA04g04900D [Brassica napus]
Length=351

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF +  PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIMFGDSIVDVGNNNNLLSIVKSNFPPYGRDFTNQTPTGRFCNGKLAVDFSAEYLG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            FSSYP A+L+ +A  ++ LIGANFASA+SGY + T++   AIPL+
Sbjct  86   FSSYPPAFLNREARNEDFLIGANFASASSGYYDATSVPFGAIPLT  130



>gb|KJB26682.1| hypothetical protein B456_004G254700 [Gossypium raimondii]
Length=347

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+  FGDS VDVGNNN + T+ KA++PPYGRDF  H+PTGRF NGKLA DI A+ +G
Sbjct  21   IVPALFIFGDSIVDVGNNNDLVTLIKANFPPYGRDFVDHEPTGRFSNGKLALDIIAEKVG  80

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            F+++  AY+S +A G+ LLIGANFASAASGY   TA+L N I LS
Sbjct  81   FTNHQPAYMSDKANGEMLLIGANFASAASGYYNATAILYNTISLS  125



>ref|XP_003561182.1| PREDICTED: GDSL esterase/lipase APG-like [Brachypodium distachyon]
Length=359

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 82/107 (77%), Gaps = 1/107 (1%)
 Frame = +2

Query  104  PLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFAS-HQPTGRFCNGKLATDITADT  280
            P VPAI+ FGDS VDVGNN+Y++TI KA+  PYGRDF   H  TGRF NGKL +D   + 
Sbjct  30   PRVPAIMFFGDSLVDVGNNDYINTIVKANLSPYGRDFQEDHVATGRFGNGKLISDFIGEK  89

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGFS  P AYLSP+A+GKNLL+GANFASA SGY + TAL+ + IPLS
Sbjct  90   LGFSVSPPAYLSPEASGKNLLLGANFASAGSGYYDPTALMYHVIPLS  136



>emb|CDX95394.1| BnaC04g27640D [Brassica napus]
Length=351

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF +  PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIMFGDSIVDVGNNNNLLSIVKSNFPPYGRDFTNRTPTGRFCNGKLAVDFSAEYLG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPL  418
            F SYP AYLS +A  ++ LIGANFASA+SGY + T++   AIPL
Sbjct  86   FPSYPPAYLSREARNEDFLIGANFASASSGYYDATSVPFGAIPL  129



>emb|CAB85501.1| putative protein [Arabidopsis thaliana]
Length=320

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +2

Query  128  FGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVA  307
             GDS VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ LGF+SYPVA
Sbjct  1    MGDSVVDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAENLGFTSYPVA  60

Query  308  YLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            YLS +A   NLL GANFAS ASG+D+ TA+  NAI LS
Sbjct  61   YLSQEANETNLLTGANFASGASGFDDATAIFYNAITLS  98



>gb|ABZ85654.1| truncated At5g03810, partial [Arabidopsis thaliana]
Length=137

 Score =   129 bits (324),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  VDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLGFSSYPVAYLSPQ  322
            VD GNNN+  T+ KA++PPYGRDF +H  TGRF NGKLATD TA+ LGF+SYPVAYLS  
Sbjct  2    VDAGNNNHRITLVKANFPPYGRDFVAHSATGRFSNGKLATDFTAENLGFTSYPVAYLSQD  61

Query  323  ATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            A   NLL GANFAS ASG+D+ TA+  NAI LS
Sbjct  62   ANETNLLTGANFASGASGFDDATAIFYNAITLS  94



>gb|EMT26145.1| GDSL esterase/lipase APG [Aegilops tauschii]
Length=353

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QP VP ++ FGDS V VGNN+Y+ T+ KA+  PYGRDF  H  TGRF NGKL +DI  + 
Sbjct  25   QPAVPGVMLFGDSLVGVGNNDYIATLVKANKAPYGRDFKDHVATGRFGNGKLLSDIIGEK  84

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+  P AYLSPQA+GKNLLIGANFASA SGY + T+ + + IPLS
Sbjct  85   LGFNGSPPAYLSPQASGKNLLIGANFASAGSGYYDPTSRMYHVIPLS  131



>ref|NP_001142139.1| uncharacterized protein LOC100274304 precursor [Zea mays]
 gb|ACF87746.1| unknown [Zea mays]
Length=359

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  277
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLATD T +
Sbjct  29   QALVPGVMIFGDSVVDAGNNNRLATLVRADFPPYGRDFPATHAPTGRFCNGKLATDYTVE  88

Query  278  TLGFSSYPVAYLSP--QATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +LG SSYP AYLS   Q+  K+LL GANFAS A+GY + TA L  A+ LS
Sbjct  89   SLGLSSYPPAYLSEEAQSNNKSLLHGANFASGAAGYLDATAALYGAMSLS  138



>gb|KFK34547.1| hypothetical protein AALP_AA5G160400 [Arabis alpina]
Length=351

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            LVPA+I FGDS VDVGNNN + +I K+++PPYGRDF +  PTGRFCNGKLA D  A+ +G
Sbjct  26   LVPALILFGDSIVDVGNNNNLASIVKSNFPPYGRDFINKNPTGRFCNGKLALDFAAEYIG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            FS+YP A+LS +A+ +NLLIGANFASA+SGY + T++   +I L+
Sbjct  86   FSTYPPAFLSREASNENLLIGANFASASSGYYDATSVPFGSITLT  130



>ref|XP_003561180.2| PREDICTED: GDSL esterase/lipase APG-like [Brachypodium distachyon]
Length=430

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYV-HTIFKADYPPYGRDFASHQPTGRFCNGKLATDITAD  277
            QPLVPA+I FGDS++DVGNNNY+   +FKA+Y PYG +F  H+ TGRF +GK+ +DITA+
Sbjct  98   QPLVPAMILFGDSTIDVGNNNYLPGAVFKANYAPYGDNFRRHRATGRFSDGKIVSDITAE  157

Query  278  TLGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +LGF SY   YLSP A+GKNLL GANF SAAS Y + TA + +AI LS
Sbjct  158  SLGFVSYAPPYLSPLASGKNLLAGANFGSAASSYADDTAAMYDAITLS  205



>ref|XP_010515793.1| PREDICTED: GDSL esterase/lipase At3g53100-like isoform X1 [Camelina 
sativa]
Length=304

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +2

Query  107  LVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADTLG  286
            +VPA+I FGDS VDVGNNN + +I K+++PPYGRDF   +PTGRFCNGKLA D +A+ LG
Sbjct  26   IVPALIMFGDSIVDVGNNNNLLSIVKSNFPPYGRDFIDQRPTGRFCNGKLAVDFSAEYLG  85

Query  287  FSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            FSSYP A+LS +A  +N  IGANFASA+SGY + T++   AI L+
Sbjct  86   FSSYPPAFLSREARNENFSIGANFASASSGYYDATSVPFGAISLT  130



>ref|NP_001241778.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG38766.1| anther-specific proline-rich protein APG precursor [Zea mays]
Length=360

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDF-ASHQPTGRFCNGKLATDITAD  277
            Q LVP ++ FGDS VD GNNN + T+ +AD+PPYGRDF A+H PTGRFCNGKLATD T +
Sbjct  30   QALVPGVMIFGDSVVDAGNNNRLATLVRADFPPYGRDFPATHAPTGRFCNGKLATDYTVE  89

Query  278  TLGFSSYPVAYLSP--QATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            +LG SSYP AYLS   Q+  K+LL GANFAS A+GY + TA L  A+ LS
Sbjct  90   SLGLSSYPPAYLSEEAQSNNKSLLHGANFASGAAGYLDATAALYGAMSLS  139



>gb|EMS52953.1| GDSL esterase/lipase APG [Triticum urartu]
Length=359

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  101  QPLVPAIIAFGDSSVDVGNNNYVHTIFKADYPPYGRDFASHQPTGRFCNGKLATDITADT  280
            QP VP ++ FGDS V VGNN+Y+ T+ KA+  PYGRDF  H  TGRF NGKL +DI  + 
Sbjct  31   QPAVPGVMLFGDSLVGVGNNDYLATLVKANMAPYGRDFKDHIATGRFGNGKLLSDIIGEK  90

Query  281  LGFSSYPVAYLSPQATGKNLLIGANFASAASGYDEKTALLXNAIPLS  421
            LGF+  P AYLSPQA+G+NLLIGANFASA SGY + TA + + IPLS
Sbjct  91   LGFNGSPPAYLSPQASGQNLLIGANFASAGSGYYDPTARIYHVIPLS  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555628969350