BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F22

Length=533
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008241115.1|  PREDICTED: ABC transporter G family member 2...    290   3e-91   Prunus mume [ume]
ref|XP_011042541.1|  PREDICTED: ABC transporter G family member 2...    288   8e-90   Populus euphratica
ref|XP_009348556.1|  PREDICTED: ABC transporter G family member 2...    285   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_008241114.1|  PREDICTED: ABC transporter G family member 2...    289   1e-89   Prunus mume [ume]
ref|XP_008241111.1|  PREDICTED: ABC transporter G family member 2...    289   1e-89   Prunus mume [ume]
ref|XP_011042537.1|  PREDICTED: ABC transporter G family member 2...    288   2e-89   Populus euphratica
ref|XP_007204637.1|  hypothetical protein PRUPE_ppa001882mg             288   3e-89   Prunus persica
gb|KDO70711.1|  hypothetical protein CISIN_1g0045372mg                  279   4e-89   Citrus sinensis [apfelsine]
ref|XP_010248083.1|  PREDICTED: ABC transporter G family member 2...    287   7e-89   Nelumbo nucifera [Indian lotus]
gb|KDO70708.1|  hypothetical protein CISIN_1g0045372mg                  281   7e-89   Citrus sinensis [apfelsine]
gb|KDO70709.1|  hypothetical protein CISIN_1g0045372mg                  280   1e-88   Citrus sinensis [apfelsine]
gb|KDO70707.1|  hypothetical protein CISIN_1g0045372mg                  281   2e-88   Citrus sinensis [apfelsine]
ref|XP_010110448.1|  ABC transporter G family member 22                 286   2e-88   
gb|KDO70706.1|  hypothetical protein CISIN_1g0045372mg                  281   2e-88   Citrus sinensis [apfelsine]
ref|XP_009348549.1|  PREDICTED: ABC transporter G family member 2...    285   2e-88   Pyrus x bretschneideri [bai li]
ref|XP_011467164.1|  PREDICTED: ABC transporter G family member 2...    285   2e-88   Fragaria vesca subsp. vesca
gb|KDO70704.1|  hypothetical protein CISIN_1g0045372mg                  281   5e-88   Citrus sinensis [apfelsine]
ref|XP_004303381.2|  PREDICTED: ABC transporter G family member 2...    285   7e-88   Fragaria vesca subsp. vesca
ref|XP_004228604.1|  PREDICTED: ABC transporter G family member 2...    284   7e-88   Solanum lycopersicum
gb|KDP36071.1|  hypothetical protein JCGZ_08715                         284   8e-88   Jatropha curcas
ref|XP_009796796.1|  PREDICTED: ABC transporter G family member 2...    281   8e-88   Nicotiana sylvestris
ref|XP_009622617.1|  PREDICTED: ABC transporter G family member 2...    283   1e-87   Nicotiana tomentosiformis
gb|KHN10345.1|  ABC transporter G family member 27                      281   2e-87   Glycine soja [wild soybean]
ref|XP_006348422.1|  PREDICTED: ABC transporter G family member 2...    283   2e-87   Solanum tuberosum [potatoes]
ref|XP_002322764.1|  ABC transporter family protein                     283   2e-87   
ref|XP_008392009.1|  PREDICTED: ABC transporter G family member 2...    283   2e-87   
gb|KJB36224.1|  hypothetical protein B456_006G147000                    278   6e-87   Gossypium raimondii
ref|XP_006430004.1|  hypothetical protein CICLE_v10011143mg             278   6e-87   
ref|XP_009362644.1|  PREDICTED: ABC transporter G family member 2...    278   8e-87   Pyrus x bretschneideri [bai li]
ref|XP_003519092.1|  PREDICTED: ABC transporter G family member 2...    281   9e-87   Glycine max [soybeans]
emb|CDP10560.1|  unnamed protein product                                280   1e-86   Coffea canephora [robusta coffee]
ref|XP_006373817.1|  hypothetical protein POPTR_0016s06620g             280   1e-86   
ref|XP_009796795.1|  PREDICTED: ABC transporter G family member 2...    280   2e-86   Nicotiana sylvestris
ref|XP_006481645.1|  PREDICTED: ABC transporter G family member 2...    280   2e-86   Citrus sinensis [apfelsine]
ref|XP_006588894.1|  PREDICTED: ABC transporter G family member 2...    279   2e-86   Glycine max [soybeans]
ref|XP_010653240.1|  PREDICTED: ABC transporter G family member 2...    276   2e-86   Vitis vinifera
ref|XP_006575266.1|  PREDICTED: ABC transporter G family member 2...    281   3e-86   Glycine max [soybeans]
ref|XP_006430002.1|  hypothetical protein CICLE_v10011143mg             278   3e-86   
ref|XP_007028066.1|  White-brown-complex ABC transporter family i...    278   3e-86   
ref|XP_010557969.1|  PREDICTED: ABC transporter G family member 2...    280   4e-86   Tarenaya hassleriana [spider flower]
ref|XP_008359521.1|  PREDICTED: ABC transporter G family member 2...    279   5e-86   
ref|XP_003535833.2|  PREDICTED: ABC transporter G family member 2...    280   8e-86   Glycine max [soybeans]
gb|KJB36225.1|  hypothetical protein B456_006G147000                    279   8e-86   Gossypium raimondii
ref|XP_006430003.1|  hypothetical protein CICLE_v10011143mg             278   1e-85   Citrus clementina [clementine]
ref|XP_009362643.1|  PREDICTED: ABC transporter G family member 2...    278   2e-85   Pyrus x bretschneideri [bai li]
ref|XP_004497624.1|  PREDICTED: ABC transporter G family member 2...    278   2e-85   Cicer arietinum [garbanzo]
ref|XP_007028065.1|  White-brown-complex ABC transporter family i...    278   2e-85   Theobroma cacao [chocolate]
gb|ACU17386.1|  unknown                                                 262   2e-85   Glycine max [soybeans]
ref|XP_009362642.1|  PREDICTED: ABC transporter G family member 2...    278   2e-85   Pyrus x bretschneideri [bai li]
ref|XP_011077784.1|  PREDICTED: ABC transporter G family member 22      278   2e-85   Sesamum indicum [beniseed]
ref|XP_006381927.1|  hypothetical protein POPTR_0006s21400g             272   3e-85   
gb|AIU41652.1|  ABC transporter family protein                          277   4e-85   Hevea brasiliensis [jebe]
ref|XP_002524100.1|  ATP-binding cassette transporter, putative         277   5e-85   Ricinus communis
emb|CBI39105.3|  unnamed protein product                                276   6e-85   Vitis vinifera
ref|XP_007145759.1|  hypothetical protein PHAVU_007G265300g             276   7e-85   Phaseolus vulgaris [French bean]
ref|XP_007028064.1|  White-brown-complex ABC transporter family i...    278   7e-85   
ref|XP_010653238.1|  PREDICTED: ABC transporter G family member 2...    276   7e-85   Vitis vinifera
emb|CDY14079.1|  BnaC02g01960D                                          276   1e-84   Brassica napus [oilseed rape]
ref|XP_010653239.1|  PREDICTED: ABC transporter G family member 2...    274   1e-84   Vitis vinifera
gb|KHG09828.1|  ABC transporter G family member 22                      272   2e-84   Gossypium arboreum [tree cotton]
gb|KJB16513.1|  hypothetical protein B456_002G233500                    271   3e-84   Gossypium raimondii
gb|KEH41804.1|  white-brown-complex ABC transporter family protein      270   4e-84   Medicago truncatula
gb|KJB16514.1|  hypothetical protein B456_002G233500                    271   5e-84   Gossypium raimondii
ref|XP_004161297.1|  PREDICTED: ABC transporter G family member 2...    270   1e-83   
gb|KJB16510.1|  hypothetical protein B456_002G233500                    271   1e-83   Gossypium raimondii
ref|XP_010519981.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    273   1e-83   Tarenaya hassleriana [spider flower]
gb|EYU38702.1|  hypothetical protein MIMGU_mgv1a001826mg                273   1e-83   Erythranthe guttata [common monkey flower]
ref|XP_002309268.1|  ABC transporter family protein                     273   1e-83   
gb|KJB14995.1|  hypothetical protein B456_002G153900                    268   2e-83   Gossypium raimondii
ref|XP_010917904.1|  PREDICTED: ABC transporter G family member 2...    271   2e-83   
ref|XP_004494280.1|  PREDICTED: ABC transporter G family member 2...    268   3e-83   
emb|CDX70095.1|  BnaA10g24440D                                          271   3e-83   
ref|XP_009122263.1|  PREDICTED: ABC transporter G family member 2...    272   3e-83   Brassica rapa
emb|CDX98933.1|  BnaC09g49020D                                          272   4e-83   
ref|XP_011047135.1|  PREDICTED: ABC transporter G family member 2...    270   4e-83   Populus euphratica
ref|XP_008790027.1|  PREDICTED: ABC transporter G family member 2...    271   5e-83   
ref|XP_009122262.1|  PREDICTED: ABC transporter G family member 2...    271   5e-83   Brassica rapa
ref|XP_010917903.1|  PREDICTED: ABC transporter G family member 2...    271   5e-83   Elaeis guineensis
ref|XP_008442969.1|  PREDICTED: ABC transporter G family member 2...    271   5e-83   
ref|XP_008790010.1|  PREDICTED: ABC transporter G family member 2...    271   5e-83   Phoenix dactylifera
ref|XP_008790019.1|  PREDICTED: ABC transporter G family member 2...    271   6e-83   Phoenix dactylifera
ref|XP_008442971.1|  PREDICTED: ABC transporter G family member 2...    271   6e-83   Cucumis melo [Oriental melon]
gb|KJB16512.1|  hypothetical protein B456_002G233500                    271   7e-83   Gossypium raimondii
dbj|BAB11402.1|  ABC transporter-like protein                           266   9e-83   Arabidopsis thaliana [mouse-ear cress]
gb|KEH41805.1|  white-brown-complex ABC transporter family protein      270   1e-82   Medicago truncatula
gb|KHG30511.1|  ABC transporter G family member 22                      268   1e-82   Gossypium arboreum [tree cotton]
ref|XP_004136536.1|  PREDICTED: ABC transporter G family member 2...    270   1e-82   Cucumis sativus [cucumbers]
ref|XP_011047134.1|  PREDICTED: ABC transporter G family member 2...    270   2e-82   Populus euphratica
ref|XP_011047133.1|  PREDICTED: ABC transporter G family member 2...    270   2e-82   Populus euphratica
emb|CDY04991.1|  BnaAnng01730D                                          269   2e-82   
ref|XP_004494279.1|  PREDICTED: ABC transporter G family member 2...    268   2e-82   
ref|XP_011094213.1|  PREDICTED: ABC transporter G family member 2...    269   3e-82   
ref|XP_010036577.1|  PREDICTED: ABC transporter G family member 2...    270   3e-82   Eucalyptus grandis [rose gum]
ref|XP_004494278.1|  PREDICTED: ABC transporter G family member 2...    268   5e-82   Cicer arietinum [garbanzo]
gb|KEH24295.1|  white-brown-complex ABC transporter family protein      265   5e-82   Medicago truncatula
gb|KJB14994.1|  hypothetical protein B456_002G153900                    269   5e-82   Gossypium raimondii
ref|XP_010491223.1|  PREDICTED: ABC transporter G family member 2...    268   5e-82   
gb|KJB14993.1|  hypothetical protein B456_002G153900                    269   6e-82   Gossypium raimondii
ref|XP_002873263.1|  abc transporter family protein                     268   8e-82   
ref|XP_006287123.1|  hypothetical protein CARUB_v10000295mg             268   9e-82   Capsella rubella
ref|NP_001031843.1|  ABC transporter G family member 22                 267   1e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094212.1|  PREDICTED: ABC transporter G family member 2...    264   1e-81   
ref|XP_010491222.1|  PREDICTED: ABC transporter G family member 2...    268   1e-81   Camelina sativa [gold-of-pleasure]
ref|NP_568169.1|  ABC transporter G family member 22                    268   1e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423326.1|  PREDICTED: ABC transporter G family member 2...    267   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010452592.1|  PREDICTED: ABC transporter G family member 22      267   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_011094211.1|  PREDICTED: ABC transporter G family member 2...    265   2e-81   
ref|XP_003521505.1|  PREDICTED: ABC transporter G family member 2...    266   5e-81   Glycine max [soybeans]
ref|XP_009125649.1|  PREDICTED: ABC transporter G family member 2...    266   6e-81   Brassica rapa
ref|XP_006604672.1|  PREDICTED: ABC transporter G family member 2...    262   9e-81   Glycine max [soybeans]
ref|XP_006604673.1|  PREDICTED: ABC transporter G family member 2...    262   9e-81   
gb|EMT07325.1|  ABC transporter G family member 22                      262   1e-80   
gb|KEH24294.1|  white-brown-complex ABC transporter family protein      265   2e-80   Medicago truncatula
ref|XP_006826407.1|  hypothetical protein AMTR_s00004p00153830          258   2e-80   
ref|XP_006649428.1|  PREDICTED: ABC transporter G family member 2...    263   2e-80   
ref|XP_002465834.1|  hypothetical protein SORBIDRAFT_01g046620          264   3e-80   Sorghum bicolor [broomcorn]
gb|AAM51832.1|AC105730_6  Putative ABC transporter                      263   4e-80   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74548.1|  hypothetical protein OsI_10084                          264   6e-80   Oryza sativa Indica Group [Indian rice]
gb|EMS65761.1|  ABC transporter G family member 22                      262   6e-80   Triticum urartu
ref|NP_001049014.1|  Os03g0157400                                       264   6e-80   
ref|XP_006399125.1|  hypothetical protein EUTSA_v10012760mg             263   9e-80   Eutrema salsugineum [saltwater cress]
ref|XP_010244002.1|  PREDICTED: ABC transporter G family member 2...    264   9e-80   
ref|XP_010244004.1|  PREDICTED: ABC transporter G family member 2...    264   9e-80   Nelumbo nucifera [Indian lotus]
ref|XP_010244001.1|  PREDICTED: ABC transporter G family member 2...    264   1e-79   Nelumbo nucifera [Indian lotus]
gb|KHN43592.1|  ABC transporter G family member 22                      261   1e-79   Glycine soja [wild soybean]
ref|XP_003553629.1|  PREDICTED: ABC transporter G family member 2...    262   2e-79   
ref|XP_006604670.1|  PREDICTED: ABC transporter G family member 2...    262   2e-79   Glycine max [soybeans]
ref|XP_007163008.1|  hypothetical protein PHAVU_001G198400g             258   2e-79   Phaseolus vulgaris [French bean]
ref|XP_009412321.1|  PREDICTED: ABC transporter G family member 2...    261   3e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003562060.1|  PREDICTED: ABC transporter G family member 2...    261   7e-79   Brachypodium distachyon [annual false brome]
ref|XP_004985644.1|  PREDICTED: ABC transporter G family member 2...    260   8e-79   Setaria italica
ref|XP_006854611.1|  hypothetical protein AMTR_s00030p00144980          260   8e-79   
ref|XP_009405790.1|  PREDICTED: ABC transporter G family member 2...    260   9e-79   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK06297.1|  predicted protein                                      260   1e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAK63861.1|AF389289_1  AT5g06530/F15M7_6                             253   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388615.1|  PREDICTED: ABC transporter G family member 2...    260   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008664829.1|  PREDICTED: uncharacterized protein LOC100216...    259   2e-78   Zea mays [maize]
ref|XP_008664823.1|  PREDICTED: uncharacterized protein LOC100216...    259   2e-78   Zea mays [maize]
ref|XP_010677592.1|  PREDICTED: ABC transporter G family member 22      259   3e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009388622.1|  PREDICTED: ABC transporter G family member 2...    259   3e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007163009.1|  hypothetical protein PHAVU_001G198400g             257   1e-77   Phaseolus vulgaris [French bean]
dbj|BAJ88390.1|  predicted protein                                      257   2e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK40221.1|  hypothetical protein AALP_AA3G346400                    254   2e-77   Arabis alpina [alpine rockcress]
tpg|DAA43438.1|  TPA: hypothetical protein ZEAMMB73_582925              258   2e-77   
gb|KEH41808.1|  white-brown-complex ABC transporter family protein      250   3e-76   Medicago truncatula
ref|XP_010247278.1|  PREDICTED: ABC transporter G family member 2...    254   3e-76   
ref|XP_010553412.1|  PREDICTED: ABC transporter G family member 2...    250   5e-76   Tarenaya hassleriana [spider flower]
ref|XP_009412322.1|  PREDICTED: ABC transporter G family member 2...    249   2e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS59306.1|  hypothetical protein M569_15501                         248   2e-75   Genlisea aurea
ref|XP_006403815.1|  hypothetical protein EUTSA_v10010138mg             251   3e-75   
ref|XP_010553410.1|  PREDICTED: ABC transporter G family member 2...    249   8e-75   Tarenaya hassleriana [spider flower]
ref|XP_010503974.1|  PREDICTED: ABC transporter G family member 2...    246   1e-74   
ref|XP_010320061.1|  PREDICTED: ABC transporter G family member 2...    248   3e-74   Solanum lycopersicum
ref|XP_004237766.1|  PREDICTED: ABC transporter G family member 2...    248   3e-74   Solanum lycopersicum
ref|XP_009799080.1|  PREDICTED: ABC transporter G family member 2...    248   4e-74   Nicotiana sylvestris
ref|XP_009799082.1|  PREDICTED: ABC transporter G family member 2...    247   5e-74   Nicotiana sylvestris
ref|XP_010426847.1|  PREDICTED: ABC transporter G family member 2...    244   5e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006362828.1|  PREDICTED: ABC transporter G family member 2...    246   2e-73   Solanum tuberosum [potatoes]
ref|XP_010503973.1|  PREDICTED: ABC transporter G family member 2...    245   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006292375.1|  hypothetical protein CARUB_v10018588mg             245   3e-73   
ref|XP_010503972.1|  PREDICTED: ABC transporter G family member 2...    245   4e-73   Camelina sativa [gold-of-pleasure]
ref|XP_011101660.1|  PREDICTED: ABC transporter G family member 2...    245   4e-73   Sesamum indicum [beniseed]
ref|XP_009599779.1|  PREDICTED: ABC transporter G family member 2...    244   7e-73   
ref|XP_010426848.1|  PREDICTED: ABC transporter G family member 2...    244   1e-72   Camelina sativa [gold-of-pleasure]
gb|EYU17426.1|  hypothetical protein MIMGU_mgv1a002142mg                241   1e-71   Erythranthe guttata [common monkey flower]
ref|XP_010911944.1|  PREDICTED: ABC transporter G family member 2...    239   2e-71   
ref|XP_002263430.1|  PREDICTED: ABC transporter G family member 2...    241   2e-71   Vitis vinifera
emb|CBI35490.3|  unnamed protein product                                241   3e-71   Vitis vinifera
ref|XP_010515694.1|  PREDICTED: ABC transporter G family member 27      239   4e-71   Camelina sativa [gold-of-pleasure]
emb|CDY23205.1|  BnaA04g05540D                                          239   4e-71   Brassica napus [oilseed rape]
ref|XP_004985645.1|  PREDICTED: ABC transporter G family member 2...    238   9e-71   Setaria italica
ref|XP_009139468.1|  PREDICTED: ABC transporter G family member 27      238   1e-70   Brassica rapa
ref|XP_002876135.1|  abc transporter family protein                     238   1e-70   
ref|XP_008356252.1|  PREDICTED: ABC transporter G family member 2...    233   2e-69   
ref|XP_009360789.1|  PREDICTED: ABC transporter G family member 2...    234   5e-69   
sp|Q9FT51.1|AB27G_ARATH  RecName: Full=ABC transporter G family m...    234   5e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CDX95330.1|  BnaC04g28280D                                          234   6e-69   
ref|NP_190799.2|  ABC transporter G family member 27                    234   7e-69   
ref|XP_007200734.1|  hypothetical protein PRUPE_ppa021401mg             230   3e-68   
ref|XP_009415591.1|  PREDICTED: ABC transporter G family member 2...    230   3e-68   
ref|XP_007019433.1|  White-brown-complex ABC transporter family         229   4e-67   
gb|ABR17189.1|  unknown                                                 228   1e-66   Picea sitchensis
ref|XP_008237629.1|  PREDICTED: ABC transporter G family member 2...    228   1e-66   Prunus mume [ume]
emb|CAN66426.1|  hypothetical protein VITISV_029010                     227   2e-66   Vitis vinifera
gb|KDP43029.1|  hypothetical protein JCGZ_25215                         225   8e-66   Jatropha curcas
ref|XP_011458535.1|  PREDICTED: ABC transporter G family member 2...    218   3e-63   Fragaria vesca subsp. vesca
ref|XP_010680137.1|  PREDICTED: ABC transporter G family member 2...    215   4e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002992999.1|  hypothetical protein SELMODRAFT_136316             208   9e-61   
ref|XP_002991839.1|  ATP-binding cassette transporter                   208   1e-60   
gb|KJB19218.1|  hypothetical protein B456_003G089800                    208   1e-60   Gossypium raimondii
gb|KJB19215.1|  hypothetical protein B456_003G089800                    206   5e-60   Gossypium raimondii
gb|KJB19216.1|  hypothetical protein B456_003G089800                    207   8e-60   Gossypium raimondii
gb|KJB19217.1|  hypothetical protein B456_003G089800                    207   2e-59   Gossypium raimondii
ref|XP_001763976.1|  ATP-binding cassette transporter, subfamily ...    201   2e-57   
ref|XP_011095584.1|  PREDICTED: ABC transporter G family member 26      184   3e-51   
ref|XP_002526137.1|  ATP-binding cassette transporter, putative         182   2e-50   
ref|XP_010542511.1|  PREDICTED: ABC transporter G family member 2...    182   2e-50   Tarenaya hassleriana [spider flower]
gb|KDO59196.1|  hypothetical protein CISIN_1g044602mg                   182   2e-50   Citrus sinensis [apfelsine]
ref|XP_006474829.1|  PREDICTED: ABC transporter G family member 2...    182   2e-50   Citrus sinensis [apfelsine]
ref|XP_006452648.1|  hypothetical protein CICLE_v10010223mg             182   2e-50   Citrus clementina [clementine]
ref|XP_009628134.1|  PREDICTED: ABC transporter G family member 26      181   6e-50   Nicotiana tomentosiformis
ref|XP_009781518.1|  PREDICTED: ABC transporter G family member 26      181   6e-50   Nicotiana sylvestris
emb|CAN73913.1|  hypothetical protein VITISV_035231                     180   9e-50   Vitis vinifera
gb|EYU27464.1|  hypothetical protein MIMGU_mgv1a002345mg                181   1e-49   Erythranthe guttata [common monkey flower]
ref|XP_010542512.1|  PREDICTED: ABC transporter G family member 2...    180   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_002867504.1|  abc transporter family protein                     180   1e-49   
ref|XP_002267511.2|  PREDICTED: ABC transporter G family member 26      180   1e-49   Vitis vinifera
ref|XP_009124723.1|  PREDICTED: ABC transporter G family member 26      180   1e-49   Brassica rapa
emb|CDY24203.1|  BnaC01g37830D                                          180   2e-49   Brassica napus [oilseed rape]
ref|NP_194472.3|  ABC transporter G family member 9                     179   2e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38655.1|  hypothetical protein AALP_AA3G143100                    179   3e-49   Arabis alpina [alpine rockcress]
ref|XP_002884953.1|  abc transporter family protein                     179   4e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_006346115.1|  PREDICTED: ABC transporter G family member 2...    179   4e-49   Solanum tuberosum [potatoes]
ref|XP_010465139.1|  PREDICTED: ABC transporter G family member 26      178   5e-49   
ref|XP_010500190.1|  PREDICTED: ABC transporter G family member 2...    178   5e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010265777.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    178   6e-49   Nelumbo nucifera [Indian lotus]
ref|XP_006300234.1|  hypothetical protein CARUB_v10016471mg             178   6e-49   Capsella rubella
ref|XP_006359003.1|  PREDICTED: ABC transporter G family member 9...    178   6e-49   Solanum tuberosum [potatoes]
emb|CDP13689.1|  unnamed protein product                                178   6e-49   Coffea canephora [robusta coffee]
ref|XP_002522797.1|  ATP-binding cassette transporter, putative         178   6e-49   Ricinus communis
gb|KJB22183.1|  hypothetical protein B456_004G033800                    178   6e-49   Gossypium raimondii
ref|NP_187928.2|  ABC transporter G family member 26                    178   6e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004498150.1|  PREDICTED: ABC transporter G family member 2...    178   7e-49   Cicer arietinum [garbanzo]
ref|XP_004252105.1|  PREDICTED: ABC transporter G family member 9...    177   8e-49   Solanum lycopersicum
ref|XP_006407250.1|  hypothetical protein EUTSA_v10020198mg             177   9e-49   Eutrema salsugineum [saltwater cress]
ref|XP_007020427.1|  ABC-2 type transporter family protein              177   9e-49   
ref|XP_010676075.1|  PREDICTED: ABC transporter G family member 26      177   1e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW87232.1|  hypothetical protein ZEAMMB73_313043                    177   1e-48   
ref|XP_007140114.1|  hypothetical protein PHAVU_008G085200g             176   1e-48   Phaseolus vulgaris [French bean]
ref|XP_002969079.1|  ATP-binding cassette transporter                   176   1e-48   
gb|KDP39319.1|  hypothetical protein JCGZ_01076                         177   2e-48   Jatropha curcas
gb|ACN27720.1|  unknown                                                 177   2e-48   Zea mays [maize]
ref|NP_001151511.1|  ABC transporter-like protein                       177   2e-48   Zea mays [maize]
ref|XP_002992849.1|  hypothetical protein SELMODRAFT_136119             176   2e-48   
gb|KFK29257.1|  hypothetical protein AALP_AA7G109600                    176   2e-48   Arabis alpina [alpine rockcress]
ref|XP_010487069.1|  PREDICTED: ABC transporter G family member 2...    177   2e-48   Camelina sativa [gold-of-pleasure]
dbj|BAB01414.1|  ABC transporter-like protein                           177   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300394.2|  ABC transporter family protein                     176   2e-48   
ref|XP_011038858.1|  PREDICTED: ABC transporter G family member 26      177   2e-48   Populus euphratica
ref|XP_004244029.1|  PREDICTED: ABC transporter G family member 26      176   3e-48   Solanum lycopersicum
ref|XP_008797781.1|  PREDICTED: ABC transporter G family member 26      176   3e-48   
ref|XP_010520902.1|  PREDICTED: ABC transporter G family member 9...    175   5e-48   Tarenaya hassleriana [spider flower]
ref|XP_006413078.1|  hypothetical protein EUTSA_v10024656mg             175   5e-48   Eutrema salsugineum [saltwater cress]
emb|CBI20349.3|  unnamed protein product                                174   6e-48   Vitis vinifera
ref|XP_009766511.1|  PREDICTED: ABC transporter G family member 9...    175   7e-48   Nicotiana sylvestris
ref|XP_010063246.1|  PREDICTED: ABC transporter G family member 26      175   7e-48   Eucalyptus grandis [rose gum]
ref|XP_006857737.1|  hypothetical protein AMTR_s00061p00187570          175   8e-48   Amborella trichopoda
emb|CAN62144.1|  hypothetical protein VITISV_007841                     174   9e-48   Vitis vinifera
ref|XP_001780064.1|  ATP-binding cassette transporter, subfamily ...    174   1e-47   
ref|XP_009605775.1|  PREDICTED: ABC transporter G family member 9       174   1e-47   Nicotiana tomentosiformis
ref|XP_002281949.1|  PREDICTED: ABC transporter G family member 9       174   1e-47   Vitis vinifera
ref|XP_009792869.1|  PREDICTED: ABC transporter G family member 9...    174   1e-47   Nicotiana sylvestris
ref|XP_010942700.1|  PREDICTED: ABC transporter G family member 26      174   1e-47   
ref|XP_010438619.1|  PREDICTED: ABC transporter G family member 9...    174   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010448138.1|  PREDICTED: ABC transporter G family member 9       174   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010433373.1|  PREDICTED: ABC transporter G family member 9...    174   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_007140113.1|  hypothetical protein PHAVU_008G085200g             174   2e-47   Phaseolus vulgaris [French bean]
ref|XP_009137658.1|  PREDICTED: ABC transporter G family member 9...    174   2e-47   Brassica rapa
emb|CDY29837.1|  BnaA03g48580D                                          174   2e-47   Brassica napus [oilseed rape]
ref|XP_008218542.1|  PREDICTED: ABC transporter G family member 26      174   2e-47   Prunus mume [ume]
ref|XP_007207412.1|  hypothetical protein PRUPE_ppa014606mg             174   2e-47   
emb|CDX92829.1|  BnaC07g40870D                                          173   3e-47   
ref|XP_003552990.1|  PREDICTED: ABC transporter G family member 2...    173   4e-47   Glycine max [soybeans]
ref|XP_004294923.1|  PREDICTED: ABC transporter G family member 26      173   5e-47   Fragaria vesca subsp. vesca
gb|KHN31682.1|  ABC transporter G family member 26                      173   5e-47   Glycine soja [wild soybean]
ref|XP_002438658.1|  hypothetical protein SORBIDRAFT_10g023750          172   6e-47   
ref|XP_009395262.1|  PREDICTED: ABC transporter G family member 9...    172   9e-47   
ref|XP_002533914.1|  ATP-binding cassette transporter, putative         172   9e-47   Ricinus communis
gb|EMT12374.1|  ABC transporter G family member 26                      172   1e-46   
ref|XP_006878615.1|  hypothetical protein AMTR_s00011p00258490          172   1e-46   Amborella trichopoda
ref|XP_006370303.1|  hypothetical protein POPTR_0001s41450g             172   1e-46   
ref|XP_002316916.1|  ABC transporter family protein                     171   1e-46   
ref|XP_010109266.1|  ABC transporter G family member 26                 174   2e-46   
ref|XP_006286036.1|  hypothetical protein CARUB_v10007565mg             171   2e-46   Capsella rubella
ref|XP_007021331.1|  White-brown-complex ABC transporter family         171   3e-46   
ref|XP_002438657.1|  hypothetical protein SORBIDRAFT_10g023740          171   3e-46   
ref|XP_004244204.1|  PREDICTED: ABC transporter G family member 9       170   3e-46   Solanum lycopersicum
ref|XP_009607601.1|  PREDICTED: ABC transporter G family member 9...    170   4e-46   Nicotiana tomentosiformis
ref|XP_004965922.1|  PREDICTED: ABC transporter G family member 2...    170   4e-46   Setaria italica
ref|XP_004491527.1|  PREDICTED: ABC transporter G family member 2...    170   4e-46   
emb|CDY29304.1|  BnaC01g19560D                                          170   4e-46   
ref|XP_011029437.1|  PREDICTED: ABC transporter G family member 9...    170   4e-46   
ref|XP_009143407.1|  PREDICTED: ABC transporter G family member 9       170   5e-46   
gb|KHN36795.1|  ABC transporter G family member 9                       169   5e-46   
ref|XP_003563648.1|  PREDICTED: ABC transporter G family member 2...    169   6e-46   
ref|XP_011095242.1|  PREDICTED: ABC transporter G family member 9...    169   6e-46   
gb|EYU37490.1|  hypothetical protein MIMGU_mgv1a026680mg                168   7e-46   
ref|XP_009367249.1|  PREDICTED: ABC transporter G family member 26      169   7e-46   
ref|XP_011095241.1|  PREDICTED: ABC transporter G family member 9...    169   8e-46   
ref|XP_008349497.1|  PREDICTED: ABC transporter G family member 2...    169   8e-46   
ref|XP_004154501.1|  PREDICTED: ABC transporter G family member 2...    164   8e-46   
ref|XP_003541854.2|  PREDICTED: ABC transporter G family member 9...    169   8e-46   
ref|XP_009414356.1|  PREDICTED: ABC transporter G family member 26      169   8e-46   
ref|XP_010227525.1|  PREDICTED: ABC transporter G family member 2...    169   9e-46   
ref|XP_010520986.1|  PREDICTED: ABC transporter G family member 9...    160   2e-45   
ref|XP_011042498.1|  PREDICTED: ABC transporter G family member 9...    168   2e-45   
gb|KJB35860.1|  hypothetical protein B456_006G130900                    163   2e-45   
ref|XP_006855537.1|  hypothetical protein AMTR_s00057p00214480          168   2e-45   
ref|XP_010256405.1|  PREDICTED: ABC transporter G family member 25      167   3e-45   
ref|XP_008386302.1|  PREDICTED: ABC transporter G family member 9...    167   4e-45   
gb|KDP27016.1|  hypothetical protein JCGZ_20951                         167   4e-45   
ref|XP_004139680.1|  PREDICTED: ABC transporter G family member 2...    167   4e-45   
gb|KGN44483.1|  hypothetical protein Csa_7G307400                       167   5e-45   
gb|KHN43910.1|  ABC transporter G family member 26                      167   5e-45   
ref|XP_006359002.1|  PREDICTED: ABC transporter G family member 9...    167   6e-45   
ref|XP_003519640.2|  PREDICTED: ABC transporter G family member 2...    167   6e-45   
emb|CDP07185.1|  unnamed protein product                                167   6e-45   
ref|XP_008775311.1|  PREDICTED: ABC transporter G family member 9...    166   8e-45   
ref|XP_008237669.1|  PREDICTED: ABC transporter G family member 9...    166   1e-44   
ref|XP_007142441.1|  hypothetical protein PHAVU_008G280800g             166   1e-44   
ref|XP_007214012.1|  hypothetical protein PRUPE_ppa014861mg             166   1e-44   
ref|XP_008799253.1|  PREDICTED: ABC transporter G family member 9...    166   2e-44   
ref|XP_003544606.1|  PREDICTED: ABC transporter G family member 2...    166   2e-44   
ref|XP_006595681.1|  PREDICTED: ABC transporter G family member 2...    166   2e-44   
ref|XP_007199008.1|  hypothetical protein PRUPE_ppa017466mg             165   2e-44   
ref|XP_008226675.1|  PREDICTED: ABC transporter G family member 9       165   2e-44   
ref|XP_002519942.1|  ATP-binding cassette transporter, putative         165   3e-44   
gb|KFK22193.1|  hypothetical protein AALP_AAs48135U000100               153   3e-44   
ref|XP_004487681.1|  PREDICTED: ABC transporter G family member 9...    165   3e-44   
gb|KEH38788.1|  white-brown-complex ABC transporter family protein      164   3e-44   
gb|KFK40223.1|  hypothetical protein AALP_AA3G346600                    157   4e-44   
gb|KJB13426.1|  hypothetical protein B456_002G073600                    164   4e-44   
ref|XP_007133073.1|  hypothetical protein PHAVU_011G149300g             164   4e-44   
gb|AET00827.2|  white-brown-complex ABC transporter family protein      164   5e-44   
ref|XP_008451875.1|  PREDICTED: ABC transporter G family member 14      164   5e-44   
ref|XP_008461920.1|  PREDICTED: ABC transporter G family member 25      164   5e-44   
ref|XP_003617868.1|  ABC transporter G family member                    164   6e-44   
gb|EYU29117.1|  hypothetical protein MIMGU_mgv1a002688mg                164   7e-44   
ref|XP_006351917.1|  PREDICTED: ABC transporter G family member 2...    164   7e-44   
ref|XP_011098341.1|  PREDICTED: ABC transporter G family member 9       164   8e-44   
gb|KJB60113.1|  hypothetical protein B456_009G290300                    164   8e-44   
gb|KHG09588.1|  ABC transporter G family member 25                      164   8e-44   
gb|KJB35859.1|  hypothetical protein B456_006G130900                    162   8e-44   
gb|KCW50637.1|  hypothetical protein EUGRSUZ_J00337                     163   9e-44   
gb|EYU26406.1|  hypothetical protein MIMGU_mgv1a004006mg                163   9e-44   
ref|XP_011082193.1|  PREDICTED: ABC transporter G family member 1...    163   9e-44   
ref|XP_009378509.1|  PREDICTED: ABC transporter G family member 9       163   1e-43   
gb|KHG11002.1|  ABC transporter G family member 25                      163   1e-43   
ref|XP_006361227.1|  PREDICTED: ABC transporter G family member 1...    163   1e-43   
ref|XP_006361228.1|  PREDICTED: ABC transporter G family member 1...    163   1e-43   
ref|XP_003548769.1|  PREDICTED: ABC transporter G family member 1...    163   1e-43   
ref|XP_010034170.1|  PREDICTED: ABC transporter G family member 9       162   2e-43   
gb|KJB35858.1|  hypothetical protein B456_006G130900                    162   2e-43   
ref|XP_009757349.1|  PREDICTED: ABC transporter G family member 1...    162   2e-43   
ref|XP_010675645.1|  PREDICTED: ABC transporter G family member 9       162   2e-43   
ref|XP_010540713.1|  PREDICTED: ABC transporter G family member 14      162   2e-43   
ref|XP_010463057.1|  PREDICTED: ABC transporter G family member 1...    162   2e-43   
ref|XP_009383080.1|  PREDICTED: ABC transporter G family member 9       162   2e-43   
ref|XP_004164431.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    162   2e-43   
ref|XP_004147769.1|  PREDICTED: ABC transporter G family member 1...    162   2e-43   
ref|XP_009605917.1|  PREDICTED: ABC transporter G family member 1...    162   3e-43   
ref|XP_004246010.1|  PREDICTED: ABC transporter G family member 14      162   3e-43   
ref|XP_004250400.1|  PREDICTED: ABC transporter G family member 25      162   4e-43   
gb|ABB97034.1|  ABC transporter-like protein                            160   4e-43   
gb|KHN16959.1|  ABC transporter G family member 14                      161   4e-43   
gb|KHN08925.1|  ABC transporter G family member 9                       161   4e-43   
ref|XP_003526081.1|  PREDICTED: ABC transporter G family member 9...    161   4e-43   
ref|XP_009631041.1|  PREDICTED: ABC transporter G family member 1...    162   4e-43   
ref|XP_010105155.1|  ABC transporter G family member 25                 161   5e-43   
ref|XP_006359961.1|  PREDICTED: ABC transporter G family member 1...    161   5e-43   
ref|XP_004293103.1|  PREDICTED: ABC transporter G family member 9       161   5e-43   
ref|XP_010478591.1|  PREDICTED: ABC transporter G family member 14      161   6e-43   
ref|XP_003547739.1|  PREDICTED: ABC transporter G family member 1...    161   8e-43   
gb|KDO83898.1|  hypothetical protein CISIN_1g0057542mg                  156   8e-43   
ref|XP_006841289.1|  hypothetical protein AMTR_s00134p00069640          160   8e-43   
gb|KHG01243.1|  ABC transporter G family member 9                       160   8e-43   
ref|XP_009604112.1|  PREDICTED: ABC transporter G family member 25      161   8e-43   
ref|XP_007156346.1|  hypothetical protein PHAVU_003G278800g             160   8e-43   
ref|XP_009586692.1|  PREDICTED: ABC transporter G family member 2...    160   9e-43   
ref|XP_009768130.1|  PREDICTED: ABC transporter G family member 2...    160   1e-42   
ref|XP_007149612.1|  hypothetical protein PHAVU_005G084300g             160   1e-42   
ref|XP_002270533.2|  PREDICTED: ABC transporter G family member 14      160   1e-42   
ref|XP_010668407.1|  PREDICTED: ABC transporter G family member 2...    156   1e-42   
ref|XP_006434601.1|  hypothetical protein CICLE_v10003388mg             156   1e-42   
ref|XP_004134251.1|  PREDICTED: ABC transporter G family member 9...    160   2e-42   
ref|XP_009145231.1|  PREDICTED: ABC transporter G family member 1...    160   2e-42   
gb|KDP37810.1|  hypothetical protein JCGZ_06712                         160   2e-42   
emb|CDY47690.1|  BnaCnng15320D                                          160   2e-42   
ref|XP_007019995.1|  ATP-binding casette family G25                     160   2e-42   
emb|CAN70956.1|  hypothetical protein VITISV_028138                     160   2e-42   
gb|KJB51502.1|  hypothetical protein B456_008G219500                    159   2e-42   
ref|XP_009769371.1|  PREDICTED: ABC transporter G family member 25      159   2e-42   
ref|XP_002304113.2|  hypothetical protein POPTR_0003s03650g             159   2e-42   
ref|XP_010324497.1|  PREDICTED: ABC transporter G family member 1...    159   3e-42   
ref|XP_011013139.1|  PREDICTED: ABC transporter G family member 1...    159   3e-42   
ref|XP_009802424.1|  PREDICTED: ABC transporter G family member 1...    159   3e-42   
ref|XP_010324495.1|  PREDICTED: ABC transporter G family member 1...    159   3e-42   
ref|XP_002534493.1|  ATP-binding cassette transporter, putative         159   3e-42   
ref|XP_010676724.1|  PREDICTED: ABC transporter G family member 14      159   3e-42   
gb|KEH19433.1|  white-brown-complex ABC transporter family protein      159   3e-42   
ref|XP_010518955.1|  PREDICTED: ABC transporter G family member 14      159   3e-42   
emb|CDP16843.1|  unnamed protein product                                159   3e-42   
ref|XP_010324496.1|  PREDICTED: ABC transporter G family member 1...    159   3e-42   
ref|XP_010499718.1|  PREDICTED: ABC transporter G family member 1...    159   4e-42   
gb|KHG20314.1|  ABC transporter G family member 14                      159   4e-42   
gb|KJB62742.1|  hypothetical protein B456_009G433300                    159   4e-42   
gb|KDP43365.1|  hypothetical protein JCGZ_25470                         159   4e-42   
ref|XP_010275138.1|  PREDICTED: ABC transporter G family member 14      159   4e-42   
ref|XP_007153314.1|  hypothetical protein PHAVU_003G024700g             159   4e-42   
ref|XP_009114967.1|  PREDICTED: ABC transporter G family member 14      159   5e-42   
emb|CDY36670.1|  BnaCnng07720D                                          155   5e-42   
gb|EEC80946.1|  hypothetical protein OsI_23653                          157   5e-42   
ref|XP_006473186.1|  PREDICTED: ABC transporter G family member 2...    159   5e-42   
gb|AAG50724.1|AC079041_17  ABC transporter, putative                    158   5e-42   
emb|CDP05875.1|  unnamed protein product                                158   5e-42   
emb|CDX96366.1|  BnaA07g29770D                                          155   5e-42   
ref|XP_004512314.1|  PREDICTED: ABC transporter G family member 1...    158   6e-42   
ref|NP_564383.1|  ABC transporter G family member 14                    158   6e-42   
ref|XP_007221425.1|  hypothetical protein PRUPE_ppa016652mg             153   6e-42   
gb|KDP29341.1|  hypothetical protein JCGZ_18262                         158   6e-42   
ref|XP_006430907.1|  hypothetical protein CICLE_v10011273mg             158   7e-42   
ref|XP_003555426.1|  PREDICTED: ABC transporter G family member 2...    158   7e-42   
gb|KDO72270.1|  hypothetical protein CISIN_1g039221mg                   158   7e-42   
ref|XP_006482405.1|  PREDICTED: ABC transporter G family member 1...    158   8e-42   
gb|EPS69022.1|  hypothetical protein M569_05746                         157   8e-42   
gb|AES95438.2|  white-brown-complex ABC transporter family protein      158   9e-42   
ref|XP_004252106.1|  PREDICTED: ABC transporter G family member 9...    160   9e-42   
emb|CAB43874.1|  putative protei                                        157   9e-42   
ref|XP_003535544.1|  PREDICTED: ABC transporter G family member 2...    158   9e-42   
ref|XP_003612480.1|  ABC transporter-like protein                       158   1e-41   
ref|NP_001266819.1|  uncharacterized protein LOC101061013               150   1e-41   
ref|XP_011071699.1|  PREDICTED: ABC transporter G family member 1...    157   1e-41   
ref|XP_006303926.1|  hypothetical protein CARUB_v10008545mg             157   1e-41   
gb|KJB25132.1|  hypothetical protein B456_004G178100                    157   1e-41   
emb|CDY12299.1|  BnaA09g24990D                                          158   1e-41   
gb|KFK44944.1|  hypothetical protein AALP_AA1G323000                    157   1e-41   
ref|XP_007046353.1|  ABC-2 type transporter family protein              158   1e-41   
ref|XP_002325552.2|  ABC transporter family protein                     157   1e-41   
gb|KHG16348.1|  ABC transporter G family member 14                      157   1e-41   
ref|XP_007040852.1|  ATP-binding cassette 14                            157   1e-41   
ref|XP_006390723.1|  hypothetical protein EUTSA_v10018591mg             155   1e-41   
ref|XP_004291249.1|  PREDICTED: ABC transporter G family member 14      157   1e-41   
gb|ACN85155.1|  ABC transporter-like protein                            157   1e-41   
ref|XP_007158067.1|  hypothetical protein PHAVU_002G121200g             157   2e-41   
ref|NP_001058033.1|  Os06g0607700                                       157   2e-41   
ref|XP_006300374.1|  hypothetical protein CARUB_v10022459mg             153   2e-41   
gb|EPS63929.1|  hypothetical protein M569_10851                         157   2e-41   
ref|XP_004236984.1|  PREDICTED: ABC transporter G family member 21      157   2e-41   
ref|XP_008237152.1|  PREDICTED: ABC transporter G family member 25      157   2e-41   
ref|XP_006366061.1|  PREDICTED: ABC transporter G family member 2...    157   2e-41   
ref|XP_009406088.1|  PREDICTED: ABC transporter G family member 2...    156   2e-41   
emb|CDP00551.1|  unnamed protein product                                157   2e-41   
ref|XP_003517105.2|  PREDICTED: ABC transporter G family member 1...    157   2e-41   
ref|XP_011005152.1|  PREDICTED: ABC transporter G family member 2...    157   2e-41   
gb|KHN28317.1|  ABC transporter G family member 14                      157   2e-41   
ref|XP_008452359.1|  PREDICTED: ABC transporter G family member 9...    156   2e-41   
ref|XP_008791161.1|  PREDICTED: ABC transporter G family member 2...    156   2e-41   
ref|XP_006415305.1|  hypothetical protein EUTSA_v10007027mg             157   2e-41   
emb|CDX72849.1|  BnaC06g32970D                                          157   2e-41   
gb|KCW69055.1|  hypothetical protein EUGRSUZ_F02609                     155   3e-41   
ref|XP_009406087.1|  PREDICTED: ABC transporter G family member 2...    156   3e-41   
ref|XP_003537708.1|  PREDICTED: ABC transporter G family member 1...    156   3e-41   
ref|XP_011001789.1|  PREDICTED: ABC transporter G family member 2...    157   3e-41   
ref|XP_009105860.1|  PREDICTED: ABC transporter G family member 25      156   3e-41   
ref|XP_011028515.1|  PREDICTED: ABC transporter G family member 1...    156   3e-41   
ref|XP_011077437.1|  PREDICTED: ABC transporter G family member 21      156   3e-41   
ref|XP_006385164.1|  ABC transporter family protein                     156   3e-41   
ref|XP_010678675.1|  PREDICTED: ABC transporter G family member 25      156   3e-41   
ref|XP_009127887.1|  PREDICTED: ABC transporter G family member 2...    156   4e-41   
ref|XP_002893685.1|  abc transporter family protein                     156   4e-41   
gb|AAG52231.1|AC021665_14  putative ABC transporter; 60211-54925        155   4e-41   
ref|XP_010251517.1|  PREDICTED: ABC transporter G family member 1...    156   4e-41   
dbj|BAH57205.1|  AT1G71960                                              155   4e-41   
ref|XP_008452272.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    155   5e-41   
ref|XP_002888855.1|  hypothetical protein ARALYDRAFT_476326             155   5e-41   
ref|XP_010111780.1|  ABC transporter G family member 14                 155   5e-41   
ref|NP_565030.1|  ABC transporter G family member 25                    155   6e-41   
gb|AAK92745.1|  putative ABC transporter protein                        155   7e-41   
ref|XP_010064794.1|  PREDICTED: ABC transporter G family member 25      156   8e-41   
ref|XP_010415916.1|  PREDICTED: ABC transporter G family member 2...    155   8e-41   
ref|XP_008243143.1|  PREDICTED: ABC transporter G family member 21      155   8e-41   
gb|KJB25133.1|  hypothetical protein B456_004G178100                    155   9e-41   
ref|XP_011074938.1|  PREDICTED: ABC transporter G family member 2...    155   9e-41   
ref|XP_004297158.1|  PREDICTED: ABC transporter G family member 21      155   1e-40   
gb|EYU22839.1|  hypothetical protein MIMGU_mgv1a002620mg                155   1e-40   
gb|KGN56224.1|  hypothetical protein Csa_3G102320                       154   1e-40   
ref|XP_006663256.1|  PREDICTED: ABC transporter G family member 2...    154   1e-40   
ref|XP_006594328.1|  PREDICTED: ABC transporter G family member 9...    154   1e-40   
ref|XP_007225163.1|  hypothetical protein PRUPE_ppa002351mg             155   1e-40   
emb|CBI18157.3|  unnamed protein product                                154   1e-40   
ref|XP_004134252.1|  PREDICTED: ABC transporter G family member 9...    154   1e-40   
emb|CDX82199.1|  BnaC02g20910D                                          155   1e-40   
gb|EYU28941.1|  hypothetical protein MIMGU_mgv1a002356mg                155   1e-40   
ref|XP_009152126.1|  PREDICTED: ABC transporter G family member 21      154   1e-40   
ref|XP_003541547.2|  PREDICTED: ABC transporter G family member 9...    154   1e-40   
ref|XP_002268373.1|  PREDICTED: ABC transporter G family member 25      154   1e-40   
ref|XP_008221126.1|  PREDICTED: ABC transporter G family member 14      154   2e-40   
gb|KHN46331.1|  ABC transporter G family member 9                       154   2e-40   
emb|CDY48079.1|  BnaA06g33490D                                          154   2e-40   
emb|CDY03668.1|  BnaA02g15690D                                          154   2e-40   
gb|KEH43567.1|  white-brown-complex ABC transporter family protein      154   2e-40   
ref|XP_006656226.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    154   2e-40   
ref|XP_002314895.1|  hypothetical protein POPTR_0010s14180g             154   2e-40   
ref|XP_009416919.1|  PREDICTED: ABC transporter G family member 2...    154   3e-40   
ref|NP_189190.2|  ABC transporter G family member 21                    152   3e-40   
ref|XP_010471215.1|  PREDICTED: ABC transporter G family member 2...    154   3e-40   
ref|XP_009593646.1|  PREDICTED: ABC transporter G family member 21      153   3e-40   
ref|XP_007143780.1|  hypothetical protein PHAVU_007G100900g             154   3e-40   
gb|KFK41612.1|  hypothetical protein AALP_AA2G151000                    153   3e-40   
ref|XP_006484387.1|  PREDICTED: ABC transporter G family member 2...    154   4e-40   



>ref|XP_008241115.1| PREDICTED: ABC transporter G family member 22 isoform X3 [Prunus 
mume]
 ref|XP_008241116.1| PREDICTED: ABC transporter G family member 22 isoform X3 [Prunus 
mume]
Length=603

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  136  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  195

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  196  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  255

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVSIPSEL DKVQ  NS+   TR NGKPSPA+VHEYLV  YET
Sbjct  256  PAEFLLDLANGNINDVSIPSELEDKVQMGNSEAADTR-NGKPSPAVVHEYLVEAYET  311



>ref|XP_011042541.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Populus 
euphratica]
Length=693

 Score =   288 bits (737),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGC+PLIAMN
Sbjct  340  DIAEGGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMLYFSSIGCNPLIAMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ WNS  E    NGKPSPA+VHEYLV  YET
Sbjct  400  PAEFLLDLANGNINDVSVPSELEDKVQIWNSDAE--MRNGKPSPAVVHEYLVEAYET  454



>ref|XP_009348556.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Pyrus x bretschneideri]
Length=600

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  133  LERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQMLQ  192

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLI+MN
Sbjct  193  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLISMN  252

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL DKVQ  NS+   TR NGKPSPA+V EYLV CYET
Sbjct  253  PAEFLLDLANGNLNDVSVPSELEDKVQMGNSEAADTR-NGKPSPAVVQEYLVECYET  308



>ref|XP_008241114.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Prunus 
mume]
Length=748

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  281  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  340

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  341  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  400

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVSIPSEL DKVQ  NS+   TR NGKPSPA+VHEYLV  YET
Sbjct  401  PAEFLLDLANGNINDVSIPSELEDKVQMGNSEAADTR-NGKPSPAVVHEYLVEAYET  456



>ref|XP_008241111.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Prunus 
mume]
 ref|XP_008241112.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Prunus 
mume]
 ref|XP_008241113.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Prunus 
mume]
Length=749

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  282  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  341

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  342  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  401

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVSIPSEL DKVQ  NS+   TR NGKPSPA+VHEYLV  YET
Sbjct  402  PAEFLLDLANGNINDVSIPSELEDKVQMGNSEAADTR-NGKPSPAVVHEYLVEAYET  457



>ref|XP_011042537.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Populus 
euphratica]
 ref|XP_011042538.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Populus 
euphratica]
 ref|XP_011042539.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Populus 
euphratica]
 ref|XP_011042540.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Populus 
euphratica]
Length=744

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGC+PLIAMN
Sbjct  340  DIAEGGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMLYFSSIGCNPLIAMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ WNS  E    NGKPSPA+VHEYLV  YET
Sbjct  400  PAEFLLDLANGNINDVSVPSELEDKVQIWNSDAE--MRNGKPSPAVVHEYLVEAYET  454



>ref|XP_007204637.1| hypothetical protein PRUPE_ppa001882mg [Prunus persica]
 gb|EMJ05836.1| hypothetical protein PRUPE_ppa001882mg [Prunus persica]
Length=748

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  281  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  340

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  341  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  400

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVSIPSEL DKVQ  NS+   TR NGKPSPA+VH+YLV  YET
Sbjct  401  PAEFLLDLANGNINDVSIPSELEDKVQMGNSEAADTR-NGKPSPAVVHDYLVEAYET  456



>gb|KDO70711.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=435

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  153  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  212

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAMAYFSSIGCSP IAMN
Sbjct  213  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMN  272

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YET
Sbjct  273  PAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYET  327



>ref|XP_010248083.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010248090.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Nelumbo 
nucifera]
Length=754

 Score =   287 bits (734),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  289  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLH  348

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  349  DIAEAGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  408

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  N + E TR NGKPSP +VHEYLV  YET
Sbjct  409  PAEFLLDLANGNINDVSVPSELEDKVQMGNLETE-TR-NGKPSPVVVHEYLVEAYET  463



>gb|KDO70708.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=513

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  153  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  212

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAMAYFSSIGCSP IAMN
Sbjct  213  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMN  272

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YET
Sbjct  273  PAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYET  327



>gb|KDO70709.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
 gb|KDO70710.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=523

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  153  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  212

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAMAYFSSIGCSP IAMN
Sbjct  213  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMN  272

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YET
Sbjct  273  PAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYET  327



>gb|KDO70707.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=567

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  153  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  212

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAMAYFSSIGCSP IAMN
Sbjct  213  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMN  272

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YET
Sbjct  273  PAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYET  327



>ref|XP_010110448.1| ABC transporter G family member 22 [Morus notabilis]
 gb|EXC26390.1| ABC transporter G family member 22 [Morus notabilis]
Length=761

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 166/177 (94%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  295  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLH  354

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  355  DIAEAGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  414

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  NS  + TR NGKPSPA+VHEYLV  YET
Sbjct  415  PAEFLLDLANGNINDVSLPSELEDKVQMENSDAD-TR-NGKPSPAVVHEYLVEAYET  469



>gb|KDO70706.1| hypothetical protein CISIN_1g0045372mg [Citrus sinensis]
Length=583

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  117  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  176

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAMAYFSSIGCSP IAMN
Sbjct  177  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMN  236

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YET
Sbjct  237  PAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYET  291



>ref|XP_009348549.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Pyrus x bretschneideri]
Length=747

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQMLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLI+MN
Sbjct  340  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLISMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL DKVQ  NS+   TR NGKPSPA+V EYLV CYET
Sbjct  400  PAEFLLDLANGNLNDVSVPSELEDKVQMGNSEAADTR-NGKPSPAVVQEYLVECYET  455



>ref|XP_011467164.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=747

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  281  LERCQDTMIGGTFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  340

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  341  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  400

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  NS E  TR NGKPSPA+VHEYLV  YET
Sbjct  401  PAEFLLDLANGNINDVSVPSELEDKVQMENS-EADTR-NGKPSPAVVHEYLVEAYET  455



>gb|KDO70704.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
 gb|KDO70705.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=619

 Score =   281 bits (720),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  153  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  212

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAMAYFSSIGCSP IAMN
Sbjct  213  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMN  272

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YET
Sbjct  273  PAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYET  327



>ref|XP_004303381.2| PREDICTED: ABC transporter G family member 22 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=781

 Score =   285 bits (729),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  315  LERCQDTMIGGTFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  374

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  375  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  434

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  NS E  TR NGKPSPA+VHEYLV  YET
Sbjct  435  PAEFLLDLANGNINDVSVPSELEDKVQMENS-EADTR-NGKPSPAVVHEYLVEAYET  489



>ref|XP_004228604.1| PREDICTED: ABC transporter G family member 22-like [Solanum lycopersicum]
 ref|XP_010315863.1| PREDICTED: ABC transporter G family member 22-like [Solanum lycopersicum]
Length=749

 Score =   284 bits (727),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V+ILH
Sbjct  283  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVEILH  342

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFS+IGC+PLI+MN
Sbjct  343  DIAEAGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMDYFSTIGCTPLISMN  402

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL DKVQ  NS  E TR NGKPSPAIVHEYLV  YET
Sbjct  403  PAEFLLDLANGNLNDVSVPSELEDKVQIGNSDTE-TR-NGKPSPAIVHEYLVEAYET  457



>gb|KDP36071.1| hypothetical protein JCGZ_08715 [Jatropha curcas]
Length=749

 Score =   284 bits (727),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  283  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  342

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKG+LLY+GKASEAM YFSSIGC+PLIAMN
Sbjct  343  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGNLLYFGKASEAMTYFSSIGCNPLIAMN  402

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  NS  E TR NGKPSPA+VHEYLV  YET
Sbjct  403  PAEFLLDLANGNINDVSVPSELDDKVQMGNSDNE-TR-NGKPSPAVVHEYLVEAYET  457



>ref|XP_009796796.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Nicotiana sylvestris]
Length=608

 Score =   281 bits (718),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR+V+ILH
Sbjct  142  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRMVEILH  201

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFS+IGCSPLI+MN
Sbjct  202  DIAETGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSAIGCSPLISMN  261

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL D+VQ  NS  E    NGKP+P +VHEYLV  YET
Sbjct  262  PAEFLLDLANGNLNDVSVPSELEDRVQIGNSDRET--GNGKPTPIVVHEYLVEAYET  316



>ref|XP_009622617.1| PREDICTED: ABC transporter G family member 22-like [Nicotiana 
tomentosiformis]
Length=744

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 164/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR+V+ILH
Sbjct  278  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRMVEILH  337

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFS+IGCSPLI+MN
Sbjct  338  DIAEAGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSAIGCSPLISMN  397

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL DKVQ  NS  E    NGKP+P +VHEYLV  YET
Sbjct  398  PAEFLLDLANGNLNDVSVPSELEDKVQIGNSDRET--GNGKPTPIVVHEYLVEAYET  452



>gb|KHN10345.1| ABC transporter G family member 27 [Glycine soja]
Length=673

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  272  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  331

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YF SIGCSPLI+MN
Sbjct  332  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMTYFQSIGCSPLISMN  391

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  N++ E    NGKPSPA+VHEYLV  YET
Sbjct  392  PAEFLLDLANGNINDVSLPSELEDKVQMGNAEAETL--NGKPSPAVVHEYLVEAYET  446



>ref|XP_006348422.1| PREDICTED: ABC transporter G family member 22-like [Solanum tuberosum]
Length=751

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V+ILH
Sbjct  285  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVEILH  344

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFS+IGC+PLI MN
Sbjct  345  DIAEAGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMDYFSTIGCTPLIPMN  404

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL DKVQ  NS  E TR NGKPSPAIVHEYLV  YET
Sbjct  405  PAEFLLDLANGNLNDVSVPSELEDKVQIGNSDTE-TR-NGKPSPAIVHEYLVEAYET  459



>ref|XP_002322764.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEF04525.1| ABC transporter family protein [Populus trichocarpa]
Length=744

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGC+PLIAMN
Sbjct  340  DIAEGGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMLYFSSIGCNPLIAMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  NS+ E TR NGKPSPA+VHEYLV  YET
Sbjct  400  PAEFLLDLANGNINDVSVPSELEDKVQIGNSEAE-TR-NGKPSPAVVHEYLVEAYET  454



>ref|XP_008392009.1| PREDICTED: ABC transporter G family member 22-like [Malus domestica]
Length=747

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQMLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKAS AM YFSSIGCSPLI+MN
Sbjct  340  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASXAMVYFSSIGCSPLISMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL DKVQ  NS+   TR NGKPSPA+V EYLV CYET
Sbjct  400  PAEFLLDLANGNLNDVSVPSELEDKVQMGNSEAADTR-NGKPSPAVVQEYLVECYET  455



>gb|KJB36224.1| hypothetical protein B456_006G147000 [Gossypium raimondii]
Length=611

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L 
Sbjct  145  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQ  204

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTVITTIHQPSSRLFHKFDKL+LLGKGS LY+G+ASEAMAYFSSIGCSPLIAMN
Sbjct  205  NIAEAGKTVITTIHQPSSRLFHKFDKLVLLGKGSSLYFGRASEAMAYFSSIGCSPLIAMN  264

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL DKVQ  NS+ E TRN  KP PA+VHEYLV  YE+
Sbjct  265  PAEFLLDLANGNINDISVPSELEDKVQMGNSETE-TRNE-KPPPAVVHEYLVEAYES  319



>ref|XP_006430004.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
 gb|ESR43244.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
Length=583

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V +L 
Sbjct  117  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQMLQ  176

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSP IAMN
Sbjct  177  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMTYFSSIGCSPQIAMN  236

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YET
Sbjct  237  PAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYET  291



>ref|XP_009362644.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Pyrus x bretschneideri]
Length=611

 Score =   278 bits (711),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGS VRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRI  +L 
Sbjct  144  LERCQDTMIGGSLVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIGQMLQ  203

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLI MN
Sbjct  204  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLITMN  263

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL D+VQ  NS+ + TR NGKPSPA+VHEYLV  YET
Sbjct  264  PAEFLLDLANGNLNDVSVPSELEDEVQMGNSEADDTR-NGKPSPAVVHEYLVESYET  319



>ref|XP_003519092.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Glycine 
max]
Length=743

 Score =   281 bits (719),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  277  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  336

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YF SIGCSPLI+MN
Sbjct  337  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMTYFQSIGCSPLISMN  396

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  N++ E    NGKPSPA+VHEYLV  YET
Sbjct  397  PAEFLLDLANGNINDVSLPSELEDKVQMGNAEAETL--NGKPSPAVVHEYLVEAYET  451



>emb|CDP10560.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV++L 
Sbjct  262  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVELLQ  321

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFHKFDKLILLGKG+LLY+GKA+EAM YFSS+GCSPLIAMN
Sbjct  322  DIAEAGKTVITTIHQPSSRLFHKFDKLILLGKGNLLYFGKAAEAMVYFSSVGCSPLIAMN  381

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL D+VQ  N++ E TR NG+PSP IVHEYLV  YET
Sbjct  382  PAEFLLDLANGNLNDVSVPSELEDRVQLGNTETE-TR-NGRPSPTIVHEYLVESYET  436



>ref|XP_006373817.1| hypothetical protein POPTR_0016s06620g [Populus trichocarpa]
 gb|ERP51614.1| hypothetical protein POPTR_0016s06620g [Populus trichocarpa]
Length=720

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGC+PLIAMN
Sbjct  340  DIAEGGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMLYFSSIGCNPLIAMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  NS+ E TR NGKPSPA+VHEYLV  YET
Sbjct  400  PAEFLLDLANGNINDVSVPSELEDKVQIGNSEAE-TR-NGKPSPAVVHEYLVEAYET  454



>ref|XP_009796795.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Nicotiana sylvestris]
Length=744

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR+V+ILH
Sbjct  278  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRMVEILH  337

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFS+IGCSPLI+MN
Sbjct  338  DIAETGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSAIGCSPLISMN  397

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL D+VQ  NS  E    NGKP+P +VHEYLV  YET
Sbjct  398  PAEFLLDLANGNLNDVSVPSELEDRVQIGNSDRET--GNGKPTPIVVHEYLVEAYET  452



>ref|XP_006481645.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Citrus sinensis]
 ref|XP_006481646.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Citrus sinensis]
Length=746

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V +L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQMLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAMAYFSSIGCSP IAMN
Sbjct  340  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YET
Sbjct  400  PAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYET  454



>ref|XP_006588894.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Glycine max]
Length=705

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  312  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  371

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASE M YF SIGCSPLI+MN
Sbjct  372  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASETMTYFQSIGCSPLISMN  431

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  N++ E    NGKPSPA+VHEYLV  YET
Sbjct  432  PAEFLLDLANGNINDVSLPSELEDKVQMGNAEAE--TQNGKPSPAVVHEYLVEAYET  486



>ref|XP_010653240.1| PREDICTED: ABC transporter G family member 22 isoform X3 [Vitis 
vinifera]
Length=599

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LDRCQDTMIGGSFVRGVSGGERKRV IGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  133  LDRCQDTMIGGSFVRGVSGGERKRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLH  192

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKG+LLY+GKAS  M YFSSIGCSPLI MN
Sbjct  193  DIAEAGKTVLTTIHQPSSRLFHKFDKLILLGKGNLLYFGKASGTMEYFSSIGCSPLITMN  252

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVSIPSEL DKVQT +S+ E TR NGKPSPA VHEYLV  YET
Sbjct  253  PAEFLLDLANGNLNDVSIPSELEDKVQTEHSETE-TR-NGKPSPADVHEYLVEAYET  307



>ref|XP_006575266.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Glycine 
max]
Length=782

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  316  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  375

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YF SIGCSPLI+MN
Sbjct  376  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMTYFQSIGCSPLISMN  435

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  N++ E    NGKPSPA+VHEYLV  YET
Sbjct  436  PAEFLLDLANGNINDVSLPSELEDKVQMGNAEAETL--NGKPSPAVVHEYLVEAYET  490



>ref|XP_006430002.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
 gb|ESR43242.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
Length=650

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V +L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQMLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSP IAMN
Sbjct  340  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMTYFSSIGCSPQIAMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YET
Sbjct  400  PAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYET  454



>ref|XP_007028066.1| White-brown-complex ABC transporter family isoform 3 [Theobroma 
cacao]
 gb|EOY08568.1| White-brown-complex ABC transporter family isoform 3 [Theobroma 
cacao]
Length=671

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEA+ YFSSIGCSPLIAMN
Sbjct  340  DIAEAGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAIVYFSSIGCSPLIAMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL DKVQ  NS+ E TR NGKP PA+VHEYLV  YE+
Sbjct  400  PAEFLLDLANGNINDISVPSELEDKVQMENSEAE-TR-NGKPPPAVVHEYLVEAYES  454



>ref|XP_010557969.1| PREDICTED: ABC transporter G family member 22-like [Tarenaya 
hassleriana]
Length=750

 Score =   280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRV IGNEIIINPSLLFLDEPTSGLDSTTALR + +LH
Sbjct  286  LERCQDTMIGGSFVRGVSGGERKRVSIGNEIIINPSLLFLDEPTSGLDSTTALRTIQMLH  345

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  346  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  405

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+SIPSEL DKVQ  NS  E    +GKPSPA+VHEYLV  YET
Sbjct  406  PAEFLLDLANGNINDISIPSELEDKVQVGNSGRET--QDGKPSPAVVHEYLVEAYET  460



>ref|XP_008359521.1| PREDICTED: ABC transporter G family member 22-like [Malus domestica]
Length=747

 Score =   279 bits (714),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRI  +L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIGQMLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFS IGCSPLIAMN
Sbjct  340  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSCIGCSPLIAMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL DKVQ  +S+ + TR NGKPSPA+VHEYLV  YET
Sbjct  400  PAEFLLDLANGNLNDVSVPSELEDKVQMGSSEADDTR-NGKPSPAVVHEYLVESYET  455



>ref|XP_003535833.2| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Glycine max]
 gb|KHN05752.1| ABC transporter G family member 22 [Glycine soja]
Length=778

 Score =   280 bits (715),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  312  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  371

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASE M YF SIGCSPLI+MN
Sbjct  372  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASETMTYFQSIGCSPLISMN  431

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  N++ E    NGKPSPA+VHEYLV  YET
Sbjct  432  PAEFLLDLANGNINDVSLPSELEDKVQMGNAEAET--QNGKPSPAVVHEYLVEAYET  486



>gb|KJB36225.1| hypothetical protein B456_006G147000 [Gossypium raimondii]
Length=752

 Score =   279 bits (713),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L 
Sbjct  286  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQ  345

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTVITTIHQPSSRLFHKFDKL+LLGKGS LY+G+ASEAMAYFSSIGCSPLIAMN
Sbjct  346  NIAEAGKTVITTIHQPSSRLFHKFDKLVLLGKGSSLYFGRASEAMAYFSSIGCSPLIAMN  405

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL DKVQ  NS+ E TRN  KP PA+VHEYLV  YE+
Sbjct  406  PAEFLLDLANGNINDISVPSELEDKVQMGNSETE-TRNE-KPPPAVVHEYLVEAYES  460



>ref|XP_006430003.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
 gb|ESR43243.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
Length=746

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V +L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQMLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSP IAMN
Sbjct  340  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMTYFSSIGCSPQIAMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YET
Sbjct  400  PAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYET  454



>ref|XP_009362643.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Pyrus x bretschneideri]
Length=746

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGS VRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRI  +L 
Sbjct  279  LERCQDTMIGGSLVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIGQMLQ  338

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLI MN
Sbjct  339  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLITMN  398

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL D+VQ  NS+ + TR NGKPSPA+VHEYLV  YET
Sbjct  399  PAEFLLDLANGNLNDVSVPSELEDEVQMGNSEADDTR-NGKPSPAVVHEYLVESYET  454



>ref|XP_004497624.1| PREDICTED: ABC transporter G family member 22-like [Cicer arietinum]
Length=745

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+IV +L 
Sbjct  278  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKIVQMLQ  337

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKA+EAM YF SIGCSPLI+MN
Sbjct  338  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKAAEAMNYFQSIGCSPLISMN  397

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  N++ E T  NGKPSPA+VHEYLV  YE+
Sbjct  398  PAEFLLDLANGNINDVSVPSELDDKVQMGNAEVETT-YNGKPSPAVVHEYLVEAYES  453



>ref|XP_007028065.1| White-brown-complex ABC transporter family isoform 2 [Theobroma 
cacao]
 gb|EOY08567.1| White-brown-complex ABC transporter family isoform 2 [Theobroma 
cacao]
Length=746

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L 
Sbjct  280  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEA+ YFSSIGCSPLIAMN
Sbjct  340  DIAEAGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAIVYFSSIGCSPLIAMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL DKVQ  NS+ E TR NGKP PA+VHEYLV  YE+
Sbjct  400  PAEFLLDLANGNINDISVPSELEDKVQMENSEAE-TR-NGKPPPAVVHEYLVEAYES  454



>gb|ACU17386.1| unknown [Glycine max]
Length=219

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 155/170 (91%), Gaps = 2/170 (1%)
 Frame = +2

Query  23   MIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGK  202
            MIGGSFVRGVSGGERKRVC GNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGK
Sbjct  1    MIGGSFVRGVSGGERKRVCTGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGK  60

Query  203  TVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMNPAEFLLD  382
            TV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YF SIGCSPLI+MNPAEFLLD
Sbjct  61   TVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMTYFQSIGCSPLISMNPAEFLLD  120

Query  383  LANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            LANGNINDVS+PSEL DKVQ  N++ E    NGKPSPA+VHEYLV  YET
Sbjct  121  LANGNINDVSLPSELEDKVQMGNAEAETL--NGKPSPAVVHEYLVEAYET  168



>ref|XP_009362642.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Pyrus x bretschneideri]
Length=747

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGS VRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRI  +L 
Sbjct  280  LERCQDTMIGGSLVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIGQMLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLI MN
Sbjct  340  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLITMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL D+VQ  NS+ + TR NGKPSPA+VHEYLV  YET
Sbjct  400  PAEFLLDLANGNLNDVSVPSELEDEVQMGNSEADDTR-NGKPSPAVVHEYLVESYET  455



>ref|XP_011077784.1| PREDICTED: ABC transporter G family member 22 [Sesamum indicum]
Length=754

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVD LH
Sbjct  288  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDTLH  347

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            EIA+AGKTVITTIHQPSSRLF KFDKLILLGKGSLLYYGKASEAM YFSSIGCSPLIAMN
Sbjct  348  EIAEAGKTVITTIHQPSSRLFLKFDKLILLGKGSLLYYGKASEAMVYFSSIGCSPLIAMN  407

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEF+LDLANGN+ D+S+PSEL DKVQ  + + E    NGKP+PA+VHEYLV  YET
Sbjct  408  PAEFMLDLANGNVTDISVPSELEDKVQMGDPEAEI--KNGKPAPAVVHEYLVETYET  462



>ref|XP_006381927.1| hypothetical protein POPTR_0006s21400g [Populus trichocarpa]
 gb|ERP59724.1| hypothetical protein POPTR_0006s21400g [Populus trichocarpa]
Length=538

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+ V +L 
Sbjct  117  LERCQDTVIGGSFVRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKTVQLLQ  176

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++A+ GKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GK+SEAM YFSSIGC+PLIAMN
Sbjct  177  DMAEGGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKSSEAMLYFSSIGCNPLIAMN  236

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  NS  +  + NGKPSPA+VHEYLV  YET
Sbjct  237  PAEFLLDLANGNINDVSVPSELDDKVQIVNS--DAGKRNGKPSPAVVHEYLVEAYET  291



>gb|AIU41652.1| ABC transporter family protein [Hevea brasiliensis]
Length=738

 Score =   277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTALRIV +L 
Sbjct  279  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSVLFLDEPTSGLDSTTALRIVQMLQ  338

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSS+GC+PLIAMN
Sbjct  339  DIAEAGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMPYFSSVGCNPLIAMN  398

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLL+LANGNINDVS+PSEL D+VQ  NS  E TR NGKPSPA+VH+YLV  YET
Sbjct  399  PAEFLLELANGNINDVSVPSELEDRVQMENSDNE-TR-NGKPSPAVVHDYLVEAYET  453



>ref|XP_002524100.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF38310.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=749

 Score =   277 bits (708),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  282  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  341

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASE M YFSSIGC+PLIAMN
Sbjct  342  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASETMPYFSSIGCNPLIAMN  401

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL D+VQ  NS  +    NGKPSP++VHEYLV  YET
Sbjct  402  PAEFLLDLANGNINDVSVPSELEDRVQMGNSDIDT--GNGKPSPSVVHEYLVEAYET  456



>emb|CBI39105.3| unnamed protein product [Vitis vinifera]
Length=738

 Score =   276 bits (706),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LDRCQDTMIGGSFVRGVSGGERKRV IGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  272  LDRCQDTMIGGSFVRGVSGGERKRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLH  331

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKG+LLY+GKAS  M YFSSIGCSPLI MN
Sbjct  332  DIAEAGKTVLTTIHQPSSRLFHKFDKLILLGKGNLLYFGKASGTMEYFSSIGCSPLITMN  391

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVSIPSEL DKVQT +S+ E TR NGKPSPA VHEYLV  YET
Sbjct  392  PAEFLLDLANGNLNDVSIPSELEDKVQTEHSETE-TR-NGKPSPADVHEYLVEAYET  446



>ref|XP_007145759.1| hypothetical protein PHAVU_007G265300g [Phaseolus vulgaris]
 gb|ESW17753.1| hypothetical protein PHAVU_007G265300g [Phaseolus vulgaris]
Length=745

 Score =   276 bits (707),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  279  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  338

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASE + YF SIGCSPLI+MN
Sbjct  339  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASETLTYFQSIGCSPLISMN  398

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL D+VQ  N++ E    NGKPSPA+VHEYLV  YET
Sbjct  399  PAEFLLDLANGNINDVSLPSELEDRVQMENAEAETP--NGKPSPAVVHEYLVEAYET  453



>ref|XP_007028064.1| White-brown-complex ABC transporter family isoform 1 [Theobroma 
cacao]
 gb|EOY08566.1| White-brown-complex ABC transporter family isoform 1 [Theobroma 
cacao]
Length=824

 Score =   278 bits (710),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L 
Sbjct  358  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQ  417

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEA+ YFSSIGCSPLIAMN
Sbjct  418  DIAEAGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAIVYFSSIGCSPLIAMN  477

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL DKVQ  NS+ E TR NGKP PA+VHEYLV  YE+
Sbjct  478  PAEFLLDLANGNINDISVPSELEDKVQMENSEAE-TR-NGKPPPAVVHEYLVEAYES  532



>ref|XP_010653238.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Vitis 
vinifera]
Length=748

 Score =   276 bits (707),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LDRCQDTMIGGSFVRGVSGGERKRV IGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  282  LDRCQDTMIGGSFVRGVSGGERKRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLH  341

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKG+LLY+GKAS  M YFSSIGCSPLI MN
Sbjct  342  DIAEAGKTVLTTIHQPSSRLFHKFDKLILLGKGNLLYFGKASGTMEYFSSIGCSPLITMN  401

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVSIPSEL DKVQT +S+ E TR NGKPSPA VHEYLV  YET
Sbjct  402  PAEFLLDLANGNLNDVSIPSELEDKVQTEHSETE-TR-NGKPSPADVHEYLVEAYET  456



>emb|CDY14079.1| BnaC02g01960D [Brassica napus]
Length=752

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALRI+ +LH
Sbjct  287  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRIIQMLH  346

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+G+LLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  347  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGNLLYFGKSSEALDYFSSIGCSPLIAMN  406

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  EP    GKPSPA+VHEYLV  YET
Sbjct  407  PAEFLLDLANGNINDISVPSELEDRVQVGNSDREP--RTGKPSPAVVHEYLVEAYET  461



>ref|XP_010653239.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Vitis 
vinifera]
Length=668

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LDRCQDTMIGGSFVRGVSGGERKRV IGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  282  LDRCQDTMIGGSFVRGVSGGERKRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLH  341

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKG+LLY+GKAS  M YFSSIGCSPLI MN
Sbjct  342  DIAEAGKTVLTTIHQPSSRLFHKFDKLILLGKGNLLYFGKASGTMEYFSSIGCSPLITMN  401

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVSIPSEL DKVQT +S+ E TR NGKPSPA VHEYLV  YET
Sbjct  402  PAEFLLDLANGNLNDVSIPSELEDKVQTEHSETE-TR-NGKPSPADVHEYLVEAYET  456



>gb|KHG09828.1| ABC transporter G family member 22 [Gossypium arboreum]
Length=609

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR +  L 
Sbjct  143  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTIQTLQ  202

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEA+ YFSSIGCSPLIAMN
Sbjct  203  DIAEVGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAIVYFSSIGCSPLIAMN  262

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ D+S+PSEL DKVQ  NS+ E    NGKP PA+VHEYLV  YE+
Sbjct  263  PAEFLLDLANGNLTDISVPSELEDKVQMENSETET--GNGKPPPAVVHEYLVEAYES  317



>gb|KJB16513.1| hypothetical protein B456_002G233500 [Gossypium raimondii]
Length=618

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR +  L 
Sbjct  154  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTIQTLQ  213

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEA+ YFSSIGCSPLIAMN
Sbjct  214  DIAEVGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAIFYFSSIGCSPLIAMN  273

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ D+S+PSEL DKVQ  NS+ E    NGKP PA+VHEYLV  YE+
Sbjct  274  PAEFLLDLANGNLTDISVPSELEDKVQMENSETET--GNGKPPPAVVHEYLVEAYES  328



>gb|KEH41804.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=580

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+IV +L 
Sbjct  117  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKIVQMLQ  176

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASE M YF SIGCSPLI+MN
Sbjct  177  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEVMNYFQSIGCSPLISMN  236

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  N+  E    +GKPSPA VHEYLV  YE+
Sbjct  237  PAEFLLDLANGNINDVSVPSELEDKVQIGNAAVET--YHGKPSPADVHEYLVEAYES  291



>gb|KJB16514.1| hypothetical protein B456_002G233500 [Gossypium raimondii]
Length=625

 Score =   271 bits (693),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR +  L 
Sbjct  161  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTIQTLQ  220

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEA+ YFSSIGCSPLIAMN
Sbjct  221  DIAEVGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAIFYFSSIGCSPLIAMN  280

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ D+S+PSEL DKVQ  NS+ E    NGKP PA+VHEYLV  YE+
Sbjct  281  PAEFLLDLANGNLTDISVPSELEDKVQMENSETET--GNGKPPPAVVHEYLVEAYES  335



>ref|XP_004161297.1| PREDICTED: ABC transporter G family member 22-like [Cucumis sativus]
Length=620

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGER+RV IGNEIIINPSLLFLDEPTSGLDSTTALRIV ILH
Sbjct  154  LERCQDTMIGGSFVRGVSGGERRRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQILH  213

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            EIA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSL+YYGKA+EAM YF+SIGCSPLIAMN
Sbjct  214  EIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLIYYGKAAEAMNYFASIGCSPLIAMN  273

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL DKVQ  NS+ +  ++  +PSP +V EYLV  YET
Sbjct  274  PAEFLLDLANGNLSDVSVPSELEDKVQMENSEADSRQD--RPSPILVQEYLVEAYET  328



>gb|KJB16510.1| hypothetical protein B456_002G233500 [Gossypium raimondii]
Length=632

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR +  L 
Sbjct  284  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTIQTLQ  343

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEA+ YFSSIGCSPLIAMN
Sbjct  344  DIAEVGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAIFYFSSIGCSPLIAMN  403

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ D+S+PSEL DKVQ  NS+ E    NGKP PA+VHEYLV  YE+
Sbjct  404  PAEFLLDLANGNLTDISVPSELEDKVQMENSETET--GNGKPPPAVVHEYLVEAYES  458



>ref|XP_010519981.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
22 [Tarenaya hassleriana]
Length=743

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRV IGNEIIINPSLLFLDEPTSGLDSTTALRI+ +LH
Sbjct  286  LERCQDTMIGGSFVRGVSGGERKRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIIQMLH  345

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+GSLLY+GKA+E M YFSSIGCSPLI+MN
Sbjct  346  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKATEVMVYFSSIGCSPLISMN  405

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  +    N KPSPA+VHEYLV  YET
Sbjct  406  PAEFLLDLANGNINDISVPSELEDRVQVGNSGRDI--QNSKPSPALVHEYLVEAYET  460



>gb|EYU38702.1| hypothetical protein MIMGU_mgv1a001826mg [Erythranthe guttata]
Length=754

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+ CQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIVD LH
Sbjct  288  LENCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVDTLH  347

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLF KFDKLILLGKGSLLY+GKASEAM YFSSIGCSP IAMN
Sbjct  348  DIAEAGKTVITTIHQPSSRLFLKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPFIAMN  407

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEF+LDLANGN+ D+S+PSEL D+V   NS  EP   +GKP+PA+VHEYLV  YET
Sbjct  408  PAEFMLDLANGNVTDISVPSELEDRVLMGNSTAEP--KSGKPAPAVVHEYLVEAYET  462



>ref|XP_002309268.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEE92791.1| ABC transporter family protein [Populus trichocarpa]
Length=743

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+ V +L 
Sbjct  278  LERCQDTVIGGSFVRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKTVQLLQ  337

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++A+ GKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GK+SEAM YFSSIGC+PLIAMN
Sbjct  338  DMAEGGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKSSEAMLYFSSIGCNPLIAMN  397

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  NS  +  + NGKPSPA+VHEYLV  YET
Sbjct  398  PAEFLLDLANGNINDVSVPSELDDKVQIVNS--DAGKRNGKPSPAVVHEYLVEAYET  452



>gb|KJB14995.1| hypothetical protein B456_002G153900 [Gossypium raimondii]
Length=554

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L 
Sbjct  282  LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQ  341

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTV+TTIHQPSSRLFHKFDKLI+LGKGSLLY+GKASEA  YFSSIGCSPLIAMN
Sbjct  342  DIAETGKTVLTTIHQPSSRLFHKFDKLIVLGKGSLLYFGKASEATDYFSSIGCSPLIAMN  401

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGN+ND+S+P EL D+VQ  NS+ E TR NGKP P +VHEYLV  YE
Sbjct  402  PAEFLLDLANGNLNDISVPPELEDRVQMENSETE-TR-NGKPPPQVVHEYLVEAYE  455



>ref|XP_010917904.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Elaeis 
guineensis]
Length=692

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR + +LH
Sbjct  278  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTIQMLH  337

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLG+GSLLY+GKASEA+ YFSS+GCSPLIAMN
Sbjct  338  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGRGSLLYFGKASEALVYFSSVGCSPLIAMN  397

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNI+DVS+PSEL D+VQ  N    P   N KPSP  VHEYLV  YET
Sbjct  398  PAEFLLDLANGNISDVSVPSELDDRVQMENLGSHP--RNDKPSPKDVHEYLVEAYET  452



>ref|XP_004494280.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Cicer arietinum]
 ref|XP_004494281.1| PREDICTED: ABC transporter G family member 22-like isoform X4 
[Cicer arietinum]
 ref|XP_004494282.1| PREDICTED: ABC transporter G family member 22-like isoform X5 
[Cicer arietinum]
 ref|XP_004494283.1| PREDICTED: ABC transporter G family member 22-like isoform X6 
[Cicer arietinum]
Length=581

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  117  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLH  176

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKT++TTIHQPSSRLFHKFDKLILLGKG+LLY+GKASEAM YF  IGC+PLIAMN
Sbjct  177  DIAEAGKTIVTTIHQPSSRLFHKFDKLILLGKGNLLYFGKASEAMDYFGFIGCTPLIAMN  236

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S+PSEL DKV   N + E +  NGKPS A+V +YLV  YET
Sbjct  237  PAEFLLDLANGNMNDISVPSELEDKVHMGNVEVETS--NGKPSAAVVQDYLVEAYET  291



>emb|CDX70095.1| BnaA10g24440D [Brassica napus]
Length=721

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  257  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLH  316

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+G+LLY+GK+SEA+ YFSSIGCSPLI MN
Sbjct  317  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGNLLYFGKSSEALVYFSSIGCSPLITMN  376

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  EP    GKPSPA VHEYLV  YET
Sbjct  377  PAEFLLDLANGNINDISVPSELEDRVQVGNSGREP--QTGKPSPAAVHEYLVEAYET  431



>ref|XP_009122263.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Brassica 
rapa]
Length=754

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  290  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLH  349

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+G+LLY+GK+SEA+ YFSSIGCSPLI MN
Sbjct  350  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGNLLYFGKSSEALVYFSSIGCSPLITMN  409

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  EP    GKPSPA VHEYLV  YET
Sbjct  410  PAEFLLDLANGNINDISVPSELEDRVQVGNSGREP--QTGKPSPAAVHEYLVEAYET  464



>emb|CDX98933.1| BnaC09g49020D [Brassica napus]
Length=755

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  291  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLH  350

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+G+LLY+GK+SEA+ YFSSIGCSPLI MN
Sbjct  351  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGNLLYFGKSSEALVYFSSIGCSPLITMN  410

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  EP    GKPSPA VHEYLV  YET
Sbjct  411  PAEFLLDLANGNINDISVPSELEDRVQVGNSGREP--QTGKPSPAAVHEYLVEAYET  465



>ref|XP_011047135.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Populus euphratica]
Length=685

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+ V +L 
Sbjct  288  LERCQDTVIGGSFVRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKTVQLLQ  347

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++A+ GKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GK+S AM YFSSIGC+PLIAMN
Sbjct  348  DMAEGGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKSSAAMPYFSSIGCNPLIAMN  407

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL DKVQ  NS  +  + NGKPSPA+VHEYLV  YET
Sbjct  408  PAEFLLDLANGNVNDVSVPSELEDKVQIGNS--DAGKRNGKPSPAVVHEYLVEAYET  462



>ref|XP_008790027.1| PREDICTED: ABC transporter G family member 22 isoform X3 [Phoenix 
dactylifera]
Length=736

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V +LH
Sbjct  270  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQMLH  329

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  330  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  389

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNI+DVS+PSEL D+VQT N   + TRN+ KPS   VHEYLV  YET
Sbjct  390  PAEFLLDLANGNISDVSVPSELDDRVQTENLGSD-TRND-KPSSKDVHEYLVEAYET  444



>ref|XP_009122262.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Brassica 
rapa]
Length=755

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  291  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLH  350

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+G+LLY+GK+SEA+ YFSSIGCSPLI MN
Sbjct  351  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGNLLYFGKSSEALVYFSSIGCSPLITMN  410

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  EP    GKPSPA VHEYLV  YET
Sbjct  411  PAEFLLDLANGNINDISVPSELEDRVQVGNSGREP--QTGKPSPAAVHEYLVEAYET  465



>ref|XP_010917903.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Elaeis 
guineensis]
Length=744

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR + +LH
Sbjct  278  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTIQMLH  337

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLG+GSLLY+GKASEA+ YFSS+GCSPLIAMN
Sbjct  338  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGRGSLLYFGKASEALVYFSSVGCSPLIAMN  397

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNI+DVS+PSEL D+VQ  N    P   N KPSP  VHEYLV  YET
Sbjct  398  PAEFLLDLANGNISDVSVPSELDDRVQMENLGSHP--RNDKPSPKDVHEYLVEAYET  452



>ref|XP_008442969.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Cucumis 
melo]
 ref|XP_008442970.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Cucumis 
melo]
Length=750

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGER+RV IGNEIIINPSLLFLDEPTSGLDSTTALRIV ILH
Sbjct  284  LERCQDTMIGGSFVRGVSGGERRRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQILH  343

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            EIA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSL+YYGKA+EAM YF+SIGCSPLIAMN
Sbjct  344  EIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLIYYGKAAEAMNYFASIGCSPLIAMN  403

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL DKVQ  NS+ +  ++  +PSP +V EYLV  YET
Sbjct  404  PAEFLLDLANGNLSDVSVPSELEDKVQMENSEADSRQD--RPSPTLVQEYLVEAYET  458



>ref|XP_008790010.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Phoenix 
dactylifera]
Length=744

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V +LH
Sbjct  278  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQMLH  337

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  338  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  397

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNI+DVS+PSEL D+VQT N   + TRN+ KPS   VHEYLV  YET
Sbjct  398  PAEFLLDLANGNISDVSVPSELDDRVQTENLGSD-TRND-KPSSKDVHEYLVEAYET  452



>ref|XP_008790019.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Phoenix 
dactylifera]
Length=743

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V +LH
Sbjct  277  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQMLH  336

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YFSSIGCSPLIAMN
Sbjct  337  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMN  396

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNI+DVS+PSEL D+VQT N   + TRN+ KPS   VHEYLV  YET
Sbjct  397  PAEFLLDLANGNISDVSVPSELDDRVQTENLGSD-TRND-KPSSKDVHEYLVEAYET  451



>ref|XP_008442971.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Cucumis 
melo]
Length=749

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGER+RV IGNEIIINPSLLFLDEPTSGLDSTTALRIV ILH
Sbjct  283  LERCQDTMIGGSFVRGVSGGERRRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQILH  342

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            EIA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSL+YYGKA+EAM YF+SIGCSPLIAMN
Sbjct  343  EIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLIYYGKAAEAMNYFASIGCSPLIAMN  402

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL DKVQ  NS+ +  ++  +PSP +V EYLV  YET
Sbjct  403  PAEFLLDLANGNLSDVSVPSELEDKVQMENSEADSRQD--RPSPTLVQEYLVEAYET  457



>gb|KJB16512.1| hypothetical protein B456_002G233500 [Gossypium raimondii]
Length=748

 Score =   271 bits (693),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR +  L 
Sbjct  284  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTIQTLQ  343

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEA+ YFSSIGCSPLIAMN
Sbjct  344  DIAEVGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAIFYFSSIGCSPLIAMN  403

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ D+S+PSEL DKVQ  NS+ E    NGKP PA+VHEYLV  YE+
Sbjct  404  PAEFLLDLANGNLTDISVPSELEDKVQMENSETET--GNGKPPPAVVHEYLVEAYES  458



>dbj|BAB11402.1| ABC transporter-like protein [Arabidopsis thaliana]
Length=567

 Score =   266 bits (681),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  163  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLH  222

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+GSLLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  223  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMN  282

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YET
Sbjct  283  PAEFLLDLANGNINDISVPSELDDRVQVGNSGRET--QTGKPSPAAVHEYLVEAYET  337



>gb|KEH41805.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=742

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+IV +L 
Sbjct  279  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKIVQMLQ  338

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASE M YF SIGCSPLI+MN
Sbjct  339  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEVMNYFQSIGCSPLISMN  398

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQ  N+  E    +GKPSPA VHEYLV  YE+
Sbjct  399  PAEFLLDLANGNINDVSVPSELEDKVQIGNAAVET--YHGKPSPADVHEYLVEAYES  453



>gb|KHG30511.1| ABC transporter G family member 22 [Gossypium arboreum]
Length=668

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 155/169 (92%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L 
Sbjct  286  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQ  345

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTVITTIHQPSSRLFHKFDKLILLGKGS LY+G+ASEAMAYFSSIGCSPLIAMN
Sbjct  346  NIAEAGKTVITTIHQPSSRLFHKFDKLILLGKGSSLYFGRASEAMAYFSSIGCSPLIAMN  405

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHE  508
            PAEFLLDLANGNIND+S+PSEL DKVQ  NS+ E TRN  KP PA++HE
Sbjct  406  PAEFLLDLANGNINDISVPSELEDKVQVGNSETE-TRNE-KPPPAVIHE  452



>ref|XP_004136536.1| PREDICTED: ABC transporter G family member 22-like [Cucumis sativus]
 gb|KGN59244.1| hypothetical protein Csa_3G784390 [Cucumis sativus]
Length=749

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGER+RV IGNEIIINPSLLFLDEPTSGLDSTTALRIV ILH
Sbjct  283  LERCQDTMIGGSFVRGVSGGERRRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQILH  342

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            EIA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSL+YYGKA+EAM YF+SIGCSPLIAMN
Sbjct  343  EIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLIYYGKAAEAMNYFASIGCSPLIAMN  402

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN++DVS+PSEL DKVQ  NS+ +  ++  +PSP +V EYLV  YET
Sbjct  403  PAEFLLDLANGNLSDVSVPSELEDKVQMENSEADSRQD--RPSPILVQEYLVEAYET  457



>ref|XP_011047134.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Populus euphratica]
Length=752

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+ V +L 
Sbjct  287  LERCQDTVIGGSFVRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKTVQLLQ  346

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++A+ GKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GK+S AM YFSSIGC+PLIAMN
Sbjct  347  DMAEGGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKSSAAMPYFSSIGCNPLIAMN  406

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL DKVQ  NS  +  + NGKPSPA+VHEYLV  YET
Sbjct  407  PAEFLLDLANGNVNDVSVPSELEDKVQIGNS--DAGKRNGKPSPAVVHEYLVEAYET  461



>ref|XP_011047133.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Populus euphratica]
Length=753

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+ V +L 
Sbjct  288  LERCQDTVIGGSFVRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKTVQLLQ  347

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++A+ GKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GK+S AM YFSSIGC+PLIAMN
Sbjct  348  DMAEGGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKSSAAMPYFSSIGCNPLIAMN  407

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+NDVS+PSEL DKVQ  NS  +  + NGKPSPA+VHEYLV  YET
Sbjct  408  PAEFLLDLANGNVNDVSVPSELEDKVQIGNS--DAGKRNGKPSPAVVHEYLVEAYET  462



>emb|CDY04991.1| BnaAnng01730D [Brassica napus]
Length=718

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  253  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLH  312

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+G+LLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  313  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGNLLYFGKSSEALDYFSSIGCSPLIAMN  372

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  E    +GKPSPA+VHEYLV  YE
Sbjct  373  PAEFLLDLANGNINDISVPSELEDRVQVGNSDRES--RSGKPSPAVVHEYLVEAYE  426



>ref|XP_004494279.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Cicer arietinum]
Length=693

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  273  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLH  332

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKT++TTIHQPSSRLFHKFDKLILLGKG+LLY+GKASEAM YF  IGC+PLIAMN
Sbjct  333  DIAEAGKTIVTTIHQPSSRLFHKFDKLILLGKGNLLYFGKASEAMDYFGFIGCTPLIAMN  392

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S+PSEL DKV   N + E +  NGKPS A+V +YLV  YET
Sbjct  393  PAEFLLDLANGNMNDISVPSELEDKVHMGNVEVETS--NGKPSAAVVQDYLVEAYET  447



>ref|XP_011094213.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Sesamum indicum]
Length=736

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+DTMIGGSFVRGVSGGERKRVCIGNEII+NPSLLFLDEPTSGLDST ALRI++ LH
Sbjct  270  LERCRDTMIGGSFVRGVSGGERKRVCIGNEIIVNPSLLFLDEPTSGLDSTIALRILETLH  329

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTVITTIHQPSSRLF KFDKLILLGKGSLLY+GKA+EAM YFSS+GCSPLIAMN
Sbjct  330  GIAEAGKTVITTIHQPSSRLFLKFDKLILLGKGSLLYFGKAAEAMVYFSSVGCSPLIAMN  389

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEF+LDLANGN+ D+S+PSEL D+VQT NS++E    NGK  PA+VHEYLV  YET
Sbjct  390  PAEFMLDLANGNVTDISVPSELEDRVQTENSEDEI--KNGKMDPAVVHEYLVEAYET  444



>ref|XP_010036577.1| PREDICTED: ABC transporter G family member 22-like [Eucalyptus 
grandis]
 ref|XP_010036578.1| PREDICTED: ABC transporter G family member 22-like [Eucalyptus 
grandis]
 gb|KCW48184.1| hypothetical protein EUGRSUZ_K01911 [Eucalyptus grandis]
Length=759

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+DTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  293  LERCEDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLH  352

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASE M YFSSIGCSPLIAMN
Sbjct  353  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEVMIYFSSIGCSPLIAMN  412

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+N+VS+PSEL D+VQ    K      N KPSP  VHEYLV  YET
Sbjct  413  PAEFLLDLANGNVNEVSVPSELEDRVQM--EKAVTQTRNAKPSPTDVHEYLVEAYET  467



>ref|XP_004494278.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Cicer arietinum]
Length=737

 Score =   268 bits (686),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  273  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLH  332

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKT++TTIHQPSSRLFHKFDKLILLGKG+LLY+GKASEAM YF  IGC+PLIAMN
Sbjct  333  DIAEAGKTIVTTIHQPSSRLFHKFDKLILLGKGNLLYFGKASEAMDYFGFIGCTPLIAMN  392

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S+PSEL DKV   N + E +  NGKPS A+V +YLV  YET
Sbjct  393  PAEFLLDLANGNMNDISVPSELEDKVHMGNVEVETS--NGKPSAAVVQDYLVEAYET  447



>gb|KEH24295.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=581

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  117  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLH  176

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKT+ITTIHQPSSRLFHKFDKLILLGKG+LLY+GKASEAM YF  IGC+PLI MN
Sbjct  177  DIAEAGKTIITTIHQPSSRLFHKFDKLILLGKGNLLYFGKASEAMDYFKLIGCNPLITMN  236

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ D+S+PSEL DKV   N++ E    NGKPS A++ EYLV  YET
Sbjct  237  PAEFLLDLANGNMIDISVPSELNDKVHMGNAETETF--NGKPSAAVIQEYLVEAYET  291



>gb|KJB14994.1| hypothetical protein B456_002G153900 [Gossypium raimondii]
Length=745

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L 
Sbjct  282  LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQ  341

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTV+TTIHQPSSRLFHKFDKLI+LGKGSLLY+GKASEA  YFSSIGCSPLIAMN
Sbjct  342  DIAETGKTVLTTIHQPSSRLFHKFDKLIVLGKGSLLYFGKASEATDYFSSIGCSPLIAMN  401

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGN+ND+S+P EL D+VQ  NS+ E TR NGKP P +VHEYLV  YE
Sbjct  402  PAEFLLDLANGNLNDISVPPELEDRVQMENSETE-TR-NGKPPPQVVHEYLVEAYE  455



>ref|XP_010491223.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Camelina sativa]
Length=692

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  288  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLH  347

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +I+ AGKTVITTIHQPSSRLFH+FDKLILLG+GSLLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  348  DISDAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALEYFSSIGCSPLIAMN  407

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YET
Sbjct  408  PAEFLLDLANGNINDISVPSELDDRVQVGNSGRE--TQTGKPSPAAVHEYLVEAYET  462



>gb|KJB14993.1| hypothetical protein B456_002G153900 [Gossypium raimondii]
Length=751

 Score =   269 bits (687),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L 
Sbjct  282  LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQ  341

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTV+TTIHQPSSRLFHKFDKLI+LGKGSLLY+GKASEA  YFSSIGCSPLIAMN
Sbjct  342  DIAETGKTVLTTIHQPSSRLFHKFDKLIVLGKGSLLYFGKASEATDYFSSIGCSPLIAMN  401

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGN+ND+S+P EL D+VQ  NS+ E TR NGKP P +VHEYLV  YE
Sbjct  402  PAEFLLDLANGNLNDISVPPELEDRVQMENSETE-TR-NGKPPPQVVHEYLVEAYE  455



>ref|XP_002873263.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49522.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=750

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  286  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLH  345

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+GSLLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  346  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMN  405

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  E     GKPSP IVHEYLV  YET
Sbjct  406  PAEFLLDLANGNINDISVPSELDDRVQVGNSGRET--QTGKPSPTIVHEYLVEAYET  460



>ref|XP_006287123.1| hypothetical protein CARUB_v10000295mg [Capsella rubella]
 gb|EOA20021.1| hypothetical protein CARUB_v10000295mg [Capsella rubella]
Length=752

 Score =   268 bits (685),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 161/178 (90%), Gaps = 4/178 (2%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  288  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLH  347

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA AGKTVITTIHQPSSRLFH+FDKLILLG+GSLLY+GK++EA+ YFSSIGCSPLIAMN
Sbjct  348  DIADAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSAEALDYFSSIGCSPLIAMN  407

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNS-KEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS +E PT   GKPSPA VHEYLV  YET
Sbjct  408  PAEFLLDLANGNINDISVPSELDDRVQVGNSGRETPT---GKPSPAAVHEYLVEAYET  462



>ref|NP_001031843.1| ABC transporter G family member 22 [Arabidopsis thaliana]
 gb|AED91031.1| ABC transporter G family member 22 [Arabidopsis thaliana]
Length=691

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  287  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLH  346

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+GSLLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  347  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMN  406

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YET
Sbjct  407  PAEFLLDLANGNINDISVPSELDDRVQVGNSGRE--TQTGKPSPAAVHEYLVEAYET  461



>ref|XP_011094212.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Sesamum indicum]
Length=600

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 3/178 (2%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+DTMIGGSFVRGVSGGERKRVCIGNEII+NPSLLFLDEPTSGLDST ALRI++ LH
Sbjct  133  LERCRDTMIGGSFVRGVSGGERKRVCIGNEIIVNPSLLFLDEPTSGLDSTIALRILETLH  192

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTVITTIHQPSSRLF KFDKLILLGKGSLLY+GKA+EAM YFSS+GCSPLIAMN
Sbjct  193  GIAEAGKTVITTIHQPSSRLFLKFDKLILLGKGSLLYFGKAAEAMVYFSSVGCSPLIAMN  252

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHE-YLVGCYET  532
            PAEF+LDLANGN+ D+S+PSEL D+VQT NS++E    NGK  PA+VHE YLV  YET
Sbjct  253  PAEFMLDLANGNVTDISVPSELEDRVQTENSEDEI--KNGKMDPAVVHEQYLVEAYET  308



>ref|XP_010491222.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Camelina sativa]
Length=752

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  288  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLH  347

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +I+ AGKTVITTIHQPSSRLFH+FDKLILLG+GSLLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  348  DISDAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALEYFSSIGCSPLIAMN  407

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YET
Sbjct  408  PAEFLLDLANGNINDISVPSELDDRVQVGNSGRET--QTGKPSPAAVHEYLVEAYET  462



>ref|NP_568169.1| ABC transporter G family member 22 [Arabidopsis thaliana]
 ref|NP_850781.2| ABC transporter G family member 22 [Arabidopsis thaliana]
 sp|Q93YS4.1|AB22G_ARATH RecName: Full=ABC transporter G family member 22; Short=ABC transporter 
ABCG.22; Short=AtABCG22; AltName: Full=White-brown 
complex homolog protein 23; Short=AtWBC23 [Arabidopsis thaliana]
 gb|AAL24135.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AAM45116.1| putative ABC transporter protein [Arabidopsis thaliana]
 dbj|BAH20090.1| AT5G06530 [Arabidopsis thaliana]
 gb|AED91029.1| ABC transporter G family member 22 [Arabidopsis thaliana]
 gb|AED91030.1| ABC transporter G family member 22 [Arabidopsis thaliana]
Length=751

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  287  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLH  346

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+GSLLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  347  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMN  406

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YET
Sbjct  407  PAEFLLDLANGNINDISVPSELDDRVQVGNSGRET--QTGKPSPAAVHEYLVEAYET  461



>ref|XP_010423326.1| PREDICTED: ABC transporter G family member 22-like [Camelina 
sativa]
Length=752

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  288  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLH  347

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +I+ AGKTVITTIHQPSSRLFH+FDKLILLG+GSLLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  348  DISDAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMN  407

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YET
Sbjct  408  PAEFLLDLANGNINDISVPSELDDRVQVGNSGRET--QTGKPSPAAVHEYLVEAYET  462



>ref|XP_010452592.1| PREDICTED: ABC transporter G family member 22 [Camelina sativa]
Length=752

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  288  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLH  347

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +I+ AGKTVITTIHQPSSRLFH+FDKLILLG+GSLLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  348  DISDAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMN  407

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YET
Sbjct  408  PAEFLLDLANGNINDISVPSELDDRVQVGNSGRET--QTGKPSPAAVHEYLVEAYET  462



>ref|XP_011094211.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Sesamum indicum]
Length=643

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 3/178 (2%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+DTMIGGSFVRGVSGGERKRVCIGNEII+NPSLLFLDEPTSGLDST ALRI++ LH
Sbjct  176  LERCRDTMIGGSFVRGVSGGERKRVCIGNEIIVNPSLLFLDEPTSGLDSTIALRILETLH  235

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTVITTIHQPSSRLF KFDKLILLGKGSLLY+GKA+EAM YFSS+GCSPLIAMN
Sbjct  236  GIAEAGKTVITTIHQPSSRLFLKFDKLILLGKGSLLYFGKAAEAMVYFSSVGCSPLIAMN  295

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHE-YLVGCYET  532
            PAEF+LDLANGN+ D+S+PSEL D+VQT NS++E    NGK  PA+VHE YLV  YET
Sbjct  296  PAEFMLDLANGNVTDISVPSELEDRVQTENSEDEI--KNGKMDPAVVHEQYLVEAYET  351



>ref|XP_003521505.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Glycine max]
 ref|XP_006577105.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Glycine max]
Length=740

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 161/177 (91%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGS+VRG+SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  274  LERCQDTMIGGSYVRGISGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  333

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKAS+AM YF  IGC+PLIAMN
Sbjct  334  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASDAMDYFQFIGCAPLIAMN  393

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S+PSEL DKVQ  N++ E   +NGKPS ++V EYLV  Y++
Sbjct  394  PAEFLLDLANGNVNDISVPSELKDKVQMGNAEAET--SNGKPSASVVQEYLVEAYDS  448



>ref|XP_009125649.1| PREDICTED: ABC transporter G family member 22-like [Brassica 
rapa]
Length=752

 Score =   266 bits (680),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGE KRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH
Sbjct  287  LERCQDTMIGGAFVRGVSGGEGKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLH  346

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLG+G+LLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  347  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGNLLYFGKSSEALDYFSSIGCSPLIAMN  406

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  E    +GKPSPA+VHEYLV  YE
Sbjct  407  PAEFLLDLANGNINDISVPSELEDRVQVGNSDRE--SRSGKPSPAVVHEYLVEAYE  460



>ref|XP_006604672.1| PREDICTED: ABC transporter G family member 22-like isoform X4 
[Glycine max]
Length=604

 Score =   262 bits (670),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGS+VRG+SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  138  LERCQDTMIGGSYVRGISGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  197

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKAS+AM YF  IGC+PLIAMN
Sbjct  198  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASDAMDYFQFIGCAPLIAMN  257

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S+PSEL D VQ  N++ E    NGKPS ++V EYLV  Y++
Sbjct  258  PAEFLLDLANGNVNDISVPSELKDIVQVGNAEAETC--NGKPSASVVQEYLVEAYDS  312



>ref|XP_006604673.1| PREDICTED: ABC transporter G family member 22-like isoform X5 
[Glycine max]
Length=586

 Score =   262 bits (669),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGS+VRG+SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  120  LERCQDTMIGGSYVRGISGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  179

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKAS+AM YF  IGC+PLIAMN
Sbjct  180  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASDAMDYFQFIGCAPLIAMN  239

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S+PSEL D VQ  N++ E    NGKPS ++V EYLV  Y++
Sbjct  240  PAEFLLDLANGNVNDISVPSELKDIVQVGNAEAETC--NGKPSASVVQEYLVEAYDS  294



>gb|EMT07325.1| ABC transporter G family member 22 [Aegilops tauschii]
Length=607

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 156/178 (88%), Gaps = 2/178 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  137  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLH  196

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLG+GSLLY+GK +EAM YFSSIGC+PLIAMN
Sbjct  197  DIAETGKTVITTIHQPSSRLFHKFDKLILLGRGSLLYFGKTAEAMPYFSSIGCNPLIAMN  256

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRN--NGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGN NDVS+PSEL DKV   N   + T +  N +PS   VHEYLV  YE
Sbjct  257  PAEFLLDLANGNTNDVSVPSELDDKVHMENQNLQDTNSKINLRPSAQDVHEYLVDAYE  314



>gb|KEH24294.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=732

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  268  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLH  327

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKT+ITTIHQPSSRLFHKFDKLILLGKG+LLY+GKASEAM YF  IGC+PLI MN
Sbjct  328  DIAEAGKTIITTIHQPSSRLFHKFDKLILLGKGNLLYFGKASEAMDYFKLIGCNPLITMN  387

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ D+S+PSEL DKV   N++ E    NGKPS A++ EYLV  YET
Sbjct  388  PAEFLLDLANGNMIDISVPSELNDKVHMGNAETETF--NGKPSAAVIQEYLVEAYET  442



>ref|XP_006826407.1| hypothetical protein AMTR_s00004p00153830 [Amborella trichopoda]
 gb|ERM93644.1| hypothetical protein AMTR_s00004p00153830 [Amborella trichopoda]
Length=468

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = +2

Query  8    RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEI  187
            RCQDT+IGGSF+RGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +L+ I
Sbjct  7    RCQDTVIGGSFIRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQMLNNI  66

Query  188  AKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMNPA  367
            A+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKASE M YFSSIGCSPLIAMNPA
Sbjct  67   AEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASETMLYFSSIGCSPLIAMNPA  126

Query  368  EFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            EFL+DLANGNINDVSIPS+L DKVQT  S E  TR NGKP   I  +YLV  YE+
Sbjct  127  EFLIDLANGNINDVSIPSDLEDKVQT-ESPETETR-NGKPHHQI-KQYLVEAYES  178



>ref|XP_006649428.1| PREDICTED: ABC transporter G family member 22-like [Oryza brachyantha]
Length=668

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEII+NPSLLFLDEPTSGLDSTTALRI+ +LH
Sbjct  199  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIVNPSLLFLDEPTSGLDSTTALRIIQLLH  258

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLG+GSLLY+GKASEAM YF SIGC+PLIAMN
Sbjct  259  DIAEDGKTVITTIHQPSSRLFHKFDKLILLGRGSLLYFGKASEAMPYFQSIGCTPLIAMN  318

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSK-EEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGN  DVS+PSEL DKV   N   +  T+N+ KPS   VHEYLV  YE
Sbjct  319  PAEFLLDLANGNTTDVSVPSELDDKVHMENQNPQNNTKNDYKPSAQDVHEYLVDAYE  375



>ref|XP_002465834.1| hypothetical protein SORBIDRAFT_01g046620 [Sorghum bicolor]
 gb|EER92832.1| hypothetical protein SORBIDRAFT_01g046620 [Sorghum bicolor]
Length=763

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 158/179 (88%), Gaps = 2/179 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSF+RGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  293  LERCQDTMIGGSFIRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLH  352

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YF SIGC+PLIAMN
Sbjct  353  DIAEDGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMPYFQSIGCTPLIAMN  412

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEE--PTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN NDVS+PSEL DKV   N   E   ++N+ +PS   VHEYLV  YET
Sbjct  413  PAEFLLDLANGNTNDVSVPSELDDKVHMENHNLENNNSKNDHRPSAQDVHEYLVDAYET  471



>gb|AAM51832.1|AC105730_6 Putative ABC transporter [Oryza sativa Japonica Group]
Length=695

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRI+ +LH
Sbjct  298  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIIQLLH  357

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLG+GSLLY+GKASEAM YF SIGC+PLIAMN
Sbjct  358  DIAEDGKTVITTIHQPSSRLFHKFDKLILLGRGSLLYFGKASEAMPYFQSIGCTPLIAMN  417

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSK-EEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGN  DVS+PSEL DKV   N   +  T+N+ KPS   VHEYLV  YE
Sbjct  418  PAEFLLDLANGNTTDVSVPSELDDKVHMENQNLQTNTKNDYKPSAQDVHEYLVDAYE  474



>gb|EEC74548.1| hypothetical protein OsI_10084 [Oryza sativa Indica Group]
Length=771

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRI+ +LH
Sbjct  302  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIIQLLH  361

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLG+GSLLY+GKASEAM YF SIGC+PLIAMN
Sbjct  362  DIAEDGKTVITTIHQPSSRLFHKFDKLILLGRGSLLYFGKASEAMPYFQSIGCTPLIAMN  421

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSK-EEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGN  DVS+PSEL DKV   N   +  T+N+ KPS   VHEYLV  YE
Sbjct  422  PAEFLLDLANGNTTDVSVPSELDDKVHMENQNLQTNTKNDYKPSAQDVHEYLVDAYE  478



>gb|EMS65761.1| ABC transporter G family member 22 [Triticum urartu]
Length=685

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 156/178 (88%), Gaps = 2/178 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  215  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLH  274

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLG+GSLLY+GK +EAM YFSSIGC+PLIAMN
Sbjct  275  DIAETGKTVITTIHQPSSRLFHKFDKLILLGRGSLLYFGKTAEAMPYFSSIGCNPLIAMN  334

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRN--NGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGN NDVS+PSEL DKV   N   + T +  N +PS   VHEYLV  YE
Sbjct  335  PAEFLLDLANGNTNDVSVPSELDDKVHMENQNLQDTNSKINLRPSAQDVHEYLVDAYE  392



>ref|NP_001049014.1| Os03g0157400 [Oryza sativa Japonica Group]
 gb|ABF94064.1| ABC transporter family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10928.1| Os03g0157400 [Oryza sativa Japonica Group]
Length=771

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRI+ +LH
Sbjct  302  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIIQLLH  361

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLG+GSLLY+GKASEAM YF SIGC+PLIAMN
Sbjct  362  DIAEDGKTVITTIHQPSSRLFHKFDKLILLGRGSLLYFGKASEAMPYFQSIGCTPLIAMN  421

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSK-EEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGN  DVS+PSEL DKV   N   +  T+N+ KPS   VHEYLV  YE
Sbjct  422  PAEFLLDLANGNTTDVSVPSELDDKVHMENQNLQTNTKNDYKPSAQDVHEYLVDAYE  478



>ref|XP_006399125.1| hypothetical protein EUTSA_v10012760mg [Eutrema salsugineum]
 gb|ESQ40578.1| hypothetical protein EUTSA_v10012760mg [Eutrema salsugineum]
Length=755

 Score =   263 bits (672),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +L 
Sbjct  291  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLL  350

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTVITTIHQPSSRLFH+FDKLILLGKG+LLY+GK+SEA+ YFSSIGCSPLIAMN
Sbjct  351  DIAEAGKTVITTIHQPSSRLFHRFDKLILLGKGNLLYFGKSSEALVYFSSIGCSPLIAMN  410

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN ND+S+PSEL D+VQ  NS  E     GKPSP  VHEYLV  YET
Sbjct  411  PAEFLLDLANGNTNDISVPSELEDRVQVGNSGRE--NQTGKPSPVAVHEYLVEAYET  465



>ref|XP_010244002.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Nelumbo nucifera]
Length=800

 Score =   264 bits (674),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGGSFVRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  325  LERCQNTIIGGSFVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIVQMLH  384

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSRLF+KFDKLILL +G+ LY+GKASEAM YFSSIGCSPLI MN
Sbjct  385  NIAKAGKTVVTTIHQPSSRLFNKFDKLILLSRGNSLYFGKASEAMLYFSSIGCSPLIVMN  444

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGNIND SIPS L DK+      + P + +G+PSP  VHEYLVG YET
Sbjct  445  PAEFLIDLANGNINDKSIPSVLEDKILL--GSQFPEKQDGRPSPVDVHEYLVGAYET  499



>ref|XP_010244004.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Nelumbo nucifera]
Length=797

 Score =   264 bits (674),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGGSFVRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  321  LERCQNTIIGGSFVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIVQMLH  380

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSRLF+KFDKLILL +G+ LY+GKASEAM YFSSIGCSPLI MN
Sbjct  381  NIAKAGKTVVTTIHQPSSRLFNKFDKLILLSRGNSLYFGKASEAMLYFSSIGCSPLIVMN  440

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGNIND SIPS L DK+      + P + +G+PSP  VHEYLVG YET
Sbjct  441  PAEFLIDLANGNINDKSIPSVLEDKILL--GSQFPEKQDGRPSPVDVHEYLVGAYET  495



>ref|XP_010244001.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Nelumbo nucifera]
Length=801

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGGSFVRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  325  LERCQNTIIGGSFVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIVQMLH  384

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSRLF+KFDKLILL +G+ LY+GKASEAM YFSSIGCSPLI MN
Sbjct  385  NIAKAGKTVVTTIHQPSSRLFNKFDKLILLSRGNSLYFGKASEAMLYFSSIGCSPLIVMN  444

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGNIND SIPS L DK+      + P + +G+PSP  VHEYLVG YET
Sbjct  445  PAEFLIDLANGNINDKSIPSVLEDKILL--GSQFPEKQDGRPSPVDVHEYLVGAYET  499



>gb|KHN43592.1| ABC transporter G family member 22 [Glycine soja]
Length=691

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGS+VRG+SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  225  LERCQDTMIGGSYVRGISGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  284

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKAS+AM YF  IGC+PLIAMN
Sbjct  285  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASDAMDYFQFIGCAPLIAMN  344

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S+PSEL D VQ  N++ E    NGKPS ++V EYLV  Y++
Sbjct  345  PAEFLLDLANGNVNDISVPSELKDIVQVGNAEAETC--NGKPSASVVQEYLVEAYDS  399



>ref|XP_003553629.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Glycine max]
 ref|XP_006604671.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Glycine max]
Length=736

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGS+VRG+SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  270  LERCQDTMIGGSYVRGISGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  329

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKAS+AM YF  IGC+PLIAMN
Sbjct  330  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASDAMDYFQFIGCAPLIAMN  389

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S+PSEL D VQ  N++ E    NGKPS ++V EYLV  Y++
Sbjct  390  PAEFLLDLANGNVNDISVPSELKDIVQVGNAEAETC--NGKPSASVVQEYLVEAYDS  444



>ref|XP_006604670.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Glycine max]
Length=740

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGS+VRG+SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  274  LERCQDTMIGGSYVRGISGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQ  333

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GKAS+AM YF  IGC+PLIAMN
Sbjct  334  DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASDAMDYFQFIGCAPLIAMN  393

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S+PSEL D VQ  N++ E    NGKPS ++V EYLV  Y++
Sbjct  394  PAEFLLDLANGNVNDISVPSELKDIVQVGNAEAETC--NGKPSASVVQEYLVEAYDS  448



>ref|XP_007163008.1| hypothetical protein PHAVU_001G198400g [Phaseolus vulgaris]
 gb|ESW35002.1| hypothetical protein PHAVU_001G198400g [Phaseolus vulgaris]
Length=558

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGS+VRGVSGGERKRVCIG+EIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  92   LERCQDTMIGGSYVRGVSGGERKRVCIGSEIIINPSLLFLDEPTSGLDSTTALRIVQVLQ  151

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+ TIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YF  IGC+PLI MN
Sbjct  152  DIAEAGKTVVITIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMDYFQFIGCAPLITMN  211

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S+PSEL D+VQ  N++ E    NGKPS ++V EYL   Y++
Sbjct  212  PAEFLLDLANGNVNDISVPSELKDRVQMGNAEVETC--NGKPSASVVQEYLEEAYDS  266



>ref|XP_009412321.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=744

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALRI+ +L 
Sbjct  278  LERCQDTMIGGSFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRIMQVLR  337

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AG+TV+TTIHQPSSRLFH+FDKLILLGKGSLLY+GKASEA+ YFSSIGCSPLIAMN
Sbjct  338  DIAEAGRTVLTTIHQPSSRLFHRFDKLILLGKGSLLYFGKASEALVYFSSIGCSPLIAMN  397

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN ND+SIPSEL DKVQ  N   +    N KPSP  VHEYLV  YET
Sbjct  398  PAEFLLDLANGNTNDISIPSELEDKVQIENLGSDI--RNDKPSPKDVHEYLVEAYET  452



>ref|XP_003562060.1| PREDICTED: ABC transporter G family member 22-like [Brachypodium 
distachyon]
Length=756

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  286  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLH  345

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTV+TTIHQPSSRLFHKFDKLILLGKGSLLY+GK SEAM YF SIGCSPLIAMN
Sbjct  346  DIAETGKTVMTTIHQPSSRLFHKFDKLILLGKGSLLYFGKTSEAMPYFQSIGCSPLIAMN  405

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPT--RNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN ND+S+PSEL DKV   N   + T  + + +PS   VHEYLV  YE+
Sbjct  406  PAEFLLDLANGNTNDISVPSELDDKVHMENQNLQNTNSKTDYRPSAQDVHEYLVDAYES  464



>ref|XP_004985644.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Setaria italica]
Length=759

 Score =   260 bits (665),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 156/179 (87%), Gaps = 2/179 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  289  LERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLH  348

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFH FDKLILLGKGSLLY+GKASEAM YF SIGC+PL AMN
Sbjct  349  DIAEDGKTVITTIHQPSSRLFHNFDKLILLGKGSLLYFGKASEAMPYFQSIGCTPLFAMN  408

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEE--PTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN NDVS+PSEL DKV   N   E   ++N+ +PS   VHEYLV  YET
Sbjct  409  PAEFLLDLANGNTNDVSVPSELDDKVHMENHNLENNNSKNDCRPSAQDVHEYLVDAYET  467



>ref|XP_006854611.1| hypothetical protein AMTR_s00030p00144980 [Amborella trichopoda]
 gb|ERN16078.1| hypothetical protein AMTR_s00030p00144980 [Amborella trichopoda]
Length=756

 Score =   260 bits (665),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG+F RG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ ILH
Sbjct  283  LERCQDTLIGGAFTRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIIQILH  342

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+ TIHQPSSRLFHKFDKLILLGKGSLLY GKA EAM YF+SIGCSPLIAMN
Sbjct  343  DIAEAGKTVVITIHQPSSRLFHKFDKLILLGKGSLLYSGKALEAMVYFNSIGCSPLIAMN  402

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGNIND SIPSEL DKV   +S+ E    + KPSP+ VHEYLV  YET
Sbjct  403  PAEFLIDLANGNINDKSIPSELEDKVLLESSRVEIV--DAKPSPSDVHEYLVEAYET  457



>ref|XP_009405790.1| PREDICTED: ABC transporter G family member 22-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405791.1| PREDICTED: ABC transporter G family member 22-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405793.1| PREDICTED: ABC transporter G family member 22-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405794.1| PREDICTED: ABC transporter G family member 22-like [Musa acuminata 
subsp. malaccensis]
Length=735

 Score =   260 bits (664),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 157/177 (89%), Gaps = 4/177 (2%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGG FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRI+ +LH
Sbjct  271  LERCQNTIIGGPFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIIQVLH  330

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAK GKTV+TTIHQPSSRLFH+FDKLILLGKGSLLY+GKAS+A+ YFSSIGCSPLIAMN
Sbjct  331  GIAKLGKTVVTTIHQPSSRLFHRFDKLILLGKGSLLYFGKASKAIKYFSSIGCSPLIAMN  390

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKE-EPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFLLDLA+GNINDV++PS L  KVQ   SKE E    NGKPSP  VHEYLV  YE
Sbjct  391  PAEFLLDLASGNINDVTVPSVLESKVQ---SKESESNTRNGKPSPEDVHEYLVEAYE  444



>dbj|BAK06297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 156/178 (88%), Gaps = 2/178 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  301  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLH  360

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTV+TTIHQPSSRLFHKFDKLILLG+GSLLY+GK +EAM YFSSIGC+PLIAMN
Sbjct  361  DIAETGKTVVTTIHQPSSRLFHKFDKLILLGRGSLLYFGKTAEAMPYFSSIGCNPLIAMN  420

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRN--NGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGN NDVS+PSEL DK+   N   + T +  N +PS   VHEYLV  YE
Sbjct  421  PAEFLLDLANGNTNDVSVPSELDDKLHMENQNLQDTNSKINLRPSAQDVHEYLVDAYE  478



>gb|AAK63861.1|AF389289_1 AT5g06530/F15M7_6 [Arabidopsis thaliana]
 gb|AAN72282.1| At5g06530/F15M7_6 [Arabidopsis thaliana]
Length=458

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +2

Query  23   MIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGK  202
            MIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+IA+AGK
Sbjct  1    MIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGK  60

Query  203  TVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMNPAEFLLD  382
            TVITTIHQPSSRLFH+FDKLILLG+GSLLY+GK+SEA+ YFSSIGCSPLIAMNPAEFLLD
Sbjct  61   TVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLD  120

Query  383  LANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            LANGNIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YET
Sbjct  121  LANGNINDISVPSELDDRVQVGNSGRET--QTGKPSPAAVHEYLVEAYET  168



>ref|XP_009388615.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=786

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGGSFVRGVSGGERKRVCIGNEII+NPSLLFLDEPTSGLDSTTALR + +L+
Sbjct  322  LERCQDTIIGGSFVRGVSGGERKRVCIGNEIIMNPSLLFLDEPTSGLDSTTALRTIQVLN  381

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA++GKTV+TTIHQPSSRLFH+FDKLILLG+GSLL++G+AS+AMAYF+SIGC PLIAMN
Sbjct  382  DIAESGKTVVTTIHQPSSRLFHRFDKLILLGRGSLLFFGRASKAMAYFASIGCVPLIAMN  441

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDV++PSEL +KVQ+ N     +  N KPSP  VHEYLV  YET
Sbjct  442  PAEFLLDLANGNINDVTLPSELEEKVQSRNLGG--STRNAKPSPEDVHEYLVETYET  496



>ref|XP_008664829.1| PREDICTED: uncharacterized protein LOC100216600 isoform X2 [Zea 
mays]
Length=752

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 155/181 (86%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  282  LERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLH  341

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YF SIGC+PLIAMN
Sbjct  342  DIAEDGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMPYFQSIGCAPLIAMN  401

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGK----PSPAIVHEYLVGCYE  529
            PAEFLLDLANGN  DVS+PSEL DKV   N   E   NN K    PS   VHEYLV  YE
Sbjct  402  PAEFLLDLANGNTTDVSVPSELDDKVHMENHNLE--NNNSKIDYRPSAQDVHEYLVDAYE  459

Query  530  T  532
            T
Sbjct  460  T  460



>ref|XP_008664823.1| PREDICTED: uncharacterized protein LOC100216600 isoform X1 [Zea 
mays]
Length=753

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 155/181 (86%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  283  LERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLH  342

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YF SIGC+PLIAMN
Sbjct  343  DIAEDGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMPYFQSIGCAPLIAMN  402

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGK----PSPAIVHEYLVGCYE  529
            PAEFLLDLANGN  DVS+PSEL DKV   N   E   NN K    PS   VHEYLV  YE
Sbjct  403  PAEFLLDLANGNTTDVSVPSELDDKVHMENHNLE--NNNSKIDYRPSAQDVHEYLVDAYE  460

Query  530  T  532
            T
Sbjct  461  T  461



>ref|XP_010677592.1| PREDICTED: ABC transporter G family member 22 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010677594.1| PREDICTED: ABC transporter G family member 22 [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALR + +L 
Sbjct  282  LERCQDTLIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRTIQVLQ  341

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GK VITTIHQPSSRLFHKFDKLILLGKGSLLY+GKAS+ M YFS+IGC+PLI+MN
Sbjct  342  DIAEDGKAVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASQVMNYFSAIGCTPLISMN  401

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDV++PSEL DKVQ  +   E  R N +PS A++HEYLV  YE+
Sbjct  402  PAEFLLDLANGNINDVTVPSELEDKVQIDDPGTE--RTNARPSAAVIHEYLVESYES  456



>ref|XP_009388622.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=782

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGGSFVRGVSGGERKRVCIGNEII+NPSLLFLDEPTSGLDSTTALR + +L+
Sbjct  318  LERCQDTIIGGSFVRGVSGGERKRVCIGNEIIMNPSLLFLDEPTSGLDSTTALRTIQVLN  377

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA++GKTV+TTIHQPSSRLFH+FDKLILLG+GSLL++G+AS+AMAYF+SIGC PLIAMN
Sbjct  378  DIAESGKTVVTTIHQPSSRLFHRFDKLILLGRGSLLFFGRASKAMAYFASIGCVPLIAMN  437

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDV++PSEL +KVQ+ N     +  N KPSP  VHEYLV  YET
Sbjct  438  PAEFLLDLANGNINDVTLPSELEEKVQSRNLGG--STRNAKPSPEDVHEYLVETYET  492



>ref|XP_007163009.1| hypothetical protein PHAVU_001G198400g [Phaseolus vulgaris]
 gb|ESW35003.1| hypothetical protein PHAVU_001G198400g [Phaseolus vulgaris]
Length=736

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 157/177 (89%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGS+VRGVSGGERKRVCIG+EIIINPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  270  LERCQDTMIGGSYVRGVSGGERKRVCIGSEIIINPSLLFLDEPTSGLDSTTALRIVQVLQ  329

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+ TIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YF  IGC+PLI MN
Sbjct  330  DIAEAGKTVVITIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMDYFQFIGCAPLITMN  389

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S+PSEL D+VQ  N++ E    NGKPS ++V EYL   Y++
Sbjct  390  PAEFLLDLANGNVNDISVPSELKDRVQMGNAEVETC--NGKPSASVVQEYLEEAYDS  444



>dbj|BAJ88390.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 155/178 (87%), Gaps = 2/178 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGG RKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  301  LERCQDTMIGGSFVRGVSGGGRKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLH  360

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTV+TTIHQPSSRLFHKFDKLILLG+GSLLY+GK +EAM YFSSIGC+PLIAMN
Sbjct  361  DIAETGKTVVTTIHQPSSRLFHKFDKLILLGRGSLLYFGKTAEAMPYFSSIGCNPLIAMN  420

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRN--NGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGN NDVS+PSEL DK+   N   + T +  N +PS   VHEYLV  YE
Sbjct  421  PAEFLLDLANGNTNDVSVPSELDDKLHMENQNLQDTNSKINLRPSAQDVHEYLVDAYE  478



>gb|KFK40221.1| hypothetical protein AALP_AA3G346400 [Arabis alpina]
Length=610

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 152/176 (86%), Gaps = 4/176 (2%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLLFLDEPTSGLDSTTAL+ + +LH
Sbjct  157  LERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLFLDEPTSGLDSTTALKTIQMLH  216

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IAKAGKTVITTIHQPSSRLFH FDKLILLG+G+LLY+GK+SEAM YFSSIGCSPLIAMN
Sbjct  217  DIAKAGKTVITTIHQPSSRLFHGFDKLILLGRGNLLYFGKSSEAMDYFSSIGCSPLIAMN  276

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFLLDLANGNIND+S+PSEL D+VQ  NS  E       P    V EYLV  YE
Sbjct  277  PAEFLLDLANGNINDISVPSELEDRVQNGNSGRESLTEKSFP----VQEYLVEAYE  328



>tpg|DAA43438.1| TPA: hypothetical protein ZEAMMB73_582925 [Zea mays]
Length=879

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 155/181 (86%), Gaps = 6/181 (3%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  409  LERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLH  468

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFHKFDKLILLGKGSLLY+GKASEAM YF SIGC+PLIAMN
Sbjct  469  DIAEDGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMPYFQSIGCAPLIAMN  528

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGK----PSPAIVHEYLVGCYE  529
            PAEFLLDLANGN  DVS+PSEL DKV   N   E   NN K    PS   VHEYLV  YE
Sbjct  529  PAEFLLDLANGNTTDVSVPSELDDKVHMENHNLE--NNNSKIDYRPSAQDVHEYLVDAYE  586

Query  530  T  532
            T
Sbjct  587  T  587



>gb|KEH41808.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=587

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 153/177 (86%), Gaps = 11/177 (6%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+TMIG SFV G+SGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+IV +L 
Sbjct  132  LERCQNTMIGDSFVPGLSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKIVQMLQ  191

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++AKAGKTV+TTIHQPSSRLFHKFDKLILLGKGS LY+GKASE+M YF SIGCSPLI+MN
Sbjct  192  DMAKAGKTVVTTIHQPSSRLFHKFDKLILLGKGSSLYFGKASESMNYFQSIGCSPLISMN  251

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGNINDVS+PSEL DKVQT           G  + A+VHEYLV  +E+
Sbjct  252  PAEFLLDLANGNINDVSVPSELKDKVQT-----------GNEASAVVHEYLVEAFES  297



>ref|XP_010247278.1| PREDICTED: ABC transporter G family member 22-like [Nelumbo nucifera]
Length=782

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGG+FVRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRIV +L 
Sbjct  317  LERCQNTIIGGAFVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIVQMLQ  376

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSRLF+KFDKLILLG+G+ LY+GKASEAM YFSSIGCSPLIAMN
Sbjct  377  SIAKAGKTVVTTIHQPSSRLFNKFDKLILLGRGNTLYFGKASEAMQYFSSIGCSPLIAMN  436

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGN+ND S+PS L DKV   +   E  + NG+ SP  VH+YLV  YET
Sbjct  437  PAEFLIDLANGNVNDKSVPSLLEDKVLFRHRNSE--KQNGRLSPTDVHQYLVDAYET  491



>ref|XP_010553412.1| PREDICTED: ABC transporter G family member 27-like isoform X2 
[Tarenaya hassleriana]
Length=597

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRG+SGGERKRVCIGNEI+INPS+LFLDEPTS LDSTTAL+IV +L 
Sbjct  131  LERCQDTMIGGSFVRGISGGERKRVCIGNEIMINPSILFLDEPTSSLDSTTALKIVQMLQ  190

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKT++TTIHQPSSRLFH+FDKLI+L +GSLLY+GKAS+AM+YFSS+GC PL+ MN
Sbjct  191  SIAEAGKTIVTTIHQPSSRLFHRFDKLIMLSRGSLLYFGKASQAMSYFSSLGCYPLLTMN  250

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+SIPS+L +  QT NS       + KP+PA V+E+LV  Y+T
Sbjct  251  PAEFLLDLANGNMNDISIPSDLGNNEQTENSYT--VIRSSKPTPAAVYEFLVEAYQT  305



>ref|XP_009412322.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=648

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 150/169 (89%), Gaps = 2/169 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALRI+ +L 
Sbjct  278  LERCQDTMIGGSFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRIMQVLR  337

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AG+TV+TTIHQPSSRLFH+FDKLILLGKGSLLY+GKASEA+ YFSSIGCSPLIAMN
Sbjct  338  DIAEAGRTVLTTIHQPSSRLFHRFDKLILLGKGSLLYFGKASEALVYFSSIGCSPLIAMN  397

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHE  508
            PAEFLLDLANGN ND+SIPSEL DKVQ  N   +    N KPSP  VHE
Sbjct  398  PAEFLLDLANGNTNDISIPSELEDKVQIENLGSDI--RNDKPSPKDVHE  444



>gb|EPS59306.1| hypothetical protein M569_15501, partial [Genlisea aurea]
Length=582

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 152/177 (86%), Gaps = 7/177 (4%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLL LDEPTSGLDST ALR+V+ L 
Sbjct  129  LERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLLLDEPTSGLDSTMALRLVETLQ  188

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++A+AGKTVITTIHQPSSRL  KFDKLILLGKG LLY+GK SEAM YFSSIGCSPLI MN
Sbjct  189  DMAEAGKTVITTIHQPSSRLLLKFDKLILLGKGCLLYHGKTSEAMPYFSSIGCSPLIPMN  248

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEF+LDLANGN+ D+S+PSEL D+VQT NS+ E         P++VHEYLV  YET
Sbjct  249  PAEFMLDLANGNVTDISVPSELEDRVQTGNSEVETI-------PSLVHEYLVEAYET  298



>ref|XP_006403815.1| hypothetical protein EUTSA_v10010138mg [Eutrema salsugineum]
 gb|ESQ45268.1| hypothetical protein EUTSA_v10010138mg [Eutrema salsugineum]
Length=770

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEII NPSLLFLDEPTS LDSTTAL+IV +L 
Sbjct  304  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIITNPSLLFLDEPTSSLDSTTALKIVQMLQ  363

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKT++TTIHQPSSRLFH+FDKL++L +GSLLY+GKASEAM++F+S+GCSPL+AMN
Sbjct  364  SIAKAGKTIVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMSFFTSVGCSPLLAMN  423

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+SIPS L +K++  NS  +    + KP+P +V+EYL   Y+T
Sbjct  424  PAEFLLDLANGNMNDISIPSTLKEKMKNENSCSKII--SSKPTPTVVYEYLEEAYKT  478



>ref|XP_010553410.1| PREDICTED: ABC transporter G family member 27-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010553411.1| PREDICTED: ABC transporter G family member 27-like isoform X1 
[Tarenaya hassleriana]
Length=736

 Score =   249 bits (637),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRG+SGGERKRVCIGNEI+INPS+LFLDEPTS LDSTTAL+IV +L 
Sbjct  270  LERCQDTMIGGSFVRGISGGERKRVCIGNEIMINPSILFLDEPTSSLDSTTALKIVQMLQ  329

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKT++TTIHQPSSRLFH+FDKLI+L +GSLLY+GKAS+AM+YFSS+GC PL+ MN
Sbjct  330  SIAEAGKTIVTTIHQPSSRLFHRFDKLIMLSRGSLLYFGKASQAMSYFSSLGCYPLLTMN  389

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+SIPS+L +  QT NS       + KP+PA V+E+LV  Y+T
Sbjct  390  PAEFLLDLANGNMNDISIPSDLGNNEQTENSYT--VIRSSKPTPAAVYEFLVEAYQT  444



>ref|XP_010503974.1| PREDICTED: ABC transporter G family member 27-like isoform X3 
[Camelina sativa]
Length=583

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ TMIGGSFVRGVSGGERKRV IGNEI+ NPSLL LDEPTS LDSTTAL+IV +L 
Sbjct  117  LERCQGTMIGGSFVRGVSGGERKRVSIGNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQ  176

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSRLFH+FDKL++L +GSLLY+GKAS+AM+YFSSIGCSPL+AMN
Sbjct  177  SIAKAGKTVVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASDAMSYFSSIGCSPLLAMN  236

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+SIPS L  K++  NS  E    + KP+P IV+EYL   Y+T
Sbjct  237  PAEFLLDLANGNMNDISIPSALKKKMKMENSCSEI--RSSKPTPTIVYEYLEEAYKT  291



>ref|XP_010320061.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Solanum lycopersicum]
Length=722

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG+FVRGVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L 
Sbjct  256  LERCQDTIIGGAFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIMQMLR  315

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTV+TTIHQPSSRLF +FDKLILLG+GS LY+GKASEAM YFSSIGCSPLIAMN
Sbjct  316  NIARAGKTVVTTIHQPSSRLFSRFDKLILLGQGSSLYFGKASEAMLYFSSIGCSPLIAMN  375

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGNI + SIPSEL +K+          + N  PSPA VHEY VG YE+
Sbjct  376  PAEFLIDLANGNITEKSIPSELKEKLLP--GHHHFKKQNEGPSPADVHEYFVGAYES  430



>ref|XP_004237766.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Solanum lycopersicum]
Length=726

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG+FVRGVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L 
Sbjct  260  LERCQDTIIGGAFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIMQMLR  319

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTV+TTIHQPSSRLF +FDKLILLG+GS LY+GKASEAM YFSSIGCSPLIAMN
Sbjct  320  NIARAGKTVVTTIHQPSSRLFSRFDKLILLGQGSSLYFGKASEAMLYFSSIGCSPLIAMN  379

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGNI + SIPSEL +K+          + N  PSPA VHEY VG YE+
Sbjct  380  PAEFLIDLANGNITEKSIPSELKEKLLP--GHHHFKKQNEGPSPADVHEYFVGAYES  434



>ref|XP_009799080.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009799081.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Nicotiana sylvestris]
Length=766

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG+FVRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  299  LERCQDTIIGGTFVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIVQMLH  358

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTV+TTIHQPSSRLF +FD+LILLG+G  LY GKASEAM YFS+IGCSPLIAMN
Sbjct  359  NIARAGKTVVTTIHQPSSRLFSRFDRLILLGQGCSLYSGKASEAMLYFSTIGCSPLIAMN  418

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGNI D SIPS+L +K    N   + ++N G PS A VHEY VG YE+
Sbjct  419  PAEFLIDLANGNIKDKSIPSDLENKFLPGNHHFK-SKNEG-PSSADVHEYFVGAYES  473



>ref|XP_009799082.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Nicotiana sylvestris]
Length=708

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG+FVRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  299  LERCQDTIIGGTFVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIVQMLH  358

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTV+TTIHQPSSRLF +FD+LILLG+G  LY GKASEAM YFS+IGCSPLIAMN
Sbjct  359  NIARAGKTVVTTIHQPSSRLFSRFDRLILLGQGCSLYSGKASEAMLYFSTIGCSPLIAMN  418

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGNI D SIPS+L +K    N   + ++N G PS A VHEY VG YE+
Sbjct  419  PAEFLIDLANGNIKDKSIPSDLENKFLPGNHHFK-SKNEG-PSSADVHEYFVGAYES  473



>ref|XP_010426847.1| PREDICTED: ABC transporter G family member 27-like isoform X1 
[Camelina sativa]
Length=597

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ TMIGGSFVRGVSGGERKRV IG EI+ NPSLL LDEPTS LDSTTAL+IV +L 
Sbjct  131  LERCQGTMIGGSFVRGVSGGERKRVSIGIEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQ  190

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSRLFH+FDKL++L +GSLLY+GKASEAM+YFSSIGCSPL+AMN
Sbjct  191  SIAKAGKTVVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMSYFSSIGCSPLLAMN  250

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+SIPS L +K++  NS  E    + KP+P IV+EYL   Y+T
Sbjct  251  PAEFLLDLANGNMNDISIPSALKEKMKMENSCSEI--RSSKPTPTIVYEYLEEAYKT  305



>ref|XP_006362828.1| PREDICTED: ABC transporter G family member 22-like [Solanum tuberosum]
Length=760

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 154/177 (87%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG+FVRGVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L 
Sbjct  294  LERCQDTIIGGAFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIMQMLR  353

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
              A+AGKTV+TTIHQPSSRLF +FDKLILLG+GS LY+GKASEAM YFSSIGCSPLIAMN
Sbjct  354  NTARAGKTVVTTIHQPSSRLFSRFDKLILLGQGSSLYFGKASEAMLYFSSIGCSPLIAMN  413

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGNI + SIPS+L DK+   N   +  +N G PSPA VHEY VG YE+
Sbjct  414  PAEFLIDLANGNITEKSIPSDLEDKLLPGNHHFK-MQNEG-PSPADVHEYFVGAYES  468



>ref|XP_010503973.1| PREDICTED: ABC transporter G family member 27-like isoform X2 
[Camelina sativa]
Length=725

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ TMIGGSFVRGVSGGERKRV IGNEI+ NPSLL LDEPTS LDSTTAL+IV +L 
Sbjct  259  LERCQGTMIGGSFVRGVSGGERKRVSIGNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQ  318

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSRLFH+FDKL++L +GSLLY+GKAS+AM+YFSSIGCSPL+AMN
Sbjct  319  SIAKAGKTVVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASDAMSYFSSIGCSPLLAMN  378

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+SIPS L  K++  NS  E    + KP+P IV+EYL   Y+T
Sbjct  379  PAEFLLDLANGNMNDISIPSALKKKMKMENSCSEI--RSSKPTPTIVYEYLEEAYKT  433



>ref|XP_006292375.1| hypothetical protein CARUB_v10018588mg [Capsella rubella]
 gb|EOA25273.1| hypothetical protein CARUB_v10018588mg [Capsella rubella]
Length=743

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 151/177 (85%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFV GVSGGERKRVCIGNEI+ NPSLL LDEPTS LDSTTAL+IV +L 
Sbjct  277  LERCQDTMIGGSFVCGVSGGERKRVCIGNEIMNNPSLLLLDEPTSSLDSTTALKIVQMLQ  336

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSRLFH+FDKL++L +GSLLY+GKASEAM YFSSIGCSPL AMN
Sbjct  337  SIAKAGKTVVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMPYFSSIGCSPLFAMN  396

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+S PS L +K++  NS  E    + KP+P +V+EYL   Y+T
Sbjct  397  PAEFLLDLANGNMNDISTPSALKEKMKMGNSFSEI--RSSKPTPTVVYEYLEEAYKT  451



>ref|XP_010503972.1| PREDICTED: ABC transporter G family member 27-like isoform X1 
[Camelina sativa]
Length=746

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ TMIGGSFVRGVSGGERKRV IGNEI+ NPSLL LDEPTS LDSTTAL+IV +L 
Sbjct  280  LERCQGTMIGGSFVRGVSGGERKRVSIGNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQ  339

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSRLFH+FDKL++L +GSLLY+GKAS+AM+YFSSIGCSPL+AMN
Sbjct  340  SIAKAGKTVVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASDAMSYFSSIGCSPLLAMN  399

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+SIPS L  K++  NS  E    + KP+P IV+EYL   Y+T
Sbjct  400  PAEFLLDLANGNMNDISIPSALKKKMKMENSCSEI--RSSKPTPTIVYEYLEEAYKT  454



>ref|XP_011101660.1| PREDICTED: ABC transporter G family member 22-like [Sesamum indicum]
 ref|XP_011101668.1| PREDICTED: ABC transporter G family member 22-like [Sesamum indicum]
Length=768

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 146/176 (83%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+TMIGG+FVRGVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L 
Sbjct  297  LERCQNTMIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIIQMLR  356

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTV+TTIHQPSSRLF KFDKLILL  G  LY+GKASEAM YFSSIGCSPL AM 
Sbjct  357  NIAQAGKTVVTTIHQPSSRLFSKFDKLILLSNGCSLYFGKASEAMLYFSSIGCSPLTAMT  416

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFL+DLANGNI D SIPSEL DK        E    +G PSP  VHEYL+G YE
Sbjct  417  PAEFLIDLANGNIKDKSIPSELEDKFLPGGECFEC--KDGGPSPVDVHEYLLGAYE  470



>ref|XP_009599779.1| PREDICTED: ABC transporter G family member 22-like [Nicotiana 
tomentosiformis]
Length=753

 Score =   244 bits (624),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 151/177 (85%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG+FVRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  293  LERCQDTIIGGAFVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIVQMLH  352

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTV+TTIHQPSSRLF  FDKLILLG+G  LY GKASEAM YFSSIGCSPLIAMN
Sbjct  353  NIARAGKTVVTTIHQPSSRLFSTFDKLILLGQGCSLYSGKASEAMLYFSSIGCSPLIAMN  412

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGNI D SIPS+L +K    N   + ++N G  S A VHEY VG YE+
Sbjct  413  PAEFLIDLANGNIKDKSIPSDLENKYLPGNHHFK-SKNEG-LSSAEVHEYFVGAYES  467



>ref|XP_010426848.1| PREDICTED: ABC transporter G family member 27-like isoform X2 
[Camelina sativa]
Length=743

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ TMIGGSFVRGVSGGERKRV IG EI+ NPSLL LDEPTS LDSTTAL+IV +L 
Sbjct  277  LERCQGTMIGGSFVRGVSGGERKRVSIGIEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQ  336

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSRLFH+FDKL++L +GSLLY+GKASEAM+YFSSIGCSPL+AMN
Sbjct  337  SIAKAGKTVVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMSYFSSIGCSPLLAMN  396

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+SIPS L +K++  NS  E    + KP+P IV+EYL   Y+T
Sbjct  397  PAEFLLDLANGNMNDISIPSALKEKMKMENSCSEI--RSSKPTPTIVYEYLEEAYKT  451



>gb|EYU17426.1| hypothetical protein MIMGU_mgv1a002142mg [Erythranthe guttata]
Length=709

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 149/177 (84%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+TMIGG+FVRGVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L 
Sbjct  234  LERCQNTMIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIIQMLQ  293

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AGKTV+TTIHQPSSRLF KFDKLIL+  G  LY+GKASEAM YFSSIGCSPLIAM+
Sbjct  294  KIARAGKTVVTTIHQPSSRLFSKFDKLILMSNGCSLYFGKASEAMLYFSSIGCSPLIAMS  353

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            P EFL+DLANGNI D SIPS L DK        E T+ NG PSP  VHEYL+  YE+
Sbjct  354  PPEFLIDLANGNIKDKSIPSVLEDKFLPGGEFFE-TKING-PSPFDVHEYLLEAYES  408



>ref|XP_010911944.1| PREDICTED: ABC transporter G family member 22-like, partial [Elaeis 
guineensis]
Length=653

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 148/177 (84%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+ CQD +IGG  VRG+SGGERKRVCIGNEI+++PSL+FLDEPTSGLDSTTALRI  +LH
Sbjct  174  LESCQDMIIGGPLVRGISGGERKRVCIGNEILLDPSLIFLDEPTSGLDSTTALRITQMLH  233

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++A AGKTV+TTIHQPSSRLF+KFDKLILLGKGS  Y+GKASEAM YFSSIGCSPLIAMN
Sbjct  234  KMAHAGKTVVTTIHQPSSRLFNKFDKLILLGKGSSFYFGKASEAMLYFSSIGCSPLIAMN  293

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGN+ND SIPSEL D     +  +E      +PSP  +HEYL+  YET
Sbjct  294  PAEFLIDLANGNMNDKSIPSELKDTFL--HGSQEFKHQEQRPSPVDIHEYLLDSYET  348



>ref|XP_002263430.1| PREDICTED: ABC transporter G family member 22-like [Vitis vinifera]
Length=775

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 150/181 (83%), Gaps = 12/181 (7%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGG+ VRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L 
Sbjct  299  LERCQNTIIGGALVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRILQMLQ  358

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
              A+AGKTV+TTIHQPSSRLF  FDKL+LLGKG+ LY+GKASEAM YFSSIGCSPL AMN
Sbjct  359  NTAEAGKTVVTTIHQPSSRLFSMFDKLVLLGKGNSLYFGKASEAMLYFSSIGCSPLEAMN  418

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNN-----GKPSPAIVHEYLVGCY  526
            PAEFL+DLANGNI++ S+PSEL DK         P R N     GKPSP  VHEYLVG Y
Sbjct  419  PAEFLIDLANGNISNKSVPSELEDKY-------SPGRQNFENEEGKPSPGEVHEYLVGAY  471

Query  527  E  529
            E
Sbjct  472  E  472



>emb|CBI35490.3| unnamed protein product [Vitis vinifera]
Length=776

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 150/181 (83%), Gaps = 12/181 (7%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGG+ VRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L 
Sbjct  300  LERCQNTIIGGALVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRILQMLQ  359

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
              A+AGKTV+TTIHQPSSRLF  FDKL+LLGKG+ LY+GKASEAM YFSSIGCSPL AMN
Sbjct  360  NTAEAGKTVVTTIHQPSSRLFSMFDKLVLLGKGNSLYFGKASEAMLYFSSIGCSPLEAMN  419

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNN-----GKPSPAIVHEYLVGCY  526
            PAEFL+DLANGNI++ S+PSEL DK         P R N     GKPSP  VHEYLVG Y
Sbjct  420  PAEFLIDLANGNISNKSVPSELEDKY-------SPGRQNFENEEGKPSPGEVHEYLVGAY  472

Query  527  E  529
            E
Sbjct  473  E  473



>ref|XP_010515694.1| PREDICTED: ABC transporter G family member 27 [Camelina sativa]
Length=743

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+R   TMIGGSFVRGVSGGERKRVCIGNEI+ NPSLL LDEPTS LDSTTAL+IV +L 
Sbjct  277  LERYIITMIGGSFVRGVSGGERKRVCIGNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQ  336

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSRLFH+FDKL++L +GSLLY+GKAS+AM+YFSSIGCSPL+AMN
Sbjct  337  SIAKAGKTVVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASDAMSYFSSIGCSPLLAMN  396

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+SIPS L +K++  NS  +    + KP+P IV+EYL   Y+T
Sbjct  397  PAEFLLDLANGNMNDISIPSALKEKMKMENSCSKI--RSSKPTPTIVYEYLEEAYKT  451



>emb|CDY23205.1| BnaA04g05540D [Brassica napus]
Length=735

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 149/177 (84%), Gaps = 6/177 (3%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+ NPSLLFLDEPTS LDSTTAL+IV +L 
Sbjct  273  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIMTNPSLLFLDEPTSSLDSTTALKIVQMLQ  332

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKT++TTIHQPSSRLFH+FDKL++L +GSLLY+GKASEAM YFSSIGCSPL++MN
Sbjct  333  SIAKAGKTIVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMPYFSSIGCSPLLSMN  392

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+SIPS L +      SK  P     K +P  V+EYL   Y+T
Sbjct  393  PAEFLLDLANGNMNDISIPSALKEGSSC--SKIRPP----KSTPTAVYEYLEEAYKT  443



>ref|XP_004985645.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Setaria italica]
Length=733

 Score =   238 bits (608),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  289  LERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLH  348

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+ GKTVITTIHQPSSRLFH FDKLILLGKGSLLY+GKASEAM YF SIGC+PL AMN
Sbjct  349  DIAEDGKTVITTIHQPSSRLFHNFDKLILLGKGSLLYFGKASEAMPYFQSIGCTPLFAMN  408

Query  362  PAEFLLDLANGNINDVSIPSELADK  436
            PAEFLLDLANGN NDVS+PSEL DK
Sbjct  409  PAEFLLDLANGNTNDVSVPSELDDK  433



>ref|XP_009139468.1| PREDICTED: ABC transporter G family member 27 [Brassica rapa]
Length=735

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 150/177 (85%), Gaps = 6/177 (3%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+ NPSLLFLDEPTS LDSTTAL+IV +L 
Sbjct  273  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIMTNPSLLFLDEPTSCLDSTTALKIVQMLQ  332

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKT++TTIHQPSSRLFH+FDKL++L +GSLLY+GKASEAM YFSSIGCSPL++MN
Sbjct  333  SIAKAGKTIVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMPYFSSIGCSPLLSMN  392

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND+SIPS L + V + +    P     K +P  V+EYL   Y+T
Sbjct  393  PAEFLLDLANGNMNDISIPSALKE-VSSCSKIRPP-----KSTPTAVYEYLEEAYKT  443



>ref|XP_002876135.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52394.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 153/186 (82%), Gaps = 11/186 (6%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+ NPSLL LDEPTS LDSTTAL+IV +L 
Sbjct  275  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQ  334

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKT++TTIHQPSSRLFH+FDKL++L +GSLLY+GKASEAM+YFSSIGCSPL+AMN
Sbjct  335  SIAKAGKTIVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMSYFSSIGCSPLLAMN  394

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVH---------EYL  514
            PAEFLLDLANGN+ND+SIPS L +K++  NS  E    + KP   +++         +YL
Sbjct  395  PAEFLLDLANGNMNDISIPSTLKEKMKMGNSCSE--MGSSKPKLYVINANCDVDAETQYL  452

Query  515  VGCYET  532
               Y+T
Sbjct  453  EEAYKT  458



>ref|XP_008356252.1| PREDICTED: ABC transporter G family member 22-like [Malus domestica]
Length=604

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 145/172 (84%), Gaps = 15/172 (9%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG FV+GVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDST ALRI+ +LH
Sbjct  137  LERCQDTLIGGXFVKGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRILQMLH  196

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSR+F+KFDKLILLG+GS LY+GKASE+M YFSSIGC+PLIAMN
Sbjct  197  IIAKAGKTVVTTIHQPSSRIFNKFDKLILLGRGSSLYFGKASESMTYFSSIGCAPLIAMN  256

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLV  517
            PAEFL+DLANGN ND S+P+EL D+               +PS   VHE+LV
Sbjct  257  PAEFLVDLANGNTNDKSLPTELEDE---------------RPSAVDVHEFLV  293



>ref|XP_009360789.1| PREDICTED: ABC transporter G family member 22-like [Pyrus x bretschneideri]
Length=764

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 15/172 (9%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG+FV+GVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDST+ALRI+ +LH
Sbjct  311  LERCQDTLIGGTFVKGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTSALRILQMLH  370

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSR+F+KFDKLILLG+GS LY+GKASE+M YFSSIGC+PLIAMN
Sbjct  371  IIAKAGKTVVTTIHQPSSRIFNKFDKLILLGRGSSLYFGKASESMTYFSSIGCAPLIAMN  430

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLV  517
            PAEFL+DLANGN ND S+P+EL D               G+PS   VHE+LV
Sbjct  431  PAEFLIDLANGNTNDKSLPTELED---------------GRPSTVDVHEFLV  467



>sp|Q9FT51.1|AB27G_ARATH RecName: Full=ABC transporter G family member 27; Short=ABC transporter 
ABCG.27; Short=AtABCG27; AltName: Full=Probable white-brown 
complex homolog protein 28; Short=AtWBC28 [Arabidopsis 
thaliana]
 emb|CAC07922.1| ABC transporter-like protein [Arabidopsis thaliana]
Length=737

 Score =   234 bits (597),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+ NPSLL LDEPTS LDSTTAL+IV +LH
Sbjct  275  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLH  334

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKT++TTIHQPSSRLFH+FDKL++L +GSLLY+GKASEAM+YFSSIGCSPL+AMN
Sbjct  335  CIAKAGKTIVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMSYFSSIGCSPLLAMN  394

Query  362  PAEFLLDLANGNINDVSIPSELADKVQ  442
            PAEFLLDL NGN+ND+S+PS L +K++
Sbjct  395  PAEFLLDLVNGNMNDISVPSALKEKMK  421



>emb|CDX95330.1| BnaC04g28280D [Brassica napus]
Length=738

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+ NPSLLFLDEPTS LDSTTAL+IV +L 
Sbjct  272  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIMTNPSLLFLDEPTSSLDSTTALKIVQMLQ  331

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKT++TTIHQPSSRLFH+FDKL++L +GSLLY+GKASEAM+YFSSIGCSPL++MN
Sbjct  332  SIAKAGKTIVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMSYFSSIGCSPLLSMN  391

Query  362  PAEFLLDLANGNINDVSIPSELADKVQ  442
            PAEFLLDLANGN+ND+SIPS L ++ +
Sbjct  392  PAEFLLDLANGNMNDISIPSALKEETK  418



>ref|NP_190799.2| ABC transporter G family member 27 [Arabidopsis thaliana]
 gb|AEE78930.1| ABC transporter G family member 27 [Arabidopsis thaliana]
Length=784

 Score =   234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+ NPSLL LDEPTS LDSTTAL+IV +LH
Sbjct  322  LERCQDTMIGGSFVRGVSGGERKRVCIGNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLH  381

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKT++TTIHQPSSRLFH+FDKL++L +GSLLY+GKASEAM+YFSSIGCSPL+AMN
Sbjct  382  CIAKAGKTIVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMSYFSSIGCSPLLAMN  441

Query  362  PAEFLLDLANGNINDVSIPSELADKVQ  442
            PAEFLLDL NGN+ND+S+PS L +K++
Sbjct  442  PAEFLLDLVNGNMNDISVPSALKEKMK  468



>ref|XP_007200734.1| hypothetical protein PRUPE_ppa021401mg, partial [Prunus persica]
 gb|EMJ01933.1| hypothetical protein PRUPE_ppa021401mg, partial [Prunus persica]
Length=637

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 144/172 (84%), Gaps = 15/172 (9%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG+FVRGVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDST ALR + +LH
Sbjct  184  LERCQDTLIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRTLQMLH  243

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSR+F+KFDKLILLG+GS LY+GKASEAM YFSSIGC+PLIAMN
Sbjct  244  IIAKAGKTVVTTIHQPSSRIFNKFDKLILLGRGSSLYFGKASEAMMYFSSIGCAPLIAMN  303

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLV  517
            PAEFL+DLANGN N+ S+P+EL D+                PS   +HE+LV
Sbjct  304  PAEFLIDLANGNTNEKSLPTELEDR---------------GPSAVDIHEFLV  340



>ref|XP_009415591.1| PREDICTED: ABC transporter G family member 22-like [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG++ RG+SGGERKRVCIGNEI+++PSLLFLDEPTSGLDSTTALRI  +LH
Sbjct  182  LERCQDTIIGGAYTRGISGGERKRVCIGNEILLDPSLLFLDEPTSGLDSTTALRIAQMLH  241

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA AGKTV+TTIHQPSSRLF+ FDKLILLG+GS LY+GK SEAM YFSSIGCSPLI MN
Sbjct  242  NIALAGKTVVTTIHQPSSRLFNMFDKLILLGRGSSLYFGKTSEAMLYFSSIGCSPLIPMN  301

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFL+DLANGNIND S+P EL  +     + E   R++   S   +HEYLVG YET
Sbjct  302  PAEFLIDLANGNINDKSVPLELQQRRFLCKTPEIEGRSS---SSMDIHEYLVGAYET  355



>ref|XP_007019433.1| White-brown-complex ABC transporter family [Theobroma cacao]
 gb|EOY16658.1| White-brown-complex ABC transporter family [Theobroma cacao]
Length=802

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 145/175 (83%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGG+F+RG+SGGERKRVCI NEI++NPSLLFLDEPTSGLDSTTAL+IV +LH
Sbjct  314  LERCQNTVIGGTFLRGISGGERKRVCIANEILLNPSLLFLDEPTSGLDSTTALQIVQMLH  373

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA++G  V+TTIHQPSSRLF KFDKLILLGKGS LYYGKASEAM YFSSIGCSPLIAMN
Sbjct  374  NIAQSGTVVVTTIHQPSSRLFSKFDKLILLGKGSSLYYGKASEAMLYFSSIGCSPLIAMN  433

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  526
            PAEFL+DLANGNI D S+PS+  D+    N   +     G PS   VHEYLV  Y
Sbjct  434  PAEFLIDLANGNIKDKSVPSDFEDRFLPRNRSLD--MKYGGPSQVDVHEYLVEAY  486



>gb|ABR17189.1| unknown [Picea sitchensis]
Length=819

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 150/182 (82%), Gaps = 10/182 (5%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG+FVRG+SGGERKRVCIG EI+I+PSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  338  LERCQDTIIGGNFVRGISGGERKRVCIGCEILIDPSLLFLDEPTSGLDSTTALRIVQMLH  397

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            +IA+AG+TV++TIHQPSSRLFHKFDKLILLG+G  +Y+GKAS+AM YFSS+G SP +AMN
Sbjct  398  DIARAGRTVVSTIHQPSSRLFHKFDKLILLGEGHSIYFGKASDAMEYFSSVGFSPFLAMN  457

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAI-----VHEYLVGCY  526
            PA+FLLDLANGNI+D+S+P+EL +      S  E   N+G   P       V EYL+  Y
Sbjct  458  PADFLLDLANGNIHDISVPAELEN-----TSHAEAEDNHGDKFPRSLSSHDVLEYLIEAY  512

Query  527  ET  532
            ET
Sbjct  513  ET  514



>ref|XP_008237629.1| PREDICTED: ABC transporter G family member 22-like [Prunus mume]
Length=804

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 144/172 (84%), Gaps = 15/172 (9%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG+FVRGVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDST ALR + +LH
Sbjct  338  LERCQDTLIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRTLQMLH  397

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAGKTV+TTIHQPSSR+F++FDKLILLG+GS LY+G+ASEAM YFSSIGC+PLIAMN
Sbjct  398  IIAKAGKTVVTTIHQPSSRIFNEFDKLILLGRGSSLYFGQASEAMMYFSSIGCAPLIAMN  457

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLV  517
            PAEFL+DLANGN N+ S+P+EL D+                PS   VHE+LV
Sbjct  458  PAEFLIDLANGNTNEKSLPTELEDR---------------GPSAVDVHEFLV  494



>emb|CAN66426.1| hypothetical protein VITISV_029010 [Vitis vinifera]
Length=751

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 144/174 (83%), Gaps = 12/174 (7%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGG+ VRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L 
Sbjct  342  LERCQNTIIGGALVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRILQMLQ  401

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
              A+AGKTV+TTIHQPSSRLF  FDKL+LLGKG+ LY+GKASEAM YFSSIGCSPL AMN
Sbjct  402  NTAEAGKTVVTTIHQPSSRLFSMFDKLVLLGKGNSLYFGKASEAMLYFSSIGCSPLEAMN  461

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNN-----GKPSPAIVHE  508
            PAEFL+DLANGNI++ S+PSEL DK         P R N     GKPSP  VHE
Sbjct  462  PAEFLIDLANGNISNKSVPSELEDKY-------SPGRQNFENEEGKPSPGEVHE  508



>gb|KDP43029.1| hypothetical protein JCGZ_25215 [Jatropha curcas]
Length=706

 Score =   225 bits (573),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 144/176 (82%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+R Q+++IGG FVRG+SGGERKRVCIG+EI++NPSLLFLDEPTSGLDSTTALRIV IL 
Sbjct  236  LERSQNSVIGGKFVRGISGGERKRVCIGHEILLNPSLLFLDEPTSGLDSTTALRIVQILQ  295

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK GKT++TTIHQPSSRLF KFD+LILLGKGS LY+GKASEAM+YFSSIGC P+IAMN
Sbjct  296  NMAKTGKTIVTTIHQPSSRLFGKFDRLILLGKGSSLYFGKASEAMSYFSSIGCHPVIAMN  355

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFL+DLANGNIND   PSEL +K    +   E  R     S   +HEYL+  YE
Sbjct  356  PAEFLIDLANGNINDKPFPSELEEKFLLESGSLE--RKKEGRSYTDIHEYLLKAYE  409



>ref|XP_011458535.1| PREDICTED: ABC transporter G family member 22-like [Fragaria 
vesca subsp. vesca]
Length=736

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 139/172 (81%), Gaps = 18/172 (10%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQDT+IGG  VRGVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDST A RI+ +L 
Sbjct  269  LERCQDTVIGGILVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAAFRILQMLQ  328

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AGKTV+TTIHQPSSR+F KFDKLILLG+GS LY+GKASEAM YFSSIGC+PLIAMN
Sbjct  329  IIAEAGKTVVTTIHQPSSRIFSKFDKLILLGRGSSLYFGKASEAMMYFSSIGCAPLIAMN  388

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLV  517
            PAEFL+DLANGN ND S+P+E  D               G PS   VHE+LV
Sbjct  389  PAEFLIDLANGNTNDKSLPTEWED---------------GGPS---VHEFLV  422



>ref|XP_010680137.1| PREDICTED: ABC transporter G family member 22-like [Beta vulgaris 
subsp. vulgaris]
Length=729

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 147/177 (83%), Gaps = 6/177 (3%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ++M+GG+ ++G+SGGER+RVCIGNEI++NP LL LDEPTS LDS +ALRIV IL 
Sbjct  256  LERCQNSMVGGALLKGISGGERRRVCIGNEILLNPPLLLLDEPTSSLDSASALRIVQILQ  315

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++AKAGKTV+TTIHQPSSRLF KFDKLILLGKGS LY+GKASEAM YFS++GCSPLI+MN
Sbjct  316  KLAKAGKTVVTTIHQPSSRLFCKFDKLILLGKGSSLYFGKASEAMKYFSTMGCSPLISMN  375

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLANGN+ND S PS L DK  T N+  +      KPSP  +HEY V  YE+
Sbjct  376  PAEFLLDLANGNMNDKSFPSNLEDKFSTTNNSRQ------KPSPLEIHEYFVEAYES  426



>ref|XP_002992999.1| hypothetical protein SELMODRAFT_136316, partial [Selaginella 
moellendorffii]
 gb|EFJ05945.1| hypothetical protein SELMODRAFT_136316, partial [Selaginella 
moellendorffii]
Length=520

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 139/177 (79%), Gaps = 4/177 (2%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LD+C+DT+IGG F RGVSGGERKRVCIG EI+I+PS++FLDEPTSGLDSTTALRI+ +LH
Sbjct  113  LDKCKDTIIGGPFERGVSGGERKRVCIGQEILIDPSIIFLDEPTSGLDSTTALRILQLLH  172

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +A+AG+TVITTIHQPSSRL+H FD L+LL  G  +++G+  +A+ YFSSIG +  + MN
Sbjct  173  GLAQAGRTVITTIHQPSSRLYHMFDNLLLLSNGHAIFFGRGQDALPYFSSIGLNASLLMN  232

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PA+FLLDLANGNI+D SIP EL  +++   SK +     GKP    V EYLV C+ +
Sbjct  233  PADFLLDLANGNISDTSIPPEL--EIKLIQSKGDS--KVGKPPELAVQEYLVECFSS  285



>ref|XP_002991839.1| ATP-binding cassette transporter, partial [Selaginella moellendorffii]
 gb|EFJ07101.1| ATP-binding cassette transporter, partial [Selaginella moellendorffii]
Length=524

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 137/177 (77%), Gaps = 4/177 (2%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LD+C+DT+IGG F RGVSGGERKRVCIG EI+I+PS++FLDEPTSGLDSTTALRI+ +LH
Sbjct  113  LDKCKDTIIGGPFERGVSGGERKRVCIGQEILIDPSIIFLDEPTSGLDSTTALRILQLLH  172

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +A+AG+TVITTIHQPSSRL+H FD L+LL  G  +++G+  +A+ YFSSIG +  + MN
Sbjct  173  GLAQAGRTVITTIHQPSSRLYHMFDNLLLLSNGHAIFFGRGQDALPYFSSIGLNASLLMN  232

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PA+FLLDLANGNI+D SIP EL  K+     + +     GKP    V EYLV C+ +
Sbjct  233  PADFLLDLANGNISDTSIPPELEIKL----IQSKGDSKVGKPPELAVQEYLVECFSS  285



>gb|KJB19218.1| hypothetical protein B456_003G089800 [Gossypium raimondii]
Length=567

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGG+F RG+SGGERKRVCI NEI++NPSLL LDEPTSGLDSTTAL+IV +L 
Sbjct  90   LERCQNTVIGGTFFRGISGGERKRVCIANEILLNPSLLLLDEPTSGLDSTTALQIVKMLR  149

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA++GKTV+TTIHQPSSRLF KFDKLILLGKGS LY+GK S+AM YFSS+GCSPLIAMN
Sbjct  150  NIARSGKTVVTTIHQPSSRLFSKFDKLILLGKGSSLYFGKVSDAMLYFSSMGCSPLIAMN  209

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  526
            PAEFL+DLANGNI D S+PS+L DK    N+  +    +G+ S   VHEYLV  Y
Sbjct  210  PAEFLIDLANGNIKDKSVPSDLEDKFFPRNNSLD--MKHGELSQVDVHEYLVEAY  262



>gb|KJB19215.1| hypothetical protein B456_003G089800 [Gossypium raimondii]
Length=498

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGG+F RG+SGGERKRVCI NEI++NPSLL LDEPTSGLDSTTAL+IV +L 
Sbjct  228  LERCQNTVIGGTFFRGISGGERKRVCIANEILLNPSLLLLDEPTSGLDSTTALQIVKMLR  287

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA++GKTV+TTIHQPSSRLF KFDKLILLGKGS LY+GK S+AM YFSS+GCSPLIAMN
Sbjct  288  NIARSGKTVVTTIHQPSSRLFSKFDKLILLGKGSSLYFGKVSDAMLYFSSMGCSPLIAMN  347

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  526
            PAEFL+DLANGNI D S+PS+L DK    N+  +    +G+ S   VHEYLV  Y
Sbjct  348  PAEFLIDLANGNIKDKSVPSDLEDKFFPRNNSLD--MKHGELSQVDVHEYLVEAY  400



>gb|KJB19216.1| hypothetical protein B456_003G089800 [Gossypium raimondii]
Length=632

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGG+F RG+SGGERKRVCI NEI++NPSLL LDEPTSGLDSTTAL+IV +L 
Sbjct  228  LERCQNTVIGGTFFRGISGGERKRVCIANEILLNPSLLLLDEPTSGLDSTTALQIVKMLR  287

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA++GKTV+TTIHQPSSRLF KFDKLILLGKGS LY+GK S+AM YFSS+GCSPLIAMN
Sbjct  288  NIARSGKTVVTTIHQPSSRLFSKFDKLILLGKGSSLYFGKVSDAMLYFSSMGCSPLIAMN  347

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  526
            PAEFL+DLANGNI D S+PS+L DK    N+  +    +G+ S   VHEYLV  Y
Sbjct  348  PAEFLIDLANGNIKDKSVPSDLEDKFFPRNNSLD--MKHGELSQVDVHEYLVEAY  400



>gb|KJB19217.1| hypothetical protein B456_003G089800 [Gossypium raimondii]
Length=705

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RCQ+T+IGG+F RG+SGGERKRVCI NEI++NPSLL LDEPTSGLDSTTAL+IV +L 
Sbjct  228  LERCQNTVIGGTFFRGISGGERKRVCIANEILLNPSLLLLDEPTSGLDSTTALQIVKMLR  287

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA++GKTV+TTIHQPSSRLF KFDKLILLGKGS LY+GK S+AM YFSS+GCSPLIAMN
Sbjct  288  NIARSGKTVVTTIHQPSSRLFSKFDKLILLGKGSSLYFGKVSDAMLYFSSMGCSPLIAMN  347

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  526
            PAEFL+DLANGNI D S+PS+L DK    N+  +    +G+ S   VHEYLV  Y
Sbjct  348  PAEFLIDLANGNIKDKSVPSDLEDKFFPRNNSLD--MKHGELSQVDVHEYLVEAY  400



>ref|XP_001763976.1| ATP-binding cassette transporter, subfamily G, member 4, group 
WBC protein PpABCG4 [Physcomitrella patens]
 gb|EDQ71115.1| ATP-binding cassette transporter, subfamily G, member 4, group 
WBC protein PpABCG4 [Physcomitrella patens]
Length=624

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LD+C+DT+IGG F RGVSGGERKRVCIG+EI+++PS LFLDEPTSGLDSTTALRI+ ++ 
Sbjct  145  LDKCRDTIIGGPFFRGVSGGERKRVCIGHEILVDPSCLFLDEPTSGLDSTTALRIIHVIR  204

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TV+TTIHQPSSRLF+ FDKLILL +G+ +Y+G A +A  YFSSIG +P IAMN
Sbjct  205  NLAKAGRTVLTTIHQPSSRLFYMFDKLILLSQGNSIYFGNACDAPNYFSSIGLTPFIAMN  264

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYE  529
            PA+F+LDLA+GN++D+SIP  L        S+         PS A VH YLV  +E
Sbjct  265  PADFILDLASGNLSDISIPPALEKTTSL--SRHCQKTPAPLPSSANVHSYLVQQFE  318



>ref|XP_011095584.1| PREDICTED: ABC transporter G family member 26 [Sesamum indicum]
Length=687

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG F++G+SGGERKR  IG+EI+++PSLL LDEPTSGLDST+A RI+ IL 
Sbjct  216  LERCRHTRIGGGFLKGISGGERKRTSIGHEILVDPSLLLLDEPTSGLDSTSANRILQILQ  275

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK G+TVITTIHQPSSR+FH FDK++L+ +G  +YYGKAS++M YFSS+   P +AMN
Sbjct  276  GLAKVGRTVITTIHQPSSRMFHMFDKVLLISEGYPIYYGKASDSMEYFSSLRFVPELAMN  335

Query  362  PAEFLLDLANGNINDVSIPSELADKVQT  445
            PAEFLLDLA G +ND+S+P EL +  +T
Sbjct  336  PAEFLLDLATGQVNDISVPEELFESQET  363



>ref|XP_002526137.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF36213.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=675

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 111/176 (63%), Gaps = 40/176 (23%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+R QDT IGG FVRG+SGGERKRVCIG+EI++NPSLLFLDEPTSGLDSTTALRIV IL 
Sbjct  239  LERSQDTAIGGKFVRGISGGERKRVCIGHEILLNPSLLFLDEPTSGLDSTTALRIVQILQ  298

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK GKTV+TTIHQPSS                                  CS  + MN
Sbjct  299  NMAKDGKTVVTTIHQPSS---------------------------------SCS--VTMN  323

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYE  529
            PAEFL+DLANGN+N+ S P EL DK    N         G PSPA VHEYL+  YE
Sbjct  324  PAEFLIDLANGNVNEKSFPLELEDKFFLENKT-----TKGLPSPADVHEYLLEAYE  374



>ref|XP_010542511.1| PREDICTED: ABC transporter G family member 26 isoform X1 [Tarenaya 
hassleriana]
Length=689

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 130/178 (73%), Gaps = 12/178 (7%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  I  EI+++PSLLFLDEPTSGLDST+A +++ IL 
Sbjct  216  LERCRHTRVGGGFVKGISGGERKRTSIAYEILVDPSLLFLDEPTSGLDSTSATKLLHILQ  275

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G  ++YGKA E M YFSS+   P IAMN
Sbjct  276  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGYPVFYGKARETMEYFSSLRIVPEIAMN  335

Query  362  PAEFLLDLANGNINDVSIPSE-LADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLDLA G + D+S+P E LA K    +S+E            IV +YL   Y+T
Sbjct  336  PAEFLLDLATGQVTDISLPDELLAAKASHPDSEE-----------VIVKQYLQLMYKT  382



>gb|KDO59196.1| hypothetical protein CISIN_1g044602mg [Citrus sinensis]
Length=674

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG F++G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A +++ +L 
Sbjct  218  LERCRHTRVGGGFIKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANKLIQVLQ  277

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++AKAG+TVITTIHQPSSR+FH FDKL+L+ +G  +YYGKA E+M YFSS+G  P IAMN
Sbjct  278  KVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGYPVYYGKARESMEYFSSLGFIPEIAMN  337

Query  362  PAEFLLDLANGNINDVSIPSELA  430
            PAEFLLDLA G + D+S+P  L+
Sbjct  338  PAEFLLDLATGQVTDISVPEALS  360



>ref|XP_006474829.1| PREDICTED: ABC transporter G family member 26-like [Citrus sinensis]
Length=687

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG F++G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A +++ +L 
Sbjct  218  LERCRHTRVGGGFIKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANKLIQVLQ  277

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++AKAG+TVITTIHQPSSR+FH FDKL+L+ +G  +YYGKA E+M YFSS+G  P IAMN
Sbjct  278  KVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGYPVYYGKARESMEYFSSLGFIPEIAMN  337

Query  362  PAEFLLDLANGNINDVSIPSELA  430
            PAEFLLDLA G + D+S+P  L+
Sbjct  338  PAEFLLDLATGQVTDISVPEALS  360



>ref|XP_006452648.1| hypothetical protein CICLE_v10010223mg [Citrus clementina]
 gb|ESR65888.1| hypothetical protein CICLE_v10010223mg [Citrus clementina]
Length=687

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG F++G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A +++ +L 
Sbjct  218  LERCRHTRVGGGFIKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANKLIQVLQ  277

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++AKAG+TVITTIHQPSSR+FH FDKL+L+ +G  +YYGKA E+M YFSS+G  P IAMN
Sbjct  278  KVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGYPVYYGKARESMEYFSSLGFIPEIAMN  337

Query  362  PAEFLLDLANGNINDVSIPSELA  430
            PAEFLLDLA G + D+S+P  L+
Sbjct  338  PAEFLLDLATGQVTDISVPEALS  360



>ref|XP_009628134.1| PREDICTED: ABC transporter G family member 26 [Nicotiana tomentosiformis]
Length=685

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG  V+GVSGGERKR  IG+EI+++PSLL LDEPTSGLDST+A R++ IL 
Sbjct  217  LERCRHTRIGGGLVKGVSGGERKRASIGHEILVDPSLLLLDEPTSGLDSTSANRLLQILQ  276

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK GKT+ITTIHQPSSR+FH F+K++L+ +G  +YYGKA E+M YFSS+G  P IAMN
Sbjct  277  GLAKMGKTIITTIHQPSSRIFHMFEKILLISEGYPVYYGKARESMEYFSSLGFIPEIAMN  336

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G +ND+SIP +L
Sbjct  337  PAEFLLDLATGQVNDISIPDDL  358



>ref|XP_009781518.1| PREDICTED: ABC transporter G family member 26 [Nicotiana sylvestris]
Length=685

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG  V+GVSGGERKR  IG+EI+++PSLL LDEPTSGLDST+A R++ IL 
Sbjct  217  LERCRHTRIGGGLVKGVSGGERKRASIGHEILVDPSLLLLDEPTSGLDSTSANRLLQILQ  276

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK GKT+ITTIHQPSSR+FH F+K++L+ +G  +YYGKA E+M YFSS+G  P IAMN
Sbjct  277  GLAKMGKTIITTIHQPSSRIFHMFEKILLISEGYPVYYGKARESMEYFSSLGFIPEIAMN  336

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G +ND+SIP +L
Sbjct  337  PAEFLLDLATGQVNDISIPDDL  358



>emb|CAN73913.1| hypothetical protein VITISV_035231 [Vitis vinifera]
Length=665

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A R++ IL 
Sbjct  194  LERCRHTKVGGGFVKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANRLLQILQ  253

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+T+ITTIHQPSSR+FH F+K++L+ +G  +YYGKA E+M YFSS+   P IAMN
Sbjct  254  GVAKAGRTIITTIHQPSSRMFHMFNKILLIAEGYPVYYGKARESMDYFSSLRFVPEIAMN  313

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G +ND+SIP +L
Sbjct  314  PAEFLLDLATGQVNDISIPQDL  335



>gb|EYU27464.1| hypothetical protein MIMGU_mgv1a002345mg [Erythranthe guttata]
Length=685

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG F++G+SGGERKR  IG+EI+++PSLL LDEPTSGLDST+A R++ IL 
Sbjct  213  LERCRHTRIGGGFIKGISGGERKRTSIGHEILVDPSLLLLDEPTSGLDSTSANRLLQILQ  272

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++ KAG+T+ITTIHQPSSR+FHKFD+++L+ +G  +YYGKA ++M YFS +   P I MN
Sbjct  273  DLGKAGRTIITTIHQPSSRMFHKFDRVLLIAEGYPVYYGKARDSMEYFSCLRFIPQIPMN  332

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G +ND+S+P EL
Sbjct  333  PAEFLLDLATGQVNDISVPDEL  354



>ref|XP_010542512.1| PREDICTED: ABC transporter G family member 26 isoform X2 [Tarenaya 
hassleriana]
Length=688

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  I  EI+++PSLLFLDEPTSGLDST+A +++ IL 
Sbjct  216  LERCRHTRVGGGFVKGISGGERKRTSIAYEILVDPSLLFLDEPTSGLDSTSATKLLHILQ  275

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G  ++YGKA E M YFSS+   P IAMN
Sbjct  276  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGYPVFYGKARETMEYFSSLRIVPEIAMN  335

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G + D+S+P EL
Sbjct  336  PAEFLLDLATGQVTDISLPDEL  357



>ref|XP_002867504.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43763.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=639

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LDRC+DT+IGG F+RGVSGGERKRV IG EI+INPSLLFLDEPTSGLDSTTA RIV IL 
Sbjct  177  LDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSILW  236

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIA-M  358
            E+A+ G+TV+TTIHQPSSRLF+ FDKL+LL +G+ +Y+G  S AM YF+S+GCSP +  +
Sbjct  237  ELARGGRTVVTTIHQPSSRLFYMFDKLLLLSEGNPIYFGLGSSAMDYFASVGCSPSVERI  296

Query  359  NPAEFLLDLANGNINDVS  412
            NP++FLLD+ANG  +D S
Sbjct  297  NPSDFLLDIANGVGSDES  314



>ref|XP_002267511.2| PREDICTED: ABC transporter G family member 26 [Vitis vinifera]
 emb|CBI39781.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A R++ IL 
Sbjct  215  LERCRHTKVGGGFVKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANRLLQILQ  274

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+T+ITTIHQPSSR+FH F+K++L+ +G  +YYGKA E+M YFSS+   P IAMN
Sbjct  275  GVAKAGRTIITTIHQPSSRMFHMFNKILLIAEGYPVYYGKARESMDYFSSLRFVPEIAMN  334

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G +ND+SIP +L
Sbjct  335  PAEFLLDLATGQVNDISIPQDL  356



>ref|XP_009124723.1| PREDICTED: ABC transporter G family member 26 [Brassica rapa]
 emb|CDY43362.1| BnaA01g29930D [Brassica napus]
Length=681

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  I  EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  209  LERCRHTRVGGGFVKGISGGERKRTSIAYEILVDPSLLLLDEPTSGLDSTSATKLLHILQ  268

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G   YYGKA EAM YFSS+   P IAMN
Sbjct  269  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGHPAYYGKAREAMEYFSSLRILPEIAMN  328

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G ++D+S+P EL
Sbjct  329  PAEFLLDLATGQVSDISLPEEL  350



>emb|CDY24203.1| BnaC01g37830D [Brassica napus]
Length=681

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  I  EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  209  LERCRHTRVGGGFVKGISGGERKRTSIAYEILVDPSLLLLDEPTSGLDSTSATKLLHILQ  268

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G   YYGKA EAM YFSS+   P IAMN
Sbjct  269  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGHPAYYGKAREAMEYFSSLRILPEIAMN  328

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G ++D+S+P EL
Sbjct  329  PAEFLLDLATGQVSDISLPEEL  350



>ref|NP_194472.3| ABC transporter G family member 9 [Arabidopsis thaliana]
 sp|Q9SZR9.2|AB9G_ARATH RecName: Full=ABC transporter G family member 9; Short=ABC transporter 
ABCG.9; Short=AtABCG9; AltName: Full=Probable white-brown 
complex homolog protein 9; Short=AtWBC9 [Arabidopsis 
thaliana]
 gb|AEE85338.1| ABC transporter G family member 9 [Arabidopsis thaliana]
Length=638

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LDRC+DT+IGG F+RGVSGGERKRV IG EI+INPSLLFLDEPTSGLDSTTA RIV IL 
Sbjct  176  LDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSILW  235

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIA-M  358
            E+A+ G+TV+TTIHQPSSRLF+ FDKL+LL +G+ +Y+G  S AM YF+S+G SPL+  +
Sbjct  236  ELARGGRTVVTTIHQPSSRLFYMFDKLLLLSEGNPVYFGLGSNAMDYFASVGYSPLVERI  295

Query  359  NPAEFLLDLANGNINDVS  412
            NP++FLLD+ANG  +D S
Sbjct  296  NPSDFLLDIANGVGSDES  313



>gb|KFK38655.1| hypothetical protein AALP_AA3G143100 [Arabis alpina]
Length=685

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  I  EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  213  LERCRHTRVGGGFVKGISGGERKRTSIAYEILVDPSLLLLDEPTSGLDSTSATKLLHILQ  272

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G   +YGKA E+M YFSS+   P IAMN
Sbjct  273  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGHPAFYGKARESMEYFSSLRILPEIAMN  332

Query  362  PAEFLLDLANGNINDVSIPSELA  430
            PAEFLLDLA G ++D+S+P EL+
Sbjct  333  PAEFLLDLATGQVSDISLPDELS  355



>ref|XP_002884953.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61212.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=685

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  I  EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  213  LERCRRTRVGGGFVKGISGGERKRASIAYEILVDPSLLLLDEPTSGLDSTSATKLLHILQ  272

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G   +YGKA E+M YFSS+   P IAMN
Sbjct  273  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGHPAFYGKAKESMEYFSSLRILPEIAMN  332

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G ++D+S+P EL
Sbjct  333  PAEFLLDLATGQVSDISLPDEL  354



>ref|XP_006346115.1| PREDICTED: ABC transporter G family member 26-like [Solanum tuberosum]
Length=684

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG  V+GVSGGERKR  IG+EI+++PSLL LDEPTSGLDST+A R++ +L 
Sbjct  216  LERCRHTRIGGGLVKGVSGGERKRASIGHEILVDPSLLLLDEPTSGLDSTSANRLLQVLQ  275

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK GKT+ITTIHQPSSR+FH F+K++L+ +G  +YYGKA ++M YFSS+G  P IAMN
Sbjct  276  GLAKMGKTIITTIHQPSSRIFHMFEKILLIAEGYPVYYGKAGDSMEYFSSLGFIPEIAMN  335

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEE  463
            PAEFLLDLA G +ND+S+P +L    Q  N +E+
Sbjct  336  PAEFLLDLATGQVNDISVPDDLYPP-QVTNEREK  368



>ref|XP_010465139.1| PREDICTED: ABC transporter G family member 26 [Camelina sativa]
Length=670

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  I  EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  198  LERCRRTRVGGGFVKGISGGERKRASIAYEILVDPSLLLLDEPTSGLDSTSATKLLHILQ  257

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G   +YGKA E+M YFSS+   P IAMN
Sbjct  258  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGHPAFYGKARESMEYFSSLRILPEIAMN  317

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G ++D+S+P EL
Sbjct  318  PAEFLLDLATGQVSDISLPEEL  339



>ref|XP_010500190.1| PREDICTED: ABC transporter G family member 26-like [Camelina 
sativa]
Length=685

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  I  EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  213  LERCRRTRVGGGFVKGISGGERKRASIAYEILVDPSLLLLDEPTSGLDSTSATKLLHILQ  272

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G   +YGKA E+M YFSS+   P IAMN
Sbjct  273  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGHPAFYGKARESMEYFSSLRILPEIAMN  332

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G ++D+S+P EL
Sbjct  333  PAEFLLDLATGQVSDISLPEEL  354



>ref|XP_010265777.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
26-like [Nelumbo nucifera]
Length=688

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 125/177 (71%), Gaps = 17/177 (10%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG+FV+G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  216  LERCRHTRIGGAFVKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANKLLHILQ  275

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IAKAG+T+I TIHQPSSR+FH F+K++L+ +G  +YYG A E+M YFSS+   P IAMN
Sbjct  276  GIAKAGRTIIITIHQPSSRMFHMFNKILLISEGCPVYYGNARESMEYFSSLRFXPQIAMN  335

Query  362  PAEFLLDLANGNINDVSIPSELAD-----------------KVQTWNSKEEPTRNNG  481
            PAEFLLDLA G +ND+S+P +L                   K + W   +E   N+G
Sbjct  336  PAEFLLDLATGQVNDISVPEDLVMLQGTPEFERDVVKYVQLKYKVWVEPKEKAENHG  392



>ref|XP_006300234.1| hypothetical protein CARUB_v10016471mg [Capsella rubella]
 gb|EOA33132.1| hypothetical protein CARUB_v10016471mg [Capsella rubella]
Length=685

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  I  EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  213  LERCRRTRVGGGFVKGISGGERKRASIAYEILVDPSLLLLDEPTSGLDSTSATKLLHILQ  272

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G   +YGKA E+M YFSS+   P IAMN
Sbjct  273  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGHPAFYGKARESMEYFSSLRILPEIAMN  332

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G ++D+S+P EL
Sbjct  333  PAEFLLDLATGQVSDISLPEEL  354



>ref|XP_006359003.1| PREDICTED: ABC transporter G family member 9-like [Solanum tuberosum]
Length=628

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 119/144 (83%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L +C+D ++GG F+RG+SGGERKRV IG E++INPSLLFLDEPTSGLDSTTALRIV  L 
Sbjct  168  LTKCKDIIVGGPFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTALRIVSTLR  227

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++AK G+TV+ TIHQPSSRLF+ F K++LL +G+ LY+G+  +AM YFS IG SPL+AMN
Sbjct  228  DLAKGGRTVVLTIHQPSSRLFYMFKKVLLLSEGNPLYFGRGEDAMGYFSGIGFSPLVAMN  287

Query  362  PAEFLLDLANGNINDVSIPSELAD  433
            P++FLLDL+NG ++D   P  LAD
Sbjct  288  PSDFLLDLSNGILSDD--PRVLAD  309



>emb|CDP13689.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG FVRG+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A RI+ IL 
Sbjct  208  LERCRHTRIGGGFVRGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANRILQILQ  267

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+T++TTIHQPSSR+FH FDK++L+ +G  LY GKA EA+ YFSS+   P +AMN
Sbjct  268  RLAKAGRTIVTTIHQPSSRIFHMFDKVLLIAQGYPLYCGKAREAVEYFSSLRFIPEMAMN  327

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLL+LA G ++D+S+P +L
Sbjct  328  PAEFLLELAAGQVDDISVPEDL  349



>ref|XP_002522797.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF39648.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=687

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG F++G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A R++ +L 
Sbjct  217  LERCRHTRIGGGFIKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANRLLQVLQ  276

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G  +YYGKA ++M YFSS+   P I MN
Sbjct  277  GLAKAGRTVITTIHQPSSRMFHMFDKLLLISEGYPVYYGKARDSMEYFSSLSFIPEITMN  336

Query  362  PAEFLLDLANGNINDVSIPSELA  430
            PAEFL+DLA G +ND+S+P +L+
Sbjct  337  PAEFLIDLATGQVNDISVPQDLS  359



>gb|KJB22183.1| hypothetical protein B456_004G033800 [Gossypium raimondii]
Length=630

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG  V+G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  218  LERCRHTRIGGGLVKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANKLIHILQ  277

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G  +Y GKA E M YFSS+   P IAMN
Sbjct  278  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGYPIYSGKARECMEYFSSLRFIPEIAMN  337

Query  362  PAEFLLDLANGNINDVSIPSELA  430
            PAEFLLDLA G +ND+++P +L 
Sbjct  338  PAEFLLDLATGQVNDITLPEDLV  360



>ref|NP_187928.2| ABC transporter G family member 26 [Arabidopsis thaliana]
 sp|Q9LK50.2|AB26G_ARATH RecName: Full=ABC transporter G family member 26; Short=ABC transporter 
ABCG.26; Short=AtABCG26; AltName: Full=Putative white-brown 
complex homolog protein 27; Short=AtWBC27 [Arabidopsis 
thaliana]
 gb|AEE75312.1| ABC transporter G family member 26 [Arabidopsis thaliana]
Length=685

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  I  EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  213  LERCRRTRVGGGFVKGISGGERKRASIAYEILVDPSLLLLDEPTSGLDSTSATKLLHILQ  272

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G   +YGKA E+M YFSS+   P IAMN
Sbjct  273  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGHPAFYGKARESMEYFSSLRILPEIAMN  332

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G ++D+S+P EL
Sbjct  333  PAEFLLDLATGQVSDISLPDEL  354



>ref|XP_004498150.1| PREDICTED: ABC transporter G family member 26-like [Cicer arietinum]
Length=686

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 133/177 (75%), Gaps = 11/177 (6%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG F++G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A +++  L 
Sbjct  218  LERCRHTKIGGGFLKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANKLLVTLQ  277

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+T+ITTIHQPSSR+FH FDKL+L+ +G  +YYG A E M YFSS+  SP IAMN
Sbjct  278  GLAKAGRTIITTIHQPSSRIFHMFDKLLLISEGYPIYYGAARETMEYFSSLRFSPEIAMN  337

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYET  532
            PAEFLLD+A G +ND+S+P+++ +        +E T +   PS A++ +YL   Y+T
Sbjct  338  PAEFLLDMATGEVNDISVPTDIFE-------DQESTHD---PSEAVI-KYLQLKYKT  383



>ref|XP_004252105.1| PREDICTED: ABC transporter G family member 9-like [Solanum lycopersicum]
Length=628

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L +C+D ++GG F+RG+SGGERKRV IG E++INPSLLFLDEPTSGLDSTTALRIV  L 
Sbjct  168  LTKCKDIIVGGPFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTALRIVSSLR  227

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++AK GKTV+ TIHQPSSRLF+ F K++LL +G+ LY+G+  +AM YFS IG SPL+AMN
Sbjct  228  DLAKGGKTVVLTIHQPSSRLFYMFKKVLLLSEGNPLYFGRGEDAMGYFSGIGFSPLVAMN  287

Query  362  PAEFLLDLANGNIND  406
            P++FLLDL+NG ++D
Sbjct  288  PSDFLLDLSNGILSD  302



>ref|XP_006407250.1| hypothetical protein EUTSA_v10020198mg [Eutrema salsugineum]
 gb|ESQ48703.1| hypothetical protein EUTSA_v10020198mg [Eutrema salsugineum]
Length=685

 Score =   177 bits (450),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  I  EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  213  LERCRRTRVGGGFVKGISGGERKRTSIAYEILVDPSLLLLDEPTSGLDSTSATKLLHILQ  272

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G   +YGKA E+M YFSS+   P IAMN
Sbjct  273  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGHPAFYGKARESMDYFSSLRILPEIAMN  332

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G ++D+S+P EL
Sbjct  333  PAEFLLDLATGQVSDISLPDEL  354



>ref|XP_007020427.1| ABC-2 type transporter family protein [Theobroma cacao]
 gb|EOY11952.1| ABC-2 type transporter family protein [Theobroma cacao]
Length=687

 Score =   177 bits (450),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG  V+G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  216  LERCRHTRIGGGLVKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANKLIQILQ  275

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G  +Y GKA E+M YFSS+   P IAMN
Sbjct  276  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGYPVYCGKARESMEYFSSLRFIPEIAMN  335

Query  362  PAEFLLDLANGNINDVSIPSELA  430
            PAEFLLDLA G +ND+++P +L 
Sbjct  336  PAEFLLDLATGQVNDITLPEDLV  358



>ref|XP_010676075.1| PREDICTED: ABC transporter G family member 26 [Beta vulgaris 
subsp. vulgaris]
Length=684

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG  +RG+SGGERKR  IG EI++ PSLL LDEPTSGLDST+A R++ IL 
Sbjct  213  LERCRHTRVGGGLIRGISGGERKRTSIGYEILVEPSLLLLDEPTSGLDSTSANRLIQILQ  272

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+T+ITTIHQPSSR+FH FDK++LL +G  +YYGKA E M YFSS+  +P I MN
Sbjct  273  GLAKAGRTIITTIHQPSSRMFHMFDKILLLSEGYPVYYGKAWETMDYFSSLRFNPEIPMN  332

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G +ND+S+P E+
Sbjct  333  PAEFLLDLATGQVNDISVPDEV  354



>gb|AFW87232.1| hypothetical protein ZEAMMB73_313043 [Zea mays]
 gb|AFW87233.1| SEC14-like protein 1 isoform 2 [Zea mays]
Length=606

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG+FVRGVSGGERKR  IGNEI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  136  LERCRHTKIGGAFVRGVSGGERKRTSIGNEILVDPSLLLLDEPTSGLDSTSASKLIFILQ  195

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK  +T+ITTIHQPSSR+FH FDKL+L+  G  +Y+GKA + M +FSS+G  P I MN
Sbjct  196  RLAKTRRTIITTIHQPSSRMFHMFDKLLLISDGHAIYHGKARDCMHHFSSLGFVPEIPMN  255

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA GN++D+S+P  L
Sbjct  256  PAEFLLDLATGNLDDISVPEAL  277



>ref|XP_007140114.1| hypothetical protein PHAVU_008G085200g [Phaseolus vulgaris]
 gb|ESW12108.1| hypothetical protein PHAVU_008G085200g [Phaseolus vulgaris]
Length=535

 Score =   176 bits (446),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 87/142 (61%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T I G +++G+SGGERKR CIG EI+++PSLL LDEPTSGLDS++A +++  L 
Sbjct  65   LERCRHTKIAGGYLKGISGGERKRTCIGYEILVDPSLLLLDEPTSGLDSSSANKLLLTLQ  124

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+T+ITTIHQPSSR+FH FDKL+L+ +G  +YYGKA E M YFSS+  +P I MN
Sbjct  125  GLAKAGRTIITTIHQPSSRIFHMFDKLLLISEGYPVYYGKAKETMEYFSSLRFTPQIPMN  184

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G +ND+S+P+++
Sbjct  185  PAEFLLDLATGQVNDISVPTDI  206



>ref|XP_002969079.1| ATP-binding cassette transporter, partial [Selaginella moellendorffii]
 gb|EFJ30195.1| ATP-binding cassette transporter, partial [Selaginella moellendorffii]
Length=580

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T+IGG F+ GVSGGERKR  IG+EI+I+PSLL LDEPTSGLDS TAL+I+ ++ 
Sbjct  111  LERCRHTIIGGPFIPGVSGGERKRTSIGSEILIDPSLLLLDEPTSGLDSATALKILQVVG  170

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AG+T++TTIHQPSSRLFH FDKLIL+ +G  +Y G A E M+YFSS+   P I MN
Sbjct  171  NIAQAGRTILTTIHQPSSRLFHMFDKLILISEGHTIYSGPAREVMSYFSSLHFVPEITMN  230

Query  362  PAEFLLDLANGNINDVSIPSELADK  436
            PA+FLLDLA G ++D+SIP E+ ++
Sbjct  231  PADFLLDLAVGVVHDISIPEEITNR  255



>gb|KDP39319.1| hypothetical protein JCGZ_01076 [Jatropha curcas]
Length=687

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG F++G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A R++++L 
Sbjct  216  LERCRQTRVGGGFIKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANRLLEVLQ  275

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK G+T+ITTIHQPSSR+FH FDKL+L+ +G  +YYGKA + M YFSS+   P IAMN
Sbjct  276  GLAKGGRTIITTIHQPSSRMFHMFDKLLLISEGYPVYYGKARDCMDYFSSLRFIPEIAMN  335

Query  362  PAEFLLDLANGNINDVSIPSELA  430
            PAEFLLDLA G +NDVS+P +L+
Sbjct  336  PAEFLLDLATGQVNDVSVPHDLS  358



>gb|ACN27720.1| unknown [Zea mays]
 gb|AFW87234.1| ABC transporter-like protein [Zea mays]
Length=663

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG+FVRGVSGGERKR  IGNEI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  193  LERCRHTKIGGAFVRGVSGGERKRTSIGNEILVDPSLLLLDEPTSGLDSTSASKLIFILQ  252

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK  +T+ITTIHQPSSR+FH FDKL+L+  G  +Y+GKA + M +FSS+G  P I MN
Sbjct  253  RLAKTRRTIITTIHQPSSRMFHMFDKLLLISDGHAIYHGKARDCMHHFSSLGFVPEIPMN  312

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA GN++D+S+P  L
Sbjct  313  PAEFLLDLATGNLDDISVPEAL  334



>ref|NP_001151511.1| ABC transporter-like protein [Zea mays]
 gb|ACG43128.1| ABC transporter-like protein [Zea mays]
Length=663

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG+FVRGVSGGERKR  IGNEI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  193  LERCRHTKIGGAFVRGVSGGERKRTSIGNEILVDPSLLLLDEPTSGLDSTSASKLIFILQ  252

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK  +T+ITTIHQPSSR+FH FDKL+L+  G  +Y+GKA + M +FSS+G  P I MN
Sbjct  253  RLAKTRRTIITTIHQPSSRMFHMFDKLLLISDGHAIYHGKARDCMHHFSSLGFVPEIPMN  312

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA GN++D+S+P  L
Sbjct  313  PAEFLLDLATGNLDDISVPEAL  334



>ref|XP_002992849.1| hypothetical protein SELMODRAFT_136119, partial [Selaginella 
moellendorffii]
 gb|EFJ06040.1| hypothetical protein SELMODRAFT_136119, partial [Selaginella 
moellendorffii]
Length=580

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 124/160 (78%), Gaps = 4/160 (3%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T+IGG F+ GVSGGERKR  IG+EI+I+PSLL LDEPTSGLDS TAL+I+ ++ 
Sbjct  111  LERCRHTIIGGPFIPGVSGGERKRTSIGSEILIDPSLLLLDEPTSGLDSATALKILQVVG  170

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             IA+AG+T++TTIHQPSSRLFH FDKLIL+ +G  +Y G A E M+YFSS+   P I MN
Sbjct  171  NIAQAGRTILTTIHQPSSRLFHMFDKLILISEGHTIYSGPAREVMSYFSSLHFVPEITMN  230

Query  362  PAEFLLDLANGNINDVSIPSELADKVQTWNSKEEPTRNNG  481
            PA+FLLDLA G ++D+SIP ++ ++    + +EE   N G
Sbjct  231  PADFLLDLAVGVVHDISIPEDITNR----SPEEEKLDNAG  266



>gb|KFK29257.1| hypothetical protein AALP_AA7G109600 [Arabis alpina]
Length=639

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LDRC+DT+IGG F+RGVSGGERKRV IG EI+INPSLLFLDEPTSGLDSTTA RIV IL 
Sbjct  177  LDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSILW  236

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIA-M  358
            E+A+ G+TV+TTIHQPSSRLF+ FDKL+LL  G+ +Y+G  S AM YF+S+G SP +  +
Sbjct  237  ELARGGRTVVTTIHQPSSRLFYMFDKLLLLSDGNPVYFGLGSHAMDYFASVGYSPSVERI  296

Query  359  NPAEFLLDLANGNINDVS  412
            NP++FLLD+ANG  +D S
Sbjct  297  NPSDFLLDIANGVGSDES  314



>ref|XP_010487069.1| PREDICTED: ABC transporter G family member 26-like [Camelina 
sativa]
Length=685

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  +  EI+++PSLL LDEPTSGLDST+A +++ IL 
Sbjct  213  LERCRRTRVGGGFVKGISGGERKRASVAYEILVDPSLLLLDEPTSGLDSTSATKLLHILQ  272

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G   +YGKA E+M YF+S+   P IAMN
Sbjct  273  GVAKAGRTVITTIHQPSSRMFHMFDKLLLISEGHPAFYGKARESMEYFASLRILPEIAMN  332

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G ++D+S+P EL
Sbjct  333  PAEFLLDLATGQVSDISLPEEL  354



>dbj|BAB01414.1| ABC transporter-like protein [Arabidopsis thaliana]
Length=693

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = +2

Query  5    DRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHE  184
            +RC+ T +GG FV+G+SGGERKR  I  EI+++PSLL LDEPTSGLDST+A +++ IL  
Sbjct  222  ERCRRTRVGGGFVKGISGGERKRASIAYEILVDPSLLLLDEPTSGLDSTSATKLLHILQG  281

Query  185  IAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMNP  364
            +AKAG+TVITTIHQPSSR+FH FDKL+L+ +G   +YGKA E+M YFSS+   P IAMNP
Sbjct  282  VAKAGRTVITTIHQPSSRMFHMFDKLLLISEGHPAFYGKARESMEYFSSLRILPEIAMNP  341

Query  365  AEFLLDLANGNINDVSIPSEL  427
            AEFLLDLA G ++D+S+P EL
Sbjct  342  AEFLLDLATGQVSDISLPDEL  362



>ref|XP_002300394.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEE85199.2| ABC transporter family protein [Populus trichocarpa]
Length=662

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            ++RC+ + +GG FV+G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A R++ IL 
Sbjct  217  IERCRHSRVGGGFVKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANRLLQILQ  276

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+T+ITTIHQPSSR+FH FDKL+L+ +G  +YYGKA E+M YFS +   P IAMN
Sbjct  277  GLAKAGRTIITTIHQPSSRIFHMFDKLLLISEGYPVYYGKARESMEYFSCLRFIPEIAMN  336

Query  362  PAEFLLDLANGNINDVSIPSELA  430
            PAEFLLDLA G +ND+S+P +L+
Sbjct  337  PAEFLLDLATGQVNDISVPEDLS  359



>ref|XP_011038858.1| PREDICTED: ABC transporter G family member 26 [Populus euphratica]
Length=689

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            ++RC+ + +GG FV+G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A R++ IL 
Sbjct  218  IERCRHSRVGGGFVKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANRLLQILQ  277

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+T+ITTIHQPSSR+FH FDKL+L+ +G  +YYGKA E+M YFS +   P IAMN
Sbjct  278  GLAKAGRTIITTIHQPSSRIFHMFDKLLLISEGYPVYYGKARESMEYFSCLRFIPEIAMN  337

Query  362  PAEFLLDLANGNINDVSIPSELA  430
            PAEFLLDLA G +ND+S+P +L+
Sbjct  338  PAEFLLDLATGQVNDISVPEDLS  360



>ref|XP_004244029.1| PREDICTED: ABC transporter G family member 26 [Solanum lycopersicum]
Length=684

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG  V+GVSGGERKR  IG+EI+++PSLL LDEPTSGLDST+A R++ +L 
Sbjct  216  LERCRHTRIGGGLVKGVSGGERKRASIGHEILVDPSLLLLDEPTSGLDSTSANRLLQVLQ  275

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK GKT+ITTIHQPSSR+FH F+K++L+ +G  +YYGKA ++M YFSS+G  P IAMN
Sbjct  276  GLAKMGKTIITTIHQPSSRIFHMFEKILLIAEGYPVYYGKARDSMEYFSSLGFIPEIAMN  335

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDLA G +ND+ +P +L
Sbjct  336  PAEFLLDLATGQVNDIIVPDDL  357



>ref|XP_008797781.1| PREDICTED: ABC transporter G family member 26 [Phoenix dactylifera]
Length=645

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T +GG FV+G+SGGERKR  IG EI+++PSLL LDEPTSGLDST+A +++ +L 
Sbjct  174  LERCRRTKVGGVFVKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSASKLLMVLQ  233

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AK G+T+ITTIHQPSSR+FH FDKL+L+ +G  +Y+GKA E+M YF+S+G  P IAMN
Sbjct  234  NLAKTGRTIITTIHQPSSRMFHMFDKLLLISEGYPIYHGKARESMQYFASLGFVPEIAMN  293

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAEFLLDL  G+ ND+SIP +L
Sbjct  294  PAEFLLDLVTGHANDISIPEDL  315



>ref|XP_010520902.1| PREDICTED: ABC transporter G family member 9-like [Tarenaya hassleriana]
Length=620

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L RC++++IGG F+RG+SGGERKRV IG EI+INPSLLFLDEPTSGLDSTTA RIV +L 
Sbjct  161  LARCKNSIIGGMFLRGISGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSVLW  220

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            E+A+ G+TV+ TIHQPSSRLF+ FDK++LL +G+ LYYG+ S  M YF+S+G SP +AMN
Sbjct  221  ELAQGGRTVVMTIHQPSSRLFYMFDKILLLSEGNPLYYGRGSNVMDYFASVGYSPSLAMN  280

Query  362  PAEFLLDLANGNINDVSIPSE  424
            P++FLLD+ANG  +D S+  +
Sbjct  281  PSDFLLDIANGVASDESMKQD  301



>ref|XP_006413078.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
 gb|ESQ54531.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
Length=640

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            LDRC+DT+IGG F+RGVSGGERKRV IG EI+INPSLLFLDEPTSGLDSTTA RIV IL 
Sbjct  178  LDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSILW  237

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIA-M  358
            E+A  G+TVITTIHQPSSRLF+ FDK++LL +G+ +Y+G  S AM YF+S+G SP +  +
Sbjct  238  ELAHGGRTVITTIHQPSSRLFYMFDKILLLSEGNPVYFGLGSNAMDYFASVGYSPSVERI  297

Query  359  NPAEFLLDLANGNINDVS  412
            NP++FLLD+ANG  +D S
Sbjct  298  NPSDFLLDIANGVGSDES  315



>emb|CBI20349.3| unnamed protein product [Vitis vinifera]
Length=574

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L +C+D++IG  F+RGVSGGERKRV IG E++INPSLLFLDEPTSGLDSTTA RIV  L 
Sbjct  167  LTKCKDSIIGNPFLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLW  226

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            E+AK G+TV+ TIHQPSSRLF+ F K++LL +G+ LY+GK +EAM YFSSIG +P +AMN
Sbjct  227  ELAKGGRTVVMTIHQPSSRLFYMFHKVLLLSEGNPLYFGKGAEAMDYFSSIGFAPSVAMN  286

Query  362  PAEFLLDLANGNIND  406
            P++FLLDLANG ++D
Sbjct  287  PSDFLLDLANGVLSD  301



>ref|XP_009766511.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=637

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L RC+D++IGG  +RG+SGGERKRV IG E++INPSLLFLDEPTSGLDSTTA RIV  L 
Sbjct  177  LTRCKDSIIGGPLLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLR  236

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++AK G+T++ TIHQPSSRLF+ F K++LL +G+ LY+G+  +AM YFSS+G SPL+AMN
Sbjct  237  DLAKGGRTIVMTIHQPSSRLFYMFHKVLLLSEGNPLYFGRGEDAMGYFSSVGYSPLVAMN  296

Query  362  PAEFLLDLANGNIND  406
            P++FLLDL+NG ++D
Sbjct  297  PSDFLLDLSNGILSD  311



>ref|XP_010063246.1| PREDICTED: ABC transporter G family member 26 [Eucalyptus grandis]
 gb|KCW70456.1| hypothetical protein EUGRSUZ_F03676 [Eucalyptus grandis]
Length=686

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG FV+G+SGGERKR  +  EI+++PSLL LDEPTSGLDST+A R++ IL 
Sbjct  216  LERCRHTRIGGVFVKGISGGERKRTSLAYEILVDPSLLLLDEPTSGLDSTSATRLMQILE  275

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+T+I TIHQPSSR+FH FDKL+L+ +G  +YYGKA EA+ YFSS+   P I MN
Sbjct  276  GVAKAGRTIIITIHQPSSRMFHMFDKLLLIAEGYPVYYGKAREAIEYFSSLSFIPEITMN  335

Query  362  PAEFLLDLANGNINDVSIPSELA  430
            PAEFLLDLA G + D+S+P EL+
Sbjct  336  PAEFLLDLATGQVKDISVPEELS  358



>ref|XP_006857737.1| hypothetical protein AMTR_s00061p00187570 [Amborella trichopoda]
 gb|ERN19204.1| hypothetical protein AMTR_s00061p00187570 [Amborella trichopoda]
Length=686

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+ T IGG+FV+G+SGGERKR  IG EI+++PSLL LDEPTSGLDS+TA +++ +L 
Sbjct  215  LERCRHTKIGGAFVKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSSTANKLLQVLQ  274

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
             +AKAG+T+ITTIHQPSSR+FH FDKL+L+ +G  +Y+G+A ++M YFSS+G  P +AMN
Sbjct  275  GLAKAGRTIITTIHQPSSRMFHMFDKLLLISEGCAIYHGQAQDSMNYFSSLGFVPELAMN  334

Query  362  PAEFLLDLANGNINDVSIPSEL  427
            PAE+LLDLA G +N++  P E+
Sbjct  335  PAEYLLDLATGRVNNIRFPEEI  356



>emb|CAN62144.1| hypothetical protein VITISV_007841 [Vitis vinifera]
Length=603

 Score =   174 bits (442),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L +C+D++IG  F+RGVSGGERKRV IG E++INPSLLFLDEPTSGLDSTTA RIV  L 
Sbjct  170  LTKCKDSIIGNPFLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLW  229

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            E+AK G+TV+ TIHQPSSRLF+ F K++LL +G+ LY+GK +EAM YFSSIG +P +AMN
Sbjct  230  ELAKGGRTVVMTIHQPSSRLFYMFHKVLLLSEGNPLYFGKGAEAMDYFSSIGFAPSVAMN  289

Query  362  PAEFLLDLANGNIND  406
            P++FLLDLANG ++D
Sbjct  290  PSDFLLDLANGVLSD  304



>ref|XP_001780064.1| ATP-binding cassette transporter, subfamily G, member 3, group 
WBC protein PpABCG3 [Physcomitrella patens]
 gb|EDQ55167.1| ATP-binding cassette transporter, subfamily G, member 3, group 
WBC protein PpABCG3 [Physcomitrella patens]
Length=584

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L+RC+DT+IGG F RGVSGGERKRV IG+E++++PSLLFLDEPTSGLDSTTALRI+  L 
Sbjct  118  LERCKDTIIGGPFKRGVSGGERKRVSIGHEMLVDPSLLFLDEPTSGLDSTTALRIIKTLQ  177

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            ++AK+GKT+ITTIHQPSS ++H FDK+ILL +G LLYYG   +AM+YF+SI  SP   MN
Sbjct  178  DMAKSGKTIITTIHQPSSTVYHMFDKMILLSEGHLLYYGDGHQAMSYFASIHFSPPFPMN  237

Query  362  PAEFLLDLANGN  397
            PA+FLLDLANG+
Sbjct  238  PADFLLDLANGS  249



>ref|XP_009605775.1| PREDICTED: ABC transporter G family member 9 [Nicotiana tomentosiformis]
Length=616

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +2

Query  2    LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  181
            L +C+D++IGG  +RG+SGGERKRV IG E++INPSLLFLDEPTSGLDSTTA +IV  L 
Sbjct  164  LTKCKDSIIGGPLLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQKIVSTLW  223

Query  182  EIAKAGKTVITTIHQPSSRLFHKFDklillgkgsllyygkASEAMAYFSSIGCSPLIAMN  361
            E+ K G+T++ TIHQPSSRLF+ F K++LL +G+ LY+G+  +AM YFSSIG SPL+AMN
Sbjct  224  ELVKGGRTIVMTIHQPSSRLFYMFHKVLLLSEGNPLYFGRGEDAMGYFSSIGFSPLVAMN  283

Query  362  PAEFLLDLANGNIND  406
            P++FLLDLANG ++D
Sbjct  284  PSDFLLDLANGVLDD  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200