BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F21

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612959.1|  PREDICTED: actin-depolymerizing factor 2-like      242   2e-78   Nicotiana tomentosiformis
ref|XP_002299887.1|  hypothetical protein POPTR_0001s24330g             242   3e-78   Populus trichocarpa [western balsam poplar]
gb|KCW50259.1|  hypothetical protein EUGRSUZ_J00048                     242   3e-78   Eucalyptus grandis [rose gum]
ref|XP_010031003.1|  PREDICTED: actin-depolymerizing factor 2-like      241   4e-78   Eucalyptus grandis [rose gum]
gb|ABD66505.1|  actin depolymerizing factor 3                           241   7e-78   Gossypium hirsutum [American cotton]
gb|EYU36258.1|  hypothetical protein MIMGU_mgv1a015971mg                241   7e-78   Erythranthe guttata [common monkey flower]
ref|XP_009775372.1|  PREDICTED: actin-depolymerizing factor 2-like      241   7e-78   Nicotiana sylvestris
ref|XP_004149045.1|  PREDICTED: actin-depolymerizing factor 2-lik...    240   1e-77   Cucumis sativus [cucumbers]
ref|XP_008457551.1|  PREDICTED: actin-depolymerizing factor 2           240   1e-77   Cucumis melo [Oriental melon]
gb|EPS73519.1|  actin-depolymerizing factor                             240   2e-77   Genlisea aurea
ref|XP_003594440.1|  Actin depolymerizing factor                        239   3e-77   Medicago truncatula
gb|ABD63906.1|  actin depolymerizing factor 2                           239   5e-77   Gossypium hirsutum [American cotton]
ref|XP_002314195.1|  actin-depolymerizing factor family protein         238   8e-77   Populus trichocarpa [western balsam poplar]
ref|XP_011042674.1|  PREDICTED: actin-depolymerizing factor 2-lik...    237   3e-76   Populus euphratica
gb|ACJ84098.1|  unknown                                                 236   4e-76   Medicago truncatula
ref|XP_011016059.1|  PREDICTED: actin-depolymerizing factor 2-like      236   4e-76   Populus euphratica
gb|KDP29838.1|  hypothetical protein JCGZ_18413                         236   5e-76   Jatropha curcas
gb|ABD66508.1|  actin depolymerizing factor 6                           236   5e-76   Gossypium hirsutum [American cotton]
ref|XP_010260094.1|  PREDICTED: actin-depolymerizing factor 2-like      236   5e-76   Nelumbo nucifera [Indian lotus]
gb|AFK42408.1|  unknown                                                 236   6e-76   Lotus japonicus
gb|KHG06644.1|  Actin-depolymerizing factor 1                           236   7e-76   Gossypium arboreum [tree cotton]
gb|EYU18949.1|  hypothetical protein MIMGU_mgv1a015984mg                236   7e-76   Erythranthe guttata [common monkey flower]
ref|XP_006586815.1|  PREDICTED: actin-depolymerizing factor 2-like      236   7e-76   Glycine max [soybeans]
ref|XP_002314194.1|  actin-depolymerizing factor 3 family protein       236   8e-76   Populus trichocarpa [western balsam poplar]
gb|EPS60626.1|  hypothetical protein M569_14175                         236   1e-75   Genlisea aurea
ref|XP_010553292.1|  PREDICTED: actin-depolymerizing factor 1           235   1e-75   Tarenaya hassleriana [spider flower]
ref|XP_002284292.1|  PREDICTED: actin-depolymerizing factor 2           235   1e-75   Vitis vinifera
ref|XP_010047513.1|  PREDICTED: actin-depolymerizing factor 2           234   3e-75   Eucalyptus grandis [rose gum]
ref|XP_007016496.1|  Actin depolymerizing factor 4                      234   5e-75   Theobroma cacao [chocolate]
ref|NP_001238519.1|  uncharacterized protein LOC100499953               233   5e-75   Glycine max [soybeans]
ref|NP_001236448.1|  uncharacterized protein LOC100305514               233   5e-75   Glycine max [soybeans]
ref|XP_002273958.2|  PREDICTED: actin-depolymerizing factor 1-like      235   5e-75   Vitis vinifera
gb|KJB20158.1|  hypothetical protein B456_003G135600                    233   6e-75   Gossypium raimondii
ref|XP_010031001.1|  PREDICTED: actin-depolymerizing factor 2-like      233   6e-75   Eucalyptus grandis [rose gum]
ref|XP_009600590.1|  PREDICTED: actin-depolymerizing factor 2           233   7e-75   Nicotiana tomentosiformis
gb|KHN48988.1|  Actin-depolymerizing factor 2                           233   9e-75   Glycine soja [wild soybean]
ref|XP_010253266.1|  PREDICTED: actin-depolymerizing factor 2           233   9e-75   Nelumbo nucifera [Indian lotus]
gb|KHG23104.1|  Actin-depolymerizing factor 1                           233   9e-75   Gossypium arboreum [tree cotton]
ref|XP_010455704.1|  PREDICTED: actin-depolymerizing factor 3           233   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_002533101.1|  actin depolymerizing factor, putative              233   1e-74   Ricinus communis
ref|XP_007144457.1|  hypothetical protein PHAVU_007G157800g             233   1e-74   Phaseolus vulgaris [French bean]
ref|XP_007027090.1|  Actin depolymerizing factor 4 isoform 2            234   1e-74   
emb|CAJ38384.1|  actin-depolymerizing factor                            233   1e-74   Plantago major [cart-track plant]
ref|XP_011000294.1|  PREDICTED: actin-depolymerizing factor 2-like      232   1e-74   Populus euphratica
sp|Q9FVI1.1|ADF2_PETHY  RecName: Full=Actin-depolymerizing factor...    232   2e-74   Petunia x hybrida [garden petunia]
ref|XP_004236758.1|  PREDICTED: actin-depolymerizing factor 2           232   2e-74   Solanum lycopersicum
gb|ABC49719.1|  actin depolymerizing factor-like protein                232   2e-74   Arachis hypogaea [goober]
ref|XP_002864656.1|  hypothetical protein ARALYDRAFT_496124             232   2e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_009593022.1|  PREDICTED: actin-depolymerizing factor 2-like      231   3e-74   Nicotiana tomentosiformis
gb|ADI78873.1|  actin-depolymerizing factor                             231   3e-74   Hevea brasiliensis [jebe]
ref|XP_006365713.1|  PREDICTED: actin-depolymerizing factor 2-like      231   3e-74   Solanum tuberosum [potatoes]
ref|XP_010529845.1|  PREDICTED: actin-depolymerizing factor 2-like      231   4e-74   Tarenaya hassleriana [spider flower]
ref|XP_002299888.1|  actin-depolymerizing factor family protein         231   4e-74   Populus trichocarpa [western balsam poplar]
ref|XP_008463478.1|  PREDICTED: actin-depolymerizing factor 2 iso...    231   4e-74   Cucumis melo [Oriental melon]
ref|XP_007218573.1|  hypothetical protein PRUPE_ppa013105mg             231   6e-74   Prunus persica
ref|XP_004249528.1|  PREDICTED: actin-depolymerizing factor 1-like      231   7e-74   Solanum lycopersicum
gb|KDP35600.1|  hypothetical protein JCGZ_09038                         230   9e-74   Jatropha curcas
gb|AFK48761.1|  unknown                                                 230   1e-73   Lotus japonicus
emb|CAL25339.1|  actin-depolymerizing factor                            230   1e-73   Platanus x hispanica [London plane tree]
ref|XP_003629907.1|  Actin depolymerizing factor-like protein           230   1e-73   Medicago truncatula
gb|ACB32233.1|  actin-depolymerizing factor 1                           230   1e-73   Solanum chacoense
ref|XP_004486422.1|  PREDICTED: actin-depolymerizing factor 2-like      230   1e-73   Cicer arietinum [garbanzo]
ref|XP_009131962.1|  PREDICTED: actin-depolymerizing factor 3           230   1e-73   
ref|XP_006281290.1|  hypothetical protein CARUB_v10027340mg             230   1e-73   Capsella rubella
ref|XP_010096647.1|  Actin-depolymerizing factor 2                      231   1e-73   
ref|XP_011094831.1|  PREDICTED: actin-depolymerizing factor 1 iso...    229   2e-73   Sesamum indicum [beniseed]
ref|XP_004142738.1|  PREDICTED: actin-depolymerizing factor 2-like      229   2e-73   Cucumis sativus [cucumbers]
ref|XP_011077447.1|  PREDICTED: actin-depolymerizing factor 1-like      231   2e-73   Sesamum indicum [beniseed]
ref|XP_006341057.1|  PREDICTED: actin-depolymerizing factor 1-like      229   3e-73   Solanum tuberosum [potatoes]
ref|XP_007147534.1|  hypothetical protein PHAVU_006G132700g             229   3e-73   Phaseolus vulgaris [French bean]
gb|ADV04049.1|  actin depolymerizing factor 4                           229   3e-73   Hevea brasiliensis [jebe]
gb|KJB78849.1|  hypothetical protein B456_013G022900                    229   3e-73   Gossypium raimondii
gb|ABD66504.1|  actin depolymerizing factor 8                           229   3e-73   Gossypium hirsutum [American cotton]
ref|XP_010535543.1|  PREDICTED: actin-depolymerizing factor 4           229   3e-73   Tarenaya hassleriana [spider flower]
ref|XP_006339034.1|  PREDICTED: actin-depolymerizing factor 1-like      229   3e-73   Solanum tuberosum [potatoes]
ref|XP_006424770.1|  hypothetical protein CICLE_v10029538mg             229   3e-73   Citrus clementina [clementine]
ref|XP_006400899.1|  hypothetical protein EUTSA_v10014975mg             229   4e-73   Eutrema salsugineum [saltwater cress]
ref|XP_002284029.1|  PREDICTED: actin-depolymerizing factor 2-lik...    228   5e-73   Vitis vinifera
ref|XP_004240356.1|  PREDICTED: actin-depolymerizing factor 2-like      228   6e-73   Solanum lycopersicum
gb|ABX79380.1|  actin-depolymerizing factor                             228   7e-73   Gossypium barbadense [Egyptian cotton]
gb|KCW50264.1|  hypothetical protein EUGRSUZ_J00048                     228   8e-73   Eucalyptus grandis [rose gum]
gb|ADV02778.1|  actin depolymerizing factor 1                           228   9e-73   Ipomoea batatas [batate]
ref|XP_011027144.1|  PREDICTED: actin-depolymerizing factor 1-like      228   1e-72   Populus euphratica
emb|CDX71068.1|  BnaC03g11520D                                          228   1e-72   
emb|CDX80216.1|  BnaC09g35260D                                          231   1e-72   
ref|XP_004246462.1|  PREDICTED: actin-depolymerizing factor 1           228   1e-72   Solanum lycopersicum
ref|XP_007206123.1|  hypothetical protein PRUPE_ppa013110mg             227   1e-72   Prunus persica
gb|KFK27528.1|  hypothetical protein AALP_AA8G395200                    227   1e-72   Arabis alpina [alpine rockcress]
ref|XP_010669849.1|  PREDICTED: actin-depolymerizing factor 4-like      227   1e-72   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI31711.3|  unnamed protein product                                229   2e-72   Vitis vinifera
gb|KJB78850.1|  hypothetical protein B456_013G022900                    228   2e-72   Gossypium raimondii
ref|XP_004495011.1|  PREDICTED: actin-depolymerizing factor 2-like      227   2e-72   Cicer arietinum [garbanzo]
emb|CDX88730.1|  BnaA03g09190D                                          228   2e-72   
emb|CDP06641.1|  unnamed protein product                                228   2e-72   Coffea canephora [robusta coffee]
ref|XP_006424771.1|  hypothetical protein CICLE_v10029538mg             227   2e-72   
ref|XP_009120511.1|  PREDICTED: actin-depolymerizing factor 3-like      227   2e-72   Brassica rapa
ref|NP_851227.1|  actin depolymerizing factor 3                         226   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094830.1|  PREDICTED: actin-depolymerizing factor 1 iso...    227   3e-72   Sesamum indicum [beniseed]
gb|AFK39900.1|  unknown                                                 226   3e-72   Lotus japonicus
ref|XP_010669850.1|  PREDICTED: actin-depolymerizing factor 4           226   4e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004504229.1|  PREDICTED: actin-depolymerizing factor 2-like      226   5e-72   Cicer arietinum [garbanzo]
gb|EYU26572.1|  hypothetical protein MIMGU_mgv1a015955mg                226   6e-72   Erythranthe guttata [common monkey flower]
emb|CDP00056.1|  unnamed protein product                                225   7e-72   Coffea canephora [robusta coffee]
ref|XP_002316301.1|  actin-depolymerizing factor family protein         226   7e-72   Populus trichocarpa [western balsam poplar]
ref|XP_010909358.1|  PREDICTED: actin-depolymerizing factor 7-like      225   8e-72   Elaeis guineensis
gb|KHN05922.1|  Actin-depolymerizing factor 2                           225   9e-72   Glycine soja [wild soybean]
ref|XP_004307556.2|  PREDICTED: uncharacterized protein LOC101301142    235   1e-71   Fragaria vesca subsp. vesca
ref|XP_006436042.1|  hypothetical protein CICLE_v10033029mg             225   1e-71   Citrus clementina [clementine]
ref|XP_006292022.1|  hypothetical protein CARUB_v10018211mg             225   1e-71   Capsella rubella
ref|NP_190187.1|  actin depolymerizing factor 1                         224   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002311154.2|  hypothetical protein POPTR_0008s05210g             227   2e-71   
ref|XP_008776502.1|  PREDICTED: actin-depolymerizing factor 7           224   2e-71   Phoenix dactylifera
ref|XP_006281292.1|  hypothetical protein CARUB_v10027342mg             224   2e-71   Capsella rubella
ref|XP_008343560.1|  PREDICTED: actin-depolymerizing factor 1           224   2e-71   Malus domestica [apple tree]
ref|XP_007027089.1|  Actin depolymerizing factor 4 isoform 1            226   3e-71   
ref|NP_001078247.1|  actin depolymerizing factor 1                      224   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009357677.1|  PREDICTED: actin-depolymerizing factor 1           224   3e-71   Pyrus x bretschneideri [bai li]
gb|AAR23800.1|  putative actin-depolymerizing factor 2                  223   4e-71   Helianthus annuus
gb|ABK94603.1|  unknown                                                 223   4e-71   Populus trichocarpa [western balsam poplar]
gb|KGN58886.1|  hypothetical protein Csa_3G734880                       223   6e-71   Cucumis sativus [cucumbers]
ref|XP_009586917.1|  PREDICTED: actin-depolymerizing factor 1           223   7e-71   Nicotiana tomentosiformis
ref|XP_006476590.1|  PREDICTED: actin-depolymerizing factor 1-like      222   1e-70   
ref|XP_009126640.1|  PREDICTED: actin-depolymerizing factor 4 iso...    222   1e-70   Brassica rapa
ref|XP_010920670.1|  PREDICTED: actin-depolymerizing factor 7           222   1e-70   Elaeis guineensis
ref|XP_010514926.1|  PREDICTED: actin-depolymerizing factor 1           222   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_003637508.1|  Actin-depolymerizing factor                        222   2e-70   
ref|XP_009406976.1|  PREDICTED: actin-depolymerizing factor 7 iso...    222   2e-70   
sp|Q9FVI2.1|ADF1_PETHY  RecName: Full=Actin-depolymerizing factor...    222   2e-70   Petunia x hybrida [garden petunia]
ref|NP_851228.1|  actin depolymerizing factor 4                         222   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418975.1|  hypothetical protein EUTSA_v10002704mg             221   3e-70   Eutrema salsugineum [saltwater cress]
emb|CBI16177.3|  unnamed protein product                                221   3e-70   Vitis vinifera
ref|XP_008369858.1|  PREDICTED: actin-depolymerizing factor 2-like      221   3e-70   Malus domestica [apple tree]
ref|XP_007009413.1|  Actin depolymerizing factor 4 isoform 1            232   3e-70   
ref|XP_008442569.1|  PREDICTED: actin-depolymerizing factor 2-like      221   3e-70   Cucumis melo [Oriental melon]
ref|XP_006418976.1|  hypothetical protein EUTSA_v10002704mg             221   4e-70   
ref|XP_004302775.1|  PREDICTED: actin-depolymerizing factor 3-like      221   4e-70   Fragaria vesca subsp. vesca
ref|XP_009337572.1|  PREDICTED: actin-depolymerizing factor 1-like      221   4e-70   Pyrus x bretschneideri [bai li]
ref|XP_010543331.1|  PREDICTED: actin-depolymerizing factor 1-like      221   4e-70   
ref|XP_008788089.1|  PREDICTED: actin-depolymerizing factor 7-like      221   5e-70   Phoenix dactylifera
ref|XP_004172071.1|  PREDICTED: actin-depolymerizing factor 1-like      221   5e-70   
gb|EPS63340.1|  hypothetical protein M569_11446                         221   5e-70   Genlisea aurea
ref|XP_008387742.1|  PREDICTED: actin-depolymerizing factor 2-like      221   5e-70   
ref|XP_004142080.1|  PREDICTED: actin-depolymerizing factor 1-like      221   6e-70   Cucumis sativus [cucumbers]
ref|XP_004294586.1|  PREDICTED: actin-depolymerizing factor 2           221   6e-70   Fragaria vesca subsp. vesca
ref|XP_010249803.1|  PREDICTED: actin-depolymerizing factor             221   6e-70   Nelumbo nucifera [Indian lotus]
emb|CDX88731.1|  BnaA03g09180D                                          223   7e-70   
ref|XP_008233662.1|  PREDICTED: uncharacterized protein LOC103332693    233   8e-70   
ref|XP_002528457.1|  actin depolymerizing factor, putative              220   8e-70   Ricinus communis
ref|XP_010426028.1|  PREDICTED: actin-depolymerizing factor 1-like      220   9e-70   Camelina sativa [gold-of-pleasure]
gb|KDO76170.1|  hypothetical protein CISIN_1g046281mg                   220   9e-70   Citrus sinensis [apfelsine]
ref|XP_009131961.1|  PREDICTED: actin-depolymerizing factor 4-like      220   9e-70   Brassica rapa
gb|ACJ84058.1|  unknown                                                 220   9e-70   Medicago truncatula
ref|XP_009421345.1|  PREDICTED: actin-depolymerizing factor 7-like      220   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404611.1|  PREDICTED: actin-depolymerizing factor 7-like      220   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW50261.1|  hypothetical protein EUGRSUZ_J00048                     219   1e-69   Eucalyptus grandis [rose gum]
ref|XP_010455715.1|  PREDICTED: actin-depolymerizing factor 4           220   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009406977.1|  PREDICTED: actin-depolymerizing factor 2 iso...    219   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937681.1|  PREDICTED: actin-depolymerizing factor 7-like      219   2e-69   Elaeis guineensis
emb|CDY09242.1|  BnaA02g06680D                                          219   2e-69   Brassica napus [oilseed rape]
emb|CAJ38388.1|  actin-depolymerizing factor                            219   2e-69   Plantago major [cart-track plant]
gb|KDP44204.1|  hypothetical protein JCGZ_05671                         219   2e-69   Jatropha curcas
ref|XP_009416252.1|  PREDICTED: actin-depolymerizing factor 7-like      219   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB76068.1|  hypothetical protein B456_012G069600                    219   2e-69   Gossypium raimondii
ref|XP_010503215.1|  PREDICTED: actin-depolymerizing factor 1-like      219   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010111772.1|  Actin-depolymerizing factor 1                      219   3e-69   
ref|XP_009374667.1|  PREDICTED: actin-depolymerizing factor 2-lik...    219   3e-69   Pyrus x bretschneideri [bai li]
ref|XP_008447631.1|  PREDICTED: actin-depolymerizing factor 1-like      219   4e-69   Cucumis melo [Oriental melon]
ref|XP_007206122.1|  hypothetical protein PRUPE_ppa013109mg             218   4e-69   Prunus persica
ref|XP_006439576.1|  hypothetical protein CICLE_v10023304mg             218   5e-69   Citrus clementina [clementine]
ref|XP_007218574.1|  hypothetical protein PRUPE_ppa013108mg             218   5e-69   Prunus persica
ref|XP_008393892.1|  PREDICTED: actin-depolymerizing factor 1           218   6e-69   Malus domestica [apple tree]
gb|AAD09110.1|  actin depolymerizing factor 4                           218   6e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KDP25456.1|  hypothetical protein JCGZ_20612                         218   6e-69   Jatropha curcas
ref|XP_011029243.1|  PREDICTED: actin-depolymerizing factor isofo...    218   7e-69   Populus euphratica
ref|XP_009419950.1|  PREDICTED: actin-depolymerizing factor 4           218   7e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009150048.1|  PREDICTED: actin-depolymerizing factor 2           218   7e-69   Brassica rapa
gb|AEJ88268.1|  putative actin-depolymerizing factor                    218   8e-69   Wolffia arrhiza
gb|AEZ00870.1|  putative actin depolymerizing factor protein            219   8e-69   Elaeis guineensis
gb|AEJ90198.1|  actin depolymerizing factor 1                           218   9e-69   Rosa hybrid cultivar
ref|XP_008371032.1|  PREDICTED: actin-depolymerizing factor 1           218   9e-69   
ref|XP_002468086.1|  hypothetical protein SORBIDRAFT_01g039300          218   1e-68   Sorghum bicolor [broomcorn]
ref|XP_002303579.1|  actin-depolymerizing factor family protein         217   1e-68   Populus trichocarpa [western balsam poplar]
ref|XP_008244913.1|  PREDICTED: actin-depolymerizing factor 10          217   1e-68   Prunus mume [ume]
emb|CDP09013.1|  unnamed protein product                                217   2e-68   Coffea canephora [robusta coffee]
ref|XP_009420088.1|  PREDICTED: actin-depolymerizing factor 7-like      217   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002509779.1|  actin depolymerizing factor, putative              217   2e-68   Ricinus communis
gb|KFK33962.1|  hypothetical protein AALP_AA5G084200                    217   2e-68   Arabis alpina [alpine rockcress]
ref|XP_006367965.1|  PREDICTED: actin-depolymerizing factor 2-like      217   2e-68   Solanum tuberosum [potatoes]
ref|XP_009353719.1|  PREDICTED: actin-depolymerizing factor 1-like      216   2e-68   Pyrus x bretschneideri [bai li]
ref|XP_008357628.1|  PREDICTED: actin-depolymerizing factor 1-like      216   2e-68   Malus domestica [apple tree]
gb|KEH20707.1|  cofilin/actin-depolymerizing factor-like protein        216   2e-68   Medicago truncatula
ref|XP_008794195.1|  PREDICTED: actin-depolymerizing factor-like        216   3e-68   Phoenix dactylifera
ref|XP_009591841.1|  PREDICTED: actin-depolymerizing factor 2-like      216   3e-68   Nicotiana tomentosiformis
ref|XP_009388628.1|  PREDICTED: actin-depolymerizing factor 7           216   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047657.1|  Os02g0663800                                       216   3e-68   
ref|XP_006846080.1|  hypothetical protein AMTR_s00012p00089320          216   3e-68   Amborella trichopoda
ref|XP_002877448.1|  hypothetical protein ARALYDRAFT_484979             216   3e-68   
emb|CDY31586.1|  BnaA10g12850D                                          216   3e-68   Brassica napus [oilseed rape]
ref|XP_010528350.1|  PREDICTED: actin-depolymerizing factor 1-like      216   4e-68   
ref|XP_002298043.1|  actin-depolymerizing factor family protein         216   5e-68   Populus trichocarpa [western balsam poplar]
ref|XP_004953378.1|  PREDICTED: actin-depolymerizing factor 1-like      216   6e-68   Setaria italica
ref|XP_010053689.1|  PREDICTED: actin-depolymerizing factor             216   6e-68   Eucalyptus grandis [rose gum]
ref|XP_006418977.1|  hypothetical protein EUTSA_v10002714mg             215   6e-68   Eutrema salsugineum [saltwater cress]
emb|CDX99133.1|  BnaA06g18240D                                          216   7e-68   
ref|XP_009358343.1|  PREDICTED: actin-depolymerizing factor 1-like      215   7e-68   Pyrus x bretschneideri [bai li]
ref|XP_006843593.1|  hypothetical protein AMTR_s00007p00126220          215   7e-68   Amborella trichopoda
ref|XP_010922979.1|  PREDICTED: actin-depolymerizing factor 7-like      219   1e-67   
ref|NP_566882.1|  actin depolymerizing factor 2                         214   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009386059.1|  PREDICTED: actin-depolymerizing factor             214   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010558792.1|  PREDICTED: actin-depolymerizing factor 2-lik...    214   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_010503214.1|  PREDICTED: actin-depolymerizing factor 2           214   2e-67   Camelina sativa [gold-of-pleasure]
emb|CDX86048.1|  BnaC03g55630D                                          215   3e-67   
ref|XP_004306801.2|  PREDICTED: actin-depolymerizing factor 10 is...    214   3e-67   Fragaria vesca subsp. vesca
ref|XP_002271495.1|  PREDICTED: actin-depolymerizing factor 10          213   4e-67   Vitis vinifera
ref|XP_008438059.1|  PREDICTED: actin-depolymerizing factor 7-like      213   4e-67   
ref|XP_010419619.1|  PREDICTED: actin-depolymerizing factor 8-like      213   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006292028.1|  hypothetical protein CARUB_v10018217mg             213   6e-67   Capsella rubella
gb|AEW90956.1|  actin depolymerizing factor 4-2                         213   7e-67   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_010514925.1|  PREDICTED: actin-depolymerizing factor 2-like      213   9e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010456252.1|  PREDICTED: actin-depolymerizing factor 8-like      213   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006647644.1|  PREDICTED: actin-depolymerizing factor 1-like      212   1e-66   
ref|XP_007040194.1|  Actin depolymerizing factor 8                      212   1e-66   Theobroma cacao [chocolate]
ref|XP_010426027.1|  PREDICTED: actin-depolymerizing factor 2-like      212   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006436041.1|  hypothetical protein CICLE_v10033029mg             212   1e-66   
gb|KDP22276.1|  hypothetical protein JCGZ_26107                         212   2e-66   Jatropha curcas
ref|XP_010662752.1|  PREDICTED: actin-depolymerizing factor 1           212   2e-66   Vitis vinifera
ref|XP_004984753.1|  PREDICTED: actin-depolymerizing factor 7-lik...    211   2e-66   Setaria italica
ref|XP_010534301.1|  PREDICTED: actin-depolymerizing factor 1-like      211   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_004503768.1|  PREDICTED: actin-depolymerizing factor 7-like      211   2e-66   Cicer arietinum [garbanzo]
gb|AET05009.2|  cofilin/actin-depolymerizing factor-like protein        211   3e-66   Medicago truncatula
ref|XP_008392560.1|  PREDICTED: actin-depolymerizing factor 7-like      211   4e-66   Malus domestica [apple tree]
sp|P30175.1|ADF_LILLO  RecName: Full=Actin-depolymerizing factor;...    211   4e-66   Lilium longiflorum [Easter lily]
gb|KHG18554.1|  Actin-depolymerizing factor                             211   4e-66   Gossypium arboreum [tree cotton]
gb|KCW71635.1|  hypothetical protein EUGRSUZ_E00162                     211   4e-66   Eucalyptus grandis [rose gum]
ref|XP_010910598.1|  PREDICTED: actin-depolymerizing factor             212   4e-66   Elaeis guineensis
ref|XP_008804935.1|  PREDICTED: actin-depolymerizing factor isofo...    211   4e-66   
ref|XP_009384093.1|  PREDICTED: actin-depolymerizing factor 1           211   5e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGW22223.1|  actin-depolymerizing factor 4                           211   5e-66   Triticum aestivum [Canadian hard winter wheat]
gb|AEP25120.1|  actin depolymerising factor                             211   5e-66   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_002872934.1|  hypothetical protein ARALYDRAFT_490501             210   6e-66   
ref|XP_007038697.1|  Actin depolymerizing factor 7                      210   7e-66   Theobroma cacao [chocolate]
ref|XP_008385227.1|  PREDICTED: actin-depolymerizing factor 1-like      210   1e-65   
emb|CBI40336.3|  unnamed protein product                                214   1e-65   Vitis vinifera
gb|KFK27529.1|  hypothetical protein AALP_AA8G395300                    209   1e-65   Arabis alpina [alpine rockcress]
gb|AEW90955.1|  actin depolymerizing factor 4-1                         209   1e-65   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_006490391.1|  PREDICTED: actin-depolymerizing factor 7-like      209   1e-65   
ref|XP_002892045.1|  hypothetical protein ARALYDRAFT_887267             209   1e-65   Arabidopsis lyrata subsp. lyrata
ref|XP_004984752.1|  PREDICTED: actin-depolymerizing factor 7-lik...    210   2e-65   Setaria italica
ref|XP_009411533.1|  PREDICTED: actin-depolymerizing factor 1-like      210   2e-65   
emb|CDY38025.1|  BnaCnng08860D                                          210   2e-65   Brassica napus [oilseed rape]
ref|NP_567182.1|  actin depolymerizing factor 8                         209   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011080987.1|  PREDICTED: actin-depolymerizing factor-like        209   3e-65   Sesamum indicum [beniseed]
ref|XP_010427310.1|  PREDICTED: actin-depolymerizing factor 8           209   3e-65   Camelina sativa [gold-of-pleasure]
dbj|BAK04382.1|  predicted protein                                      209   3e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003630533.1|  Actin depolymerizing factor                        209   4e-65   
ref|NP_568916.2|  actin depolymerizing factor 4                         208   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544380.1|  PREDICTED: actin-depolymerizing factor 8 iso...    208   5e-65   Tarenaya hassleriana [spider flower]
ref|NP_001053519.1|  Os04g0555700                                       208   5e-65   
ref|XP_007211217.1|  hypothetical protein PRUPE_ppa013153mg             208   6e-65   
ref|XP_006304638.1|  hypothetical protein CARUB_v10011760mg             207   7e-65   Capsella rubella
ref|XP_009414703.1|  PREDICTED: actin-depolymerizing factor-like        207   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN56524.1|  hypothetical protein Csa_3G122480                       207   8e-65   Cucumis sativus [cucumbers]
ref|NP_001148898.1|  actin-depolymerizing factor                        207   1e-64   Zea mays [maize]
emb|CDX71067.1|  BnaC03g11510D                                          207   1e-64   
ref|XP_004240732.1|  PREDICTED: actin-depolymerizing factor 7           207   1e-64   Solanum lycopersicum
ref|XP_003538360.1|  PREDICTED: actin-depolymerizing factor 7-lik...    207   1e-64   Glycine max [soybeans]
ref|XP_006418454.1|  hypothetical protein EUTSA_v10009057mg             207   1e-64   Eutrema salsugineum [saltwater cress]
ref|XP_009350096.1|  PREDICTED: actin-depolymerizing factor 2-like      206   2e-64   Pyrus x bretschneideri [bai li]
gb|KGN57376.1|  hypothetical protein Csa_3G182120                       206   2e-64   Cucumis sativus [cucumbers]
ref|XP_008343556.1|  PREDICTED: actin-depolymerizing factor 1-like      206   2e-64   
ref|XP_002439159.1|  hypothetical protein SORBIDRAFT_09g001500          206   2e-64   Sorghum bicolor [broomcorn]
ref|XP_006843087.1|  hypothetical protein AMTR_s00140p00036970          206   3e-64   Amborella trichopoda
ref|XP_009118832.1|  PREDICTED: actin-depolymerizing factor 10 is...    206   3e-64   Brassica rapa
ref|XP_002864657.1|  hypothetical protein ARALYDRAFT_332260             206   3e-64   
gb|ACU23570.1|  unknown                                                 206   3e-64   Glycine max [soybeans]
ref|XP_006363318.1|  PREDICTED: actin-depolymerizing factor 7-like      206   3e-64   Solanum tuberosum [potatoes]
ref|XP_004511586.1|  PREDICTED: actin-depolymerizing factor 7-lik...    206   3e-64   Cicer arietinum [garbanzo]
ref|XP_010479839.1|  PREDICTED: actin-depolymerizing factor 10          206   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009389157.1|  PREDICTED: actin-depolymerizing factor 1-like      206   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009599636.1|  PREDICTED: actin-depolymerizing factor 7           206   3e-64   
gb|AAL91667.1|  pollen specific actin-depolymerizing factor 2           206   3e-64   
ref|XP_007160047.1|  hypothetical protein PHAVU_002G288100g             207   4e-64   
ref|XP_003532683.1|  PREDICTED: actin-depolymerizing factor 7-like      206   4e-64   
ref|XP_008804936.1|  PREDICTED: zinc finger CCHC domain-containin...    213   4e-64   
ref|XP_008385142.1|  PREDICTED: actin-depolymerizing factor 1-like      205   4e-64   
ref|XP_003524462.1|  PREDICTED: actin-depolymerizing factor 7-like      207   5e-64   
ref|XP_009346958.1|  PREDICTED: actin-depolymerizing factor 1 iso...    205   5e-64   
ref|XP_009770352.1|  PREDICTED: actin-depolymerizing factor 7           205   5e-64   
ref|XP_008241374.1|  PREDICTED: actin-depolymerizing factor 2-like      205   6e-64   
ref|XP_004300779.2|  PREDICTED: actin-depolymerizing factor 7-like      205   6e-64   
ref|XP_006396264.1|  hypothetical protein EUTSA_v10029050mg             205   6e-64   
ref|XP_010908104.1|  PREDICTED: zinc finger CCHC domain-containin...    212   7e-64   
ref|XP_006590525.1|  PREDICTED: actin-depolymerizing factor 7-lik...    205   7e-64   
ref|XP_009119731.1|  PREDICTED: actin-depolymerizing factor 10-like     205   8e-64   
gb|KHN16833.1|  Actin-depolymerizing factor 7                           206   9e-64   
gb|AFK45315.1|  unknown                                                 205   9e-64   
gb|AFK35836.1|  unknown                                                 205   1e-63   
ref|XP_002448300.1|  hypothetical protein SORBIDRAFT_06g024870          205   1e-63   
gb|KJB33315.1|  hypothetical protein B456_006G198000                    204   1e-63   
ref|NP_171680.1|  actin depolymerizing factor 11                        204   1e-63   
ref|NP_001240195.1|  uncharacterized protein LOC100795241               204   1e-63   
gb|ACR38016.1|  unknown                                                 204   1e-63   
ref|XP_009118831.1|  PREDICTED: actin-depolymerizing factor 10 is...    204   1e-63   
ref|XP_009397611.1|  PREDICTED: actin-depolymerizing factor 1-like      204   1e-63   
gb|KGN50293.1|  hypothetical protein Csa_5G165880                       204   1e-63   
ref|XP_010672167.1|  PREDICTED: actin-depolymerizing factor 10          204   2e-63   
ref|XP_004511585.1|  PREDICTED: actin-depolymerizing factor 7-lik...    204   2e-63   
gb|AFK48601.1|  unknown                                                 203   3e-63   
ref|XP_008437023.1|  PREDICTED: actin-depolymerizing factor 7           203   4e-63   
ref|XP_011084418.1|  PREDICTED: actin-depolymerizing factor 7           203   4e-63   
ref|XP_006285474.1|  hypothetical protein CARUB_v10006893mg             203   4e-63   
ref|XP_009387944.1|  PREDICTED: zinc finger CCHC domain-containin...    210   4e-63   
emb|CDP08835.1|  unnamed protein product                                204   4e-63   
ref|XP_010433613.1|  PREDICTED: actin-depolymerizing factor 7-like      203   5e-63   
ref|XP_010544379.1|  PREDICTED: actin-depolymerizing factor 8 iso...    204   5e-63   
ref|NP_194289.2|  actin depolymerizing factor 7                         203   5e-63   
ref|XP_007051847.1|  Actin depolymerizing factor 11                     203   6e-63   
ref|XP_010448409.1|  PREDICTED: actin-depolymerizing factor 7           202   6e-63   
gb|EAY86979.1|  hypothetical protein OsI_08373                          202   7e-63   
ref|XP_010245480.1|  PREDICTED: actin-depolymerizing factor 1-like      202   7e-63   
ref|XP_009111466.1|  PREDICTED: actin-depolymerizing factor 8           202   8e-63   
emb|CDY15154.1|  BnaC05g00330D                                          203   8e-63   
gb|ABD66503.1|  actin depolymerizing factor 7                           202   9e-63   
ref|XP_006445079.1|  hypothetical protein CICLE_v10023747mg             202   9e-63   
ref|XP_006418978.1|  hypothetical protein EUTSA_v10002714mg             202   1e-62   
ref|XP_006572866.1|  PREDICTED: uncharacterized protein LOC100795...    202   1e-62   
ref|XP_002322471.2|  hypothetical protein POPTR_0015s13080g             202   1e-62   
ref|XP_011024249.1|  PREDICTED: actin-depolymerizing factor 1-lik...    201   1e-62   
gb|KCW46430.1|  hypothetical protein EUGRSUZ_K00262                     201   2e-62   
ref|XP_002969368.1|  hypothetical protein SELMODRAFT_146459             202   2e-62   
ref|XP_010482597.1|  PREDICTED: actin-depolymerizing factor 12          201   2e-62   
ref|XP_010444761.1|  PREDICTED: actin-depolymerizing factor 12-like     201   2e-62   
emb|CAB82824.1|  actin depolymerizing factor 2 (ADF2)                   201   2e-62   
ref|XP_008647356.1|  PREDICTED: hypothetical protein isoform X1         201   2e-62   
gb|KJB52790.1|  hypothetical protein B456_008G277000                    201   3e-62   
ref|NP_001148445.1|  actin-depolymerizing factor                        201   4e-62   
gb|ABF60823.1|  actin depolymerizing factor                             200   4e-62   
ref|XP_010442763.1|  PREDICTED: actin-depolymerizing factor 12-like     201   4e-62   
gb|KJB34132.1|  hypothetical protein B456_006G049100                    201   4e-62   
ref|XP_002867603.1|  actin binding protein                              201   4e-62   
ref|XP_007143417.1|  hypothetical protein PHAVU_007G070500g             200   5e-62   
ref|XP_002318237.1|  actin-depolymerizing factor family protein         200   5e-62   
gb|ABK26220.1|  unknown                                                 200   5e-62   
ref|XP_006413292.1|  hypothetical protein EUTSA_v10026532mg             200   6e-62   
ref|XP_006401834.1|  hypothetical protein EUTSA_v10014982mg             200   6e-62   
ref|XP_004496563.1|  PREDICTED: actin-depolymerizing factor 7-like      200   6e-62   
gb|ABK22764.1|  unknown                                                 200   8e-62   
dbj|BAK06235.1|  predicted protein                                      199   1e-61   
ref|XP_002452789.1|  hypothetical protein SORBIDRAFT_04g032550          199   1e-61   
ref|XP_010555668.1|  PREDICTED: actin-depolymerizing factor 7           199   1e-61   
ref|NP_001151716.1|  LOC100285352                                       199   1e-61   
ref|XP_009767730.1|  PREDICTED: uncharacterized protein LOC104218...    204   1e-61   
ref|XP_009132530.1|  PREDICTED: actin-depolymerizing factor 12-like     199   1e-61   
ref|XP_009767736.1|  PREDICTED: actin-depolymerizing factor 7-lik...    199   2e-61   
ref|XP_010910431.1|  PREDICTED: actin-depolymerizing factor-like        199   2e-61   
gb|KFK26837.1|  hypothetical protein AALP_AA8G300400                    199   2e-61   
ref|XP_009127248.1|  PREDICTED: actin-depolymerizing factor 12          199   2e-61   
gb|ABK21557.1|  unknown                                                 199   2e-61   
ref|XP_009793423.1|  PREDICTED: actin-depolymerizing factor 10-like     199   3e-61   
ref|XP_009382377.1|  PREDICTED: actin-depolymerizing factor 1-like      198   3e-61   
gb|AAM61402.1|  actin depolymerizing factor-like                        198   4e-61   
ref|NP_568769.1|  actin depolymerizing factor 10                        198   4e-61   
ref|XP_009106793.1|  PREDICTED: actin-depolymerizing factor 7           198   4e-61   
gb|KHN26651.1|  Actin-depolymerizing factor 7                           197   8e-61   
ref|XP_009615468.1|  PREDICTED: actin-depolymerizing factor 10-like     197   9e-61   
emb|CBI22738.3|  unnamed protein product                                197   9e-61   
ref|XP_009109200.1|  PREDICTED: actin-depolymerizing factor-like        197   9e-61   
ref|XP_010055150.1|  PREDICTED: actin-depolymerizing factor 8           197   9e-61   
gb|EEE61469.1|  hypothetical protein OsJ_15732                          205   1e-60   
gb|EAY95118.1|  hypothetical protein OsI_16935                          205   1e-60   
ref|XP_011093147.1|  PREDICTED: actin-depolymerizing factor 10-like     197   1e-60   
emb|CDY07204.1|  BnaCnng02190D                                          201   1e-60   
gb|KJB41305.1|  hypothetical protein B456_007G098100                    197   1e-60   
gb|EMT04440.1|  Actin-depolymerizing factor 1                           197   1e-60   
emb|CDY51146.1|  BnaA09g51810D                                          204   2e-60   
gb|AAT42170.1|  putative actin depolymerizing factor                    206   2e-60   
gb|AAL91666.1|  pollen specific actin-depolymerizing factor 1           196   2e-60   
ref|XP_006421922.1|  hypothetical protein CICLE_v10007087mg             196   2e-60   
ref|XP_002865909.1|  hypothetical protein ARALYDRAFT_495305             196   2e-60   
ref|XP_010537182.1|  PREDICTED: actin-depolymerizing factor 7-lik...    196   3e-60   
emb|CDP05195.1|  unnamed protein product                                196   3e-60   
ref|XP_002510785.1|  actin depolymerizing factor, putative              206   4e-60   
ref|XP_003611106.1|  Actin depolymerizing factor                        195   4e-60   
sp|Q0DLA3.2|ADF7_ORYSJ  RecName: Full=Actin-depolymerizing factor...    195   5e-60   
ref|XP_009793756.1|  PREDICTED: actin-depolymerizing factor 7-like      195   5e-60   
ref|XP_004157224.1|  PREDICTED: uncharacterized LOC101212555            203   6e-60   
ref|XP_004140838.1|  PREDICTED: uncharacterized protein LOC101212555    203   6e-60   
ref|XP_006653969.1|  PREDICTED: actin-depolymerizing factor 7-like      195   7e-60   
gb|AAD51856.1|AF179295_1  putative actin depolymerizing factor          194   7e-60   
ref|XP_007158489.1|  hypothetical protein PHAVU_002G156700g             195   8e-60   
gb|AAC13618.1|  Similar to actin binding protein; F6N23.12              194   9e-60   
ref|XP_003570044.1|  PREDICTED: actin-depolymerizing factor 1           194   1e-59   
ref|XP_004133872.1|  PREDICTED: actin-depolymerizing factor 10-like     194   1e-59   
ref|XP_008439227.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    202   1e-59   
ref|XP_011076485.1|  PREDICTED: uncharacterized protein C683.02c        202   2e-59   
ref|XP_002877449.1|  hypothetical protein ARALYDRAFT_484981             194   2e-59   
gb|KHN35014.1|  Actin-depolymerizing factor 7                           193   2e-59   
ref|XP_011030201.1|  PREDICTED: uncharacterized protein LOC105129717    199   2e-59   
ref|XP_006341722.1|  PREDICTED: actin-depolymerizing factor 10-like     193   3e-59   
ref|XP_009400269.1|  PREDICTED: actin-depolymerizing factor-like        193   3e-59   
ref|XP_009137539.1|  PREDICTED: actin-depolymerizing factor-like        193   3e-59   
ref|XP_010537181.1|  PREDICTED: actin-depolymerizing factor 7-lik...    193   3e-59   
ref|XP_011091992.1|  PREDICTED: actin-depolymerizing factor 10-like     193   3e-59   
ref|NP_001059648.1|  Os07g0484200                                       193   4e-59   
ref|XP_006491074.1|  PREDICTED: actin-depolymerizing factor 10-like     193   4e-59   
ref|NP_001054456.1|  Os05g0113400                                       193   4e-59   
gb|KDP28647.1|  hypothetical protein JCGZ_14418                         192   4e-59   
gb|EPS69954.1|  hypothetical protein M569_04811                         194   5e-59   
gb|AFN53632.1|  actin-depolymerizing factor 12                          199   6e-59   
gb|EYU25097.1|  hypothetical protein MIMGU_mgv11b015928mg               192   6e-59   
ref|XP_010238336.1|  PREDICTED: actin-depolymerizing factor 9           192   7e-59   
ref|XP_010089132.1|  Actin-depolymerizing factor 7                      192   7e-59   
ref|XP_011048781.1|  PREDICTED: uncharacterized protein LOC105142716    202   8e-59   
ref|XP_010533658.1|  PREDICTED: actin-depolymerizing factor 8-like      192   8e-59   
ref|XP_009342975.1|  PREDICTED: actin-depolymerizing factor 7           192   1e-58   
gb|AFS49701.1|  actin-depolymerizing factor 7                           192   1e-58   
ref|XP_009771651.1|  PREDICTED: actin-depolymerizing factor 12-like     192   1e-58   
ref|XP_006657701.1|  PREDICTED: actin-depolymerizing factor 9-like      192   2e-58   
dbj|BAK05349.1|  predicted protein                                      191   2e-58   
gb|AFN53688.1|  putative actin-depolymerizing factor 12                 199   2e-58   
ref|XP_010038440.1|  PREDICTED: uncharacterized protein LOC104426974    200   2e-58   
ref|XP_003569002.1|  PREDICTED: actin-depolymerizing factor 7           191   2e-58   
gb|EEC82036.1|  hypothetical protein OsI_26009                          191   2e-58   
ref|XP_006353297.1|  PREDICTED: actin-depolymerizing factor 12-like     191   2e-58   
ref|XP_004152385.1|  PREDICTED: actin-depolymerizing factor 7-like      191   3e-58   
ref|XP_010317604.1|  PREDICTED: actin-depolymerizing factor 12          191   3e-58   
gb|KDO72931.1|  hypothetical protein CISIN_1g032504mg                   190   3e-58   
emb|CDY27075.1|  BnaA02g10950D                                          199   3e-58   
ref|XP_008376578.1|  PREDICTED: actin-depolymerizing factor 7 iso...    190   3e-58   
gb|EMS51874.1|  Actin-depolymerizing factor 6                           196   3e-58   
emb|CDY38916.1|  BnaA03g12630D                                          199   4e-58   
dbj|BAJ93061.1|  predicted protein                                      191   4e-58   
ref|XP_011470359.1|  PREDICTED: actin-depolymerizing factor 7 iso...    191   4e-58   
emb|CDX90057.1|  BnaA10g00250D                                          190   4e-58   
emb|CDX92721.1|  BnaC07g39790D                                          192   5e-58   
ref|XP_010521323.1|  PREDICTED: actin-depolymerizing factor 7-like      190   6e-58   
emb|CAA18167.1|  actin depolymerizing factor-like protein               189   7e-58   
ref|XP_004960504.1|  PREDICTED: actin-depolymerizing factor 7-like      190   7e-58   
ref|XP_002460700.1|  hypothetical protein SORBIDRAFT_02g033380          190   8e-58   
ref|XP_010327379.1|  PREDICTED: actin-depolymerizing factor 10-like     190   8e-58   
gb|EMT12807.1|  Actin-depolymerizing factor 7                           191   1e-57   
gb|EYU32098.1|  hypothetical protein MIMGU_mgv1a026462mg                189   1e-57   
ref|XP_004957704.1|  PREDICTED: actin-depolymerizing factor 2-like      189   2e-57   
ref|XP_009630108.1|  PREDICTED: actin-depolymerizing factor 10-like     189   2e-57   
ref|XP_011024326.1|  PREDICTED: actin-depolymerizing factor 1-lik...    187   2e-57   
ref|XP_010040886.1|  PREDICTED: actin-depolymerizing factor 7-like      188   3e-57   
ref|NP_568915.2|  actin depolymerizing factor 3                         187   3e-57   
ref|XP_010227222.1|  PREDICTED: uncharacterized protein LOC100826202    199   3e-57   
ref|XP_006650806.1|  PREDICTED: actin-depolymerizing factor 4-like      188   3e-57   
ref|NP_001051721.1|  Os03g0820600                                       188   3e-57   
gb|EYU35082.1|  hypothetical protein MIMGU_mgv1a015967mg                188   4e-57   
gb|KFK30636.1|  hypothetical protein AALP_AA6G007700                    191   4e-57   
ref|XP_007218580.1|  hypothetical protein PRUPE_ppa013189mg             187   6e-57   
ref|XP_009601830.1|  PREDICTED: uncharacterized protein LOC104097027    197   7e-57   
emb|CDY50194.1|  BnaA03g47540D                                          190   7e-57   
ref|XP_011089446.1|  PREDICTED: LOW QUALITY PROTEIN: actin-depoly...    186   7e-57   
ref|XP_010671964.1|  PREDICTED: actin-depolymerizing factor 7           187   7e-57   
ref|XP_006590210.1|  PREDICTED: uncharacterized protein LOC100804471    195   8e-57   
ref|XP_006606908.1|  PREDICTED: uncharacterized protein LOC100783153    195   8e-57   
gb|EAY92368.1|  hypothetical protein OsI_14097                          187   1e-56   
ref|XP_006339546.1|  PREDICTED: actin-depolymerizing factor 12-like     187   1e-56   
gb|KHN21743.1|  Actin-depolymerizing factor 7                           186   1e-56   
gb|AES62539.2|  cofilin/actin-depolymerizing factor-like protein        199   2e-56   
ref|XP_009787751.1|  PREDICTED: actin-depolymerizing factor 10-like     186   2e-56   
ref|NP_001105590.1|  actin-depolymerizing factor 2                      186   2e-56   
ref|XP_009767744.1|  PREDICTED: actin-depolymerizing factor 7-lik...    186   2e-56   
ref|XP_003592288.1|  Actin depolymerizing factor                        198   2e-56   
gb|EMT14364.1|  Actin-depolymerizing factor 6                           186   2e-56   
emb|CDX94438.1|  BnaC01g17460D                                          185   3e-56   
ref|XP_010105396.1|  Actin-depolymerizing factor 7                      185   3e-56   
emb|CDX91636.1|  BnaC02g15240D                                          185   3e-56   
ref|XP_010227656.1|  PREDICTED: actin-depolymerizing factor 4-like      185   4e-56   
ref|NP_001105463.1|  actin-depolymerizing factor 1                      185   5e-56   
dbj|BAB10533.1|  actin depolymerizing factor-like                       185   5e-56   
ref|XP_009595762.1|  PREDICTED: actin-depolymerizing factor 10-like     185   6e-56   
ref|XP_009628017.1|  PREDICTED: actin-depolymerizing factor 7-like      184   6e-56   
emb|CDY00526.1|  BnaA10g07470D                                          184   6e-56   
gb|ACN27286.1|  unknown                                                 184   7e-56   
gb|EPS71217.1|  hypothetical protein M569_03542                         184   8e-56   
ref|XP_002511837.1|  actin depolymerizing factor, putative              184   9e-56   
ref|XP_008668647.1|  PREDICTED: actin-depolymerizing factor 2 iso...    184   1e-55   
ref|XP_008376580.1|  PREDICTED: uncharacterized protein LOC103439...    191   1e-55   
gb|ABK23520.1|  unknown                                                 184   1e-55   
emb|CDY31909.1|  BnaC09g28350D                                          184   1e-55   
emb|CDY52365.1|  BnaA08g31000D                                          183   2e-55   
gb|KHG04895.1|  Actin-depolymerizing factor 10 -like protein            183   2e-55   
ref|XP_004137944.1|  PREDICTED: actin-depolymerizing factor 2-like      184   3e-55   
gb|ACR34799.1|  unknown                                                 183   3e-55   
ref|XP_009408567.1|  PREDICTED: actin-depolymerizing factor 11-like     182   8e-55   
ref|XP_011470360.1|  PREDICTED: uncharacterized protein LOC101314...    189   1e-54   
ref|XP_008377508.1|  PREDICTED: actin-depolymerizing factor 7-lik...    181   1e-54   
gb|AIZ95472.1|  actin-depolymerizing factor 3                           181   2e-54   
ref|XP_009139339.1|  PREDICTED: actin-depolymerizing factor             181   2e-54   
ref|XP_008651860.1|  PREDICTED: actin-depolymerizing factor 1 iso...    181   3e-54   
dbj|BAK00003.1|  predicted protein                                      181   3e-54   
ref|XP_009388955.1|  PREDICTED: actin-depolymerizing factor 11-like     180   5e-54   
gb|EMS50122.1|  Actin-depolymerizing factor 4                           181   5e-54   
ref|XP_010906274.1|  PREDICTED: actin-depolymerizing factor-like ...    180   6e-54   
ref|XP_009371344.1|  PREDICTED: uncharacterized protein LOC103960584    189   7e-54   
gb|KCW50262.1|  hypothetical protein EUGRSUZ_J00048                     178   1e-53   



>ref|XP_009612959.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana tomentosiformis]
Length=139

 Score =   242 bits (618),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAVHDDCKLKFLELKTKRAYRFIV+KIEEKQKQVIVEKLGEPA+SY+DF   L
Sbjct  1    MANSASGMAVHDDCKLKFLELKTKRAYRFIVFKIEEKQKQVIVEKLGEPAESYEDFCTHL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDFLT+ESVPKSRIFFIAWSPDT+KVRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFLTKESVPKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002299887.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa]
 ref|XP_006387927.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011000286.1| PREDICTED: actin-depolymerizing factor 2 [Populus euphratica]
 gb|ABK92579.1| unknown [Populus trichocarpa]
 gb|ABK96321.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE84692.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa]
 gb|ERP46841.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   242 bits (617),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEEKQKQVIVEKLGEPAQSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPAQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+V KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KCW50259.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=139

 Score =   242 bits (617),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEEKQKQVIVEKLGEPA SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPANSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+VPKSRI FIAWSPDT+KVR+KMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFMTEENVPKSRIIFIAWSPDTSKVRNKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010031003.1| PREDICTED: actin-depolymerizing factor 2-like [Eucalyptus grandis]
 gb|KCW50263.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=139

 Score =   241 bits (616),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEEKQKQVIVEKLGEPA SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPANSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+VPKSRI FIAWSPDT+KVR+KMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFMTEENVPKSRIIFIAWSPDTSKVRNKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|ABD66505.1| actin depolymerizing factor 3 [Gossypium hirsutum]
 gb|KJB16926.1| hypothetical protein B456_002G254700 [Gossypium raimondii]
Length=139

 Score =   241 bits (614),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELKTKR +RFIV+KIEEKQKQVIVEKLGEP +SY+DFT CL
Sbjct  1    MANAASGMAVHDDCKLKFLELKTKRTHRFIVFKIEEKQKQVIVEKLGEPTESYEDFTKCL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDFLT E+VPKSRIFFIAWSPDT+++RSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFLTAENVPKSRIFFIAWSPDTSRIRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|EYU36258.1| hypothetical protein MIMGU_mgv1a015971mg [Erythranthe guttata]
Length=139

 Score =   241 bits (614),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAVHDDCKLKF+ELKTKR +RFIV+KIEEKQKQV+VEKLGEP Q+Y+DFTA L
Sbjct  1    MANSASGMAVHDDCKLKFMELKTKRTHRFIVFKIEEKQKQVLVEKLGEPVQTYEDFTANL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T+E+VPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFVTDENVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009775372.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana sylvestris]
Length=139

 Score =   241 bits (614),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAVHDDCKLKFLELKTKR YRFIV+KIEEKQKQVIVEKLGEPA+SY+DF   L
Sbjct  1    MANSASGMAVHDDCKLKFLELKTKRTYRFIVFKIEEKQKQVIVEKLGEPAESYEDFCTHL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDFLT+ESVPKSRIFFIAWSPDT+KVRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFLTKESVPKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004149045.1| PREDICTED: actin-depolymerizing factor 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004149046.1| PREDICTED: actin-depolymerizing factor 2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004171741.1| PREDICTED: actin-depolymerizing factor 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004171742.1| PREDICTED: actin-depolymerizing factor 2-like isoform 2 [Cucumis 
sativus]
 gb|KGN65663.1| hypothetical protein Csa_1G480180 [Cucumis sativus]
Length=139

 Score =   240 bits (613),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELKTKR YR+IVYKIEEKQKQV VEKLGEP QSY+DFTACL
Sbjct  1    MANAASGMAVHDDCKLKFLELKTKRTYRYIVYKIEEKQKQVTVEKLGEPGQSYEDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDF+FLTE +VPKSRIFFIAWSPDT+KVRSKMIYASSKD+F+REL GIQ+E
Sbjct  61   PADECRYAVYDFEFLTEGNVPKSRIFFIAWSPDTSKVRSKMIYASSKDKFRRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_008457551.1| PREDICTED: actin-depolymerizing factor 2 [Cucumis melo]
 gb|ADN34239.1| actin depolymerizing factor-like protein [Cucumis melo subsp. 
melo]
Length=139

 Score =   240 bits (612),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELKTKR YRFIVYKIEEKQKQV VEK+GEP QSY+DFTACL
Sbjct  1    MANAASGMAVHDDCKLKFLELKTKRTYRFIVYKIEEKQKQVTVEKVGEPGQSYEDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDF+FLTE +VPKSRIFFIAWSPDT+KVRSKMIYASSKD+F+REL GIQ+E
Sbjct  61   PADECRYAVYDFEFLTEGNVPKSRIFFIAWSPDTSKVRSKMIYASSKDKFRRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|EPS73519.1| actin-depolymerizing factor, partial [Genlisea aurea]
Length=143

 Score =   240 bits (612),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  RTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFT  360
            R  MAN+ASGMAVHDDCKLKF+ELK KR +RFIVYKIEEKQKQV+VEKLGEP Q+Y+DFT
Sbjct  2    RGAMANAASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVVVEKLGEPTQTYEDFT  61

Query  361  ACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGI  540
            A LPA ECRYAVYDFDFLTE++VPKSRIFFIAWSPDTAKVR+KMIYASSKDRFKREL GI
Sbjct  62   ASLPAQECRYAVYDFDFLTEDNVPKSRIFFIAWSPDTAKVRNKMIYASSKDRFKRELDGI  121

Query  541  QVELQATDP  567
            QVELQATDP
Sbjct  122  QVELQATDP  130



>ref|XP_003594440.1| Actin depolymerizing factor [Medicago truncatula]
 gb|AES64691.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
 gb|AFK47537.1| unknown [Medicago truncatula]
Length=139

 Score =   239 bits (610),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELK KR +RFIVYKIEEKQKQVIVEKLGEPAQ Y+DFTACL
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVIVEKLGEPAQGYEDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDF++LTEE+VPKSRIFFI WSPDTA+VRSKMIYAS+K+RFKREL GIQ+E
Sbjct  61   PADECRYAVYDFEYLTEENVPKSRIFFIGWSPDTARVRSKMIYASTKERFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|ABD63906.1| actin depolymerizing factor 2 [Gossypium hirsutum]
 gb|KHG27900.1| Actin-depolymerizing factor 2 [Gossypium arboreum]
 gb|KHG27902.1| Actin-depolymerizing factor 2 [Gossypium arboreum]
Length=139

 Score =   239 bits (609),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR +RFIV+KIEEKQKQVIVEKLGEP +SY+DFT CL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGEPTESYEDFTKCL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDFLT E+VPKSRIFFIAWSPDT+++RSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFLTAENVPKSRIFFIAWSPDTSRIRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002314195.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|EEE88150.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   238 bits (607),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEE+QKQVIVEKLGEPAQSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEEQKQVIVEKLGEPAQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+V KSRIFFIAW PDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIFFIAWCPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_011042674.1| PREDICTED: actin-depolymerizing factor 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011042675.1| PREDICTED: actin-depolymerizing factor 2-like isoform X2 [Populus 
euphratica]
Length=139

 Score =   237 bits (604),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEEKQKQVIVEKLGEPAQSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPAQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECR+AVYDFDF+T E+V KSRIFFIAWSPDT++VRS MIYASSKDRFKREL GIQVE
Sbjct  61   PADECRFAVYDFDFVTAENVQKSRIFFIAWSPDTSRVRSNMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|ACJ84098.1| unknown [Medicago truncatula]
Length=139

 Score =   236 bits (603),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELK KR +RFIVYKIEEKQKQVIVEKLGEPAQ Y+DFTACL
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVIVEKLGEPAQGYEDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDF++LTEE+VPKSRIFFI WSPDTA+VRSKMIYAS+K+RFK EL GIQ+E
Sbjct  61   PADECRYAVYDFEYLTEENVPKSRIFFIGWSPDTARVRSKMIYASTKERFKGELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_011016059.1| PREDICTED: actin-depolymerizing factor 2-like [Populus euphratica]
Length=139

 Score =   236 bits (603),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHD+CKLKFLELK KR YRFIVYKIEE+QKQVIVEKLGEPAQSY+DFTA L
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRFIVYKIEEEQKQVIVEKLGEPAQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+V KSRIFFIAW PDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIFFIAWCPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KDP29838.1| hypothetical protein JCGZ_18413 [Jatropha curcas]
Length=139

 Score =   236 bits (602),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR +RFIV+KIEEKQKQV+VEKLGEPA SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVVVEKLGEPANSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+V KSRI FIAWSPDT+KVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIVFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|ABD66508.1| actin depolymerizing factor 6 [Gossypium hirsutum]
 gb|KJB16927.1| hypothetical protein B456_002G254800 [Gossypium raimondii]
Length=139

 Score =   236 bits (602),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF ELK KR +RFIV+KIEEKQKQVIVEKLGEP +SY+DFT CL
Sbjct  1    MANAASGMAVHDDCKLKFQELKAKRTHRFIVFKIEEKQKQVIVEKLGEPTESYEDFTKCL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDFLT E+VPKSRIFFIAWSPDT+++RSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFLTAENVPKSRIFFIAWSPDTSRIRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010260094.1| PREDICTED: actin-depolymerizing factor 2-like [Nelumbo nucifera]
Length=139

 Score =   236 bits (602),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQV+VEKLGEP QSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|AFK42408.1| unknown [Lotus japonicus]
Length=139

 Score =   236 bits (602),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+F+ELK KR +RFI+YKIEEKQKQVIVEKLGEPAQ Y+DF ACL
Sbjct  1    MANAASGMAVHDDCKLRFVELKAKRTHRFIIYKIEEKQKQVIVEKLGEPAQGYEDFAACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDF+FLTE +VPKSRIFF+AWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFEFLTEGNVPKSRIFFVAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KHG06644.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
 gb|KJB83792.1| hypothetical protein B456_013G264800 [Gossypium raimondii]
Length=139

 Score =   236 bits (601),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQV+VEKLGEP+QSYDDFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSQSYDDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|EYU18949.1| hypothetical protein MIMGU_mgv1a015984mg [Erythranthe guttata]
Length=139

 Score =   236 bits (601),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAVHDDCKLKF+ELK KR +RFIVYKIEEKQKQV+VEKLGEP ++Y+DFTA L
Sbjct  1    MANSASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVMVEKLGEPIETYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+TEESV KS+IFFIAWSPDTAKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFVTEESVQKSKIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006586815.1| PREDICTED: actin-depolymerizing factor 2-like [Glycine max]
 gb|KHN40738.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=139

 Score =   236 bits (601),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELKTKR +RFIV+KIEE+QKQVIVEKLGEPAQ Y+DFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKTKRTHRFIVFKIEEQQKQVIVEKLGEPAQGYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDF++LTE +VPKSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFEYLTEGNVPKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002314194.1| actin-depolymerizing factor 3 family protein [Populus trichocarpa]
 gb|ABK96064.1| unknown [Populus trichocarpa]
 gb|EEE88149.1| actin-depolymerizing factor 3 family protein [Populus trichocarpa]
Length=139

 Score =   236 bits (601),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEEKQKQVIVEKLGEPAQSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPAQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECR+AVYDFDF+T E+V KSRIFFIAW PDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRFAVYDFDFVTAENVQKSRIFFIAWCPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|EPS60626.1| hypothetical protein M569_14175, partial [Genlisea aurea]
Length=150

 Score =   236 bits (601),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 123/137 (90%), Gaps = 3/137 (2%)
 Frame = +1

Query  157  SPIFLRSPRTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEP  336
            SPI    P   MANSASGMAVHDDCKLKF+ELK KR +RFIV+KIEEKQKQVIVEKLGEP
Sbjct  4    SPI---DPSALMANSASGMAVHDDCKLKFMELKAKRTHRFIVFKIEEKQKQVIVEKLGEP  60

Query  337  AQSYDDFTACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDR  516
            A++Y+ F A LPA+ECRYAVYDF+FLTE +VPKSRIFFIAWSPDTAKVRSKMIYASSKDR
Sbjct  61   AETYESFAASLPAEECRYAVYDFEFLTEGNVPKSRIFFIAWSPDTAKVRSKMIYASSKDR  120

Query  517  FKRELGGIQVELQATDP  567
            FKREL GIQVELQATDP
Sbjct  121  FKRELDGIQVELQATDP  137



>ref|XP_010553292.1| PREDICTED: actin-depolymerizing factor 1 [Tarenaya hassleriana]
Length=139

 Score =   235 bits (600),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK+KR YRFIVYKIEEKQKQVIVEKLGEP+QSY+DF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKSKRTYRFIVYKIEEKQKQVIVEKLGEPSQSYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTSENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002284292.1| PREDICTED: actin-depolymerizing factor 2 [Vitis vinifera]
Length=139

 Score =   235 bits (600),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEEKQKQV+VEK+GEP QSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KS+IFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010047513.1| PREDICTED: actin-depolymerizing factor 2 [Eucalyptus grandis]
Length=139

 Score =   234 bits (596),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR YRFIV+KIEEKQKQV+VEK+GEP QSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_007016496.1| Actin depolymerizing factor 4 [Theobroma cacao]
 gb|EOY34115.1| Actin depolymerizing factor 4 [Theobroma cacao]
Length=139

 Score =   234 bits (596),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQV+VEKLGEP QSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|NP_001238519.1| uncharacterized protein LOC100499953 [Glycine max]
 gb|ACU14320.1| unknown [Glycine max]
Length=139

 Score =   233 bits (595),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQVIVEKLGEPA  YDDF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPANGYDDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|NP_001236448.1| uncharacterized protein LOC100305514 [Glycine max]
 gb|ACU13224.1| unknown [Glycine max]
 gb|AGM20694.1| actin depolymerizing factor 1 [Glycine max]
 gb|KHN14376.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=139

 Score =   233 bits (595),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIV+KIEE+QKQVIVEKLGEPAQ Y+DFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEQQKQVIVEKLGEPAQGYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDF++LTE +VPKSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFEYLTEGNVPKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002273958.2| PREDICTED: actin-depolymerizing factor 1-like [Vitis vinifera]
 emb|CBI32606.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   235 bits (600),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 1/141 (1%)
 Frame = +1

Query  145  SAQISPIFLRSPRTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEK  324
            S+Q+S + +      MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQV+VEK
Sbjct  37   SSQVS-VLVVDRTAKMANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEK  95

Query  325  LGEPAQSYDDFTACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYAS  504
            +GEPAQSY+DFTA LPADECRYAVYDFDF+TEE+  KSRIFFIAW PD+++VRSKMIYAS
Sbjct  96   VGEPAQSYEDFTASLPADECRYAVYDFDFVTEENCQKSRIFFIAWCPDSSRVRSKMIYAS  155

Query  505  SKDRFKRELGGIQVELQATDP  567
            SKDRFKREL GIQVELQATDP
Sbjct  156  SKDRFKRELDGIQVELQATDP  176



>gb|KJB20158.1| hypothetical protein B456_003G135600 [Gossypium raimondii]
Length=139

 Score =   233 bits (595),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YR+IV+KIEEKQKQV+VEKLGEP+QSYDDFT+ L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVFKIEEKQKQVVVEKLGEPSQSYDDFTSSL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010031001.1| PREDICTED: actin-depolymerizing factor 2-like [Eucalyptus grandis]
 gb|KCW50260.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=139

 Score =   233 bits (595),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEEKQKQVIVEKLGEP  SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPTNSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFD++TEE+  KSRI FIAWSPDT+KVR+KMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDYVTEENCQKSRIIFIAWSPDTSKVRNKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009600590.1| PREDICTED: actin-depolymerizing factor 2 [Nicotiana tomentosiformis]
 ref|XP_009798392.1| PREDICTED: actin-depolymerizing factor 2 [Nicotiana sylvestris]
Length=143

 Score =   233 bits (595),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR +RFI+YKIEEKQKQV+VEKLGEP +SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIIYKIEEKQKQVVVEKLGEPTESYEDFTAGL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF TEE+V KSRIFFIAWSPDTA+VRSKMIYASSKDRFKREL G QVE
Sbjct  61   PADECRYAVYDFDFTTEENVQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGFQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KHN48988.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=154

 Score =   233 bits (595),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  RTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFT  360
            R  +AN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQVIVEKLGEPA  YDDF 
Sbjct  13   RIEVANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPANGYDDFA  72

Query  361  ACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGI  540
            A LPADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GI
Sbjct  73   ASLPADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGI  132

Query  541  QVELQATDP  567
            Q+ELQATDP
Sbjct  133  QIELQATDP  141



>ref|XP_010253266.1| PREDICTED: actin-depolymerizing factor 2 [Nelumbo nucifera]
Length=139

 Score =   233 bits (594),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQV+VEK+GEP +SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTESYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KHG23104.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
Length=139

 Score =   233 bits (594),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YR+IV+KIEEKQKQV+VEKLGEP+QSYDDFT+ L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVFKIEEKQKQVVVEKLGEPSQSYDDFTSSL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010455704.1| PREDICTED: actin-depolymerizing factor 3 [Camelina sativa]
 ref|XP_010443774.1| PREDICTED: actin-depolymerizing factor 3 [Camelina sativa]
 ref|XP_010483636.1| PREDICTED: actin-depolymerizing factor 3 [Camelina sativa]
Length=139

 Score =   233 bits (594),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELKTKR YRFIVYKIEE+QKQV+VEK+GEP QS++D  A L
Sbjct  1    MANAASGMAVHDDCKLKFMELKTKRTYRFIVYKIEEQQKQVMVEKIGEPNQSHEDLAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDFLT E VPKSRIFF+AWSPDTA+VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVFDFDFLTAEDVPKSRIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002533101.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF29273.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR YRFIV+KIEEKQKQVIVEK+GEPAQSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_007144457.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris]
 gb|AGV54234.1| actin-depolymerizing factor [Phaseolus vulgaris]
 gb|ESW16451.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris]
Length=139

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YR+IVYKIEEKQKQV+VEKLGEPA  Y+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVYKIEEKQKQVVVEKLGEPANGYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KS+IFFIAWSPD+A+VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSKIFFIAWSPDSARVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_007027090.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao]
 gb|EOY07592.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao]
Length=173

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  LRSPRTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSY  348
             ++ R  MAN+ASGMAVHD+CKLKFLELK KR YRFIV+KIEEKQKQVIVEKLGEPAQSY
Sbjct  28   FQTNRKEMANAASGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPAQSY  87

Query  349  DDFTACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRE  528
            +DF   LPADECRYAVYDFDFLT E+V KSRIFFIAWSPDT++VRSKMIYASSKDRFKRE
Sbjct  88   EDFAKSLPADECRYAVYDFDFLTPENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRE  147

Query  529  LGGIQVELQATDP  567
            L GIQVELQATDP
Sbjct  148  LDGIQVELQATDP  160



>emb|CAJ38384.1| actin-depolymerizing factor [Plantago major]
Length=139

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELKTKR +RFIVYKIEEKQKQV+VE LGEP Q+Y+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFMELKTKRTHRFIVYKIEEKQKQVMVETLGEPVQTYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFD++T ++VPKSRIFF+AWSPDTA+VR+KMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDYMTVDNVPKSRIFFVAWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_011000294.1| PREDICTED: actin-depolymerizing factor 2-like [Populus euphratica]
Length=139

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YR IV+KIEEK KQVIVEKLGEPAQSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKLKQVIVEKLGEPAQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+V KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFMTAENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>sp|Q9FVI1.1|ADF2_PETHY RecName: Full=Actin-depolymerizing factor 2; Short=ADF-2 [Petunia 
x hybrida]
 gb|AAG16974.1|AF183904_1 actin-depolymerizing factor 2 [Petunia x hybrida]
 gb|AAK72616.1| actin-depolymerizing factor 2 [Petunia x hybrida]
Length=143

 Score =   232 bits (592),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFI+YKIEEKQK+V+VEKLGEP +SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKEVVVEKLGEPTESYEDFTAGL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T+E+  KSRIFFIAWSPDTA+VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFMTKENHQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004236758.1| PREDICTED: actin-depolymerizing factor 2 [Solanum lycopersicum]
Length=143

 Score =   232 bits (592),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFI+YKIEEKQKQVIVEKLGEP +SY+DF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVIVEKLGEPTESYEDFAAGL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDTA+VRSKMIYASSKDRFKREL G QVE
Sbjct  61   PADECRYAVYDFDFMTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGFQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|ABC49719.1| actin depolymerizing factor-like protein [Arachis hypogaea]
Length=139

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIV+KIEE QKQVIVEKLGEPAQ Y+DFTACL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEENQKQVIVEKLGEPAQGYEDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAVYDF++LTE +VPKSRIFFIAWSPDT++VR+KMIYASSKDRFKREL GIQVE
Sbjct  61   PPNECRYAVYDFEYLTEGNVPKSRIFFIAWSPDTSRVRNKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002864656.1| hypothetical protein ARALYDRAFT_496124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40915.1| hypothetical protein ARALYDRAFT_496124 [Arabidopsis lyrata subsp. 
lyrata]
Length=139

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+F+ELKTKR YRFIVYKIEE+QKQV+VEK+GEPA++++   ACL
Sbjct  1    MANAASGMAVHDDCKLRFMELKTKRTYRFIVYKIEEQQKQVVVEKIGEPAETHEALAACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P+DECRYAV+DFDFLT E VPKSRIFF+AWSPDTAKVRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PSDECRYAVFDFDFLTAEDVPKSRIFFVAWSPDTAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009593022.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009801697.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana sylvestris]
Length=139

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQVIVEKLGEPA+SY+DF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPAESYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRY V+DFDF+TEE   KS+IFFIAWSPDTAKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYTVFDFDFVTEEGCQKSKIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|ADI78873.1| actin-depolymerizing factor [Hevea brasiliensis]
Length=139

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR YR+IV+KIEEK KQVIVEKLGEP QSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRYIVFKIEEKAKQVIVEKLGEPTQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006365713.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum tuberosum]
Length=143

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFI+YKIEEKQKQV+VEKLGEP +SY+DF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVVVEKLGEPTESYEDFAAGL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDTA+VRSKMIYASSKDRFKREL G QVE
Sbjct  61   PADECRYAVYDFDFMTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGFQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010529845.1| PREDICTED: actin-depolymerizing factor 2-like [Tarenaya hassleriana]
Length=139

 Score =   231 bits (590),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ SGMAVHD+CKLKFLELK KR YRFIV+KIEEKQKQVIVEKLGEP+QSY+DFTA L
Sbjct  1    MANAVSGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPSQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002299888.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|ABK93478.1| unknown [Populus trichocarpa]
 gb|ABK93508.1| unknown [Populus trichocarpa]
 gb|ABK93744.1| unknown [Populus trichocarpa]
 gb|ABK93767.1| unknown [Populus trichocarpa]
 gb|EEE84693.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YR IV+KIEEK KQVIVEKLGEPAQSY+DFTA +
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKLKQVIVEKLGEPAQSYEDFTASI  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+V KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFMTAENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_008463478.1| PREDICTED: actin-depolymerizing factor 2 isoform X1 [Cucumis 
melo]
 ref|XP_008463479.1| PREDICTED: actin-depolymerizing factor 2 isoform X2 [Cucumis 
melo]
Length=139

 Score =   231 bits (589),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FL+LK KR YRFIV+KIEEKQKQV+VEKLGEP++SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVVVEKLGEPSESYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRI FIAWSPDT+KVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_007218573.1| hypothetical protein PRUPE_ppa013105mg [Prunus persica]
 gb|EMJ19772.1| hypothetical protein PRUPE_ppa013105mg [Prunus persica]
Length=139

 Score =   231 bits (588),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHD+CKLKFLELK KR YRFIVYKIEEKQKQVIVEK+GEPA SY+DF+A L
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKVGEPADSYEDFSASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFD++TEE+  KSRI FIAWSPDT+KVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDYVTEENCQKSRIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004249528.1| PREDICTED: actin-depolymerizing factor 1-like [Solanum lycopersicum]
Length=139

 Score =   231 bits (588),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL FLELKTKR +RFIV+KIEEKQKQV+VEK+GEP QSY+DF   L
Sbjct  1    MANAASGMAVHDDCKLTFLELKTKRTHRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAESL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDTA+VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KDP35600.1| hypothetical protein JCGZ_09038 [Jatropha curcas]
Length=139

 Score =   230 bits (587),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQVIVEK+GEP QSY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPNQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KSRIFFIAWSPD ++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDASRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|AFK48761.1| unknown [Lotus japonicus]
Length=139

 Score =   230 bits (587),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ SGMAV DDCKLKFLELK KR YRFIV+KIEEKQKQV+VEKLGEPA  YDDFTA L
Sbjct  1    MANAVSGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPANGYDDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>emb|CAL25339.1| actin-depolymerizing factor [Platanus x acerifolia]
Length=139

 Score =   230 bits (587),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASG+AVHDDCKLKFLELK KR YRFIV+KIE+KQKQV+VEK+GEP QSY+DF+A L
Sbjct  1    MANAASGIAVHDDCKLKFLELKVKRTYRFIVFKIEDKQKQVVVEKVGEPTQSYEDFSASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+V KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTAENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_003629907.1| Actin depolymerizing factor-like protein [Medicago truncatula]
 gb|AET04383.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
 gb|AFK43620.1| unknown [Medicago truncatula]
Length=139

 Score =   230 bits (587),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+F+ELK KR +RFI+YKIEEKQKQVIVEKLGEP Q Y++F ACL
Sbjct  1    MANAASGMAVHDDCKLRFMELKAKRTHRFIIYKIEEKQKQVIVEKLGEPVQGYEEFAACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+D++F+TE +VPKSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVFDYEFMTEGNVPKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|ACB32233.1| actin-depolymerizing factor 1 [Solanum chacoense]
Length=139

 Score =   230 bits (587),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIV+KIEEKQKQV+VEK+GEPAQSY+DFTACL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPAQSYEDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAVYDFDF+T E+  KSRIFFIAWSPDTA+VRSKMIYAS+K+RFKREL GIQVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASTKERFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004486422.1| PREDICTED: actin-depolymerizing factor 2-like [Cicer arietinum]
Length=139

 Score =   230 bits (586),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR YRFI+YKIEE QKQV+VEKLG+P Q Y+DFTA +
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIIYKIEEAQKQVVVEKLGDPTQGYEDFTANI  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDF++LTE +VPKSRIFFI WSPDTA+VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFEYLTEGNVPKSRIFFIGWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009131962.1| PREDICTED: actin-depolymerizing factor 3 [Brassica rapa]
Length=139

 Score =   230 bits (586),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEE+QKQV+VEKLGEP QS+DDF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA++DFDF+T E+  KS+IFFIAWSPDTA+VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006281290.1| hypothetical protein CARUB_v10027340mg [Capsella rubella]
 gb|EOA14188.1| hypothetical protein CARUB_v10027340mg [Capsella rubella]
Length=139

 Score =   230 bits (586),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELKTKR+YR+IVYKIEE+QKQVIVEK+GEPA++++D  A L
Sbjct  1    MANAASGMAVHDDCKLKFMELKTKRSYRYIVYKIEEQQKQVIVEKIGEPAETHEDLAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA ECRYAV+DFDFLT E VPKSRIFF+AWSPDTA+VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PAHECRYAVFDFDFLTAEDVPKSRIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010096647.1| Actin-depolymerizing factor 2 [Morus notabilis]
 gb|EXB65315.1| Actin-depolymerizing factor 2 [Morus notabilis]
Length=159

 Score =   231 bits (588),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  166  FLRSPRTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQS  345
            F   P    AN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQVIVEKLGEP QS
Sbjct  13   FQSQPSDGSANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQS  72

Query  346  YDDFTACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKR  525
            Y+DFTA LP +ECRYAVYD+DF+TEE+V KS+I FIAWSPDT++VRSKMIYASSKDRFKR
Sbjct  73   YEDFTASLPDNECRYAVYDYDFITEENVQKSKIIFIAWSPDTSRVRSKMIYASSKDRFKR  132

Query  526  ELGGIQVELQATDP  567
            EL GIQVELQATDP
Sbjct  133  ELDGIQVELQATDP  146



>ref|XP_011094831.1| PREDICTED: actin-depolymerizing factor 1 isoform X2 [Sesamum 
indicum]
Length=139

 Score =   229 bits (585),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIV+KIEEKQKQV+VEK+GEP Q+YDDFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPTQNYDDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PVDECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004142738.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis sativus]
 ref|XP_004156722.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis sativus]
 gb|KGN51280.1| hypothetical protein Csa_5G512870 [Cucumis sativus]
Length=139

 Score =   229 bits (585),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FL+LK KR YRFIV+KIEEKQKQV+VEKLG+P++SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVVVEKLGKPSESYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRI FIAWSPDT+KVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_011077447.1| PREDICTED: actin-depolymerizing factor 1-like [Sesamum indicum]
Length=173

 Score =   231 bits (588),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 5/140 (4%)
 Frame = +1

Query  163  IFLRSPRT-----TMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKL  327
            +F  SPR+      MAN+ASGMAVHDDCKL+FLELK KR YRFI++KIEEKQKQV+VEK+
Sbjct  21   VFSWSPRSLPEAPEMANAASGMAVHDDCKLRFLELKAKRTYRFIIFKIEEKQKQVVVEKV  80

Query  328  GEPAQSYDDFTACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASS  507
            GEP QSYDDFTA LP DECRYAVYDFDF+T E+  KSRIFFIAWSPDT+++R+KMIYASS
Sbjct  81   GEPTQSYDDFTASLPVDECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRIRNKMIYASS  140

Query  508  KDRFKRELGGIQVELQATDP  567
            KDRFKREL GIQVELQATDP
Sbjct  141  KDRFKRELDGIQVELQATDP  160



>ref|XP_006341057.1| PREDICTED: actin-depolymerizing factor 1-like [Solanum tuberosum]
Length=139

 Score =   229 bits (584),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIV+KIEEKQKQV+VEK+GEPAQSY+DFTACL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPAQSYEDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAVYDFDF+T E+  KSRIFFIAWSPDTA+VRSKMIYAS+K+RFKRE+ GIQVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASTKERFKREVDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_007147534.1| hypothetical protein PHAVU_006G132700g [Phaseolus vulgaris]
 gb|ESW19528.1| hypothetical protein PHAVU_006G132700g [Phaseolus vulgaris]
Length=139

 Score =   229 bits (584),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEE+QKQVIVEKLGEP Q Y+DF + L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEQQKQVIVEKLGEPNQGYEDFASSL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDF+++TE +VPKSRIFFIAWSPDTA+VRSKMIYASSKDRF+REL GIQ+E
Sbjct  61   PADECRYAVYDFEYMTEGNVPKSRIFFIAWSPDTARVRSKMIYASSKDRFRRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|ADV04049.1| actin depolymerizing factor 4 [Hevea brasiliensis]
Length=139

 Score =   229 bits (584),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASG+AVHDDCKLKFLELK KR YRFIV+KIEEKQKQVIVEKLGEP  SY+DFTA L
Sbjct  1    MANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTNSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFD++T+E+  KSRI FIAWSPDT+KVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDYVTDENCQKSRIVFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KJB78849.1| hypothetical protein B456_013G022900 [Gossypium raimondii]
Length=139

 Score =   229 bits (584),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQV+VEK+GEP  SY+ FTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTDSYEAFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T+E+  KSRIFFIAWSPDT+KVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|ABD66504.1| actin depolymerizing factor 8 [Gossypium hirsutum]
 gb|AAY88048.2| actin depolymerizing factor [Gossypium hirsutum]
 gb|KHG23444.1| Actin-depolymerizing factor 2 [Gossypium arboreum]
Length=139

 Score =   229 bits (584),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQV+VEK+GEP  SY+ FTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTDSYEAFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T+E+  KSRIFFIAWSPDT+KVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010535543.1| PREDICTED: actin-depolymerizing factor 4 [Tarenaya hassleriana]
Length=139

 Score =   229 bits (584),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR YRFIVYKIEE+QKQVIVEK+GEPAQ+Y+DFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVYKIEEQQKQVIVEKVGEPAQTYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYA++DFDF+T E+  KS+IFFIAWSPDTA+VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PANECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006339034.1| PREDICTED: actin-depolymerizing factor 1-like [Solanum tuberosum]
Length=139

 Score =   229 bits (583),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL F ELKTKR++RFIV+KIEEKQKQV+VEK+GEP QSY+DF   L
Sbjct  1    MANAASGMAVHDDCKLTFFELKTKRSHRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAESL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDTA+VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006424770.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 ref|XP_006488280.1| PREDICTED: actin-depolymerizing factor 1-like isoform X2 [Citrus 
sinensis]
 gb|ESR38010.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 gb|KDO72932.1| hypothetical protein CISIN_1g032504mg [Citrus sinensis]
Length=139

 Score =   229 bits (583),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQVIVEKLGEP Q+Y+DF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYD+DF+T E+  KSRIFFIAWSPDTA+VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006400899.1| hypothetical protein EUTSA_v10014975mg [Eutrema salsugineum]
 gb|ESQ42352.1| hypothetical protein EUTSA_v10014975mg [Eutrema salsugineum]
Length=139

 Score =   229 bits (583),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEE+QKQVIVEK+GEP QS+DDF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVIVEKVGEPGQSHDDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA++DFDF+T E+  KS+IFF+AWSPDTA+VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIFDFDFVTAENCQKSKIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002284029.1| PREDICTED: actin-depolymerizing factor 2-like isoform X1 [Vitis 
vinifera]
 ref|XP_002284040.1| PREDICTED: actin-depolymerizing factor 2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010658601.1| PREDICTED: actin-depolymerizing factor 2-like isoform X2 [Vitis 
vinifera]
Length=139

 Score =   228 bits (582),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YR IV++IEEKQKQVIVEK+GEP QSY+DF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFQIEEKQKQVIVEKVGEPTQSYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004240356.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum lycopersicum]
 ref|XP_006367788.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum tuberosum]
Length=137

 Score =   228 bits (581),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELKTKRA+RFIV+KIEEKQ  +IVEKLGEPA+SY+DF   L
Sbjct  1    MANAASGMAVHDDCKLKFLELKTKRAFRFIVFKIEEKQ--IIVEKLGEPAESYEDFCTHL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDFLT+ESVPKSRIFFIAW PDT+KVRSKMIYASSKDRFKREL GIQ+E
Sbjct  59   PADECRYAVYDFDFLTKESVPKSRIFFIAWCPDTSKVRSKMIYASSKDRFKRELDGIQIE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>gb|ABX79380.1| actin-depolymerizing factor [Gossypium barbadense]
Length=139

 Score =   228 bits (581),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQV+VEK+GEP  SY+ FTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPIDSYEAFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T+E+  KSRIFFIAWSPDT+KVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KCW50264.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=132

 Score =   228 bits (580),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAVHDDCKLKFLELK KR YRFIVYKIEEKQKQVIVEKLGEPA SY+DFTA LPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPANSYEDFTASLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            AVYDFDF+TEE+VPKSRI FIAWSPDT+KVR+KMIYASSKDRFKREL GIQ+ELQATDP
Sbjct  61   AVYDFDFMTEENVPKSRIIFIAWSPDTSKVRNKMIYASSKDRFKRELDGIQIELQATDP  119



>gb|ADV02778.1| actin depolymerizing factor 1 [Ipomoea batatas]
Length=139

 Score =   228 bits (580),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIV+KIEEKQKQVIVEK+GEPA+SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVIVEKVGEPARSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYAVYDFDF+T E+  KS+IFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PTDECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_011027144.1| PREDICTED: actin-depolymerizing factor 1-like [Populus euphratica]
Length=139

 Score =   228 bits (580),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FL+LK KR YRFIV+KIEEKQKQVIVEKLGEPA SY++F+A L
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVIVEKLGEPADSYENFSASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFD++TEE+  KSRI FIAWSPDTA+VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDYVTEENCQKSRIVFIAWSPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>emb|CDX71068.1| BnaC03g11520D [Brassica napus]
Length=164

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  ANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLP  372
            AN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEE+QKQV+VEKLGEP QS+DDF A LP
Sbjct  27   ANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASLP  86

Query  373  ADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVEL  552
            ADECRYA++DFDF+T E+  KS+IFFIAWSPDTA+VRSKMIYASSKDRFKREL GIQVEL
Sbjct  87   ADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVEL  146

Query  553  QATDP  567
            QATDP
Sbjct  147  QATDP  151



>emb|CDX80216.1| BnaC09g35260D [Brassica napus]
Length=252

 Score =   231 bits (590),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  TTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTA  363
            + MAN+ASGMAVHDDCKLKFLELK KR +RFIVYKIEE+QKQV+VEKLGEP QS+DDF A
Sbjct  112  SAMANAASGMAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAA  171

Query  364  CLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQ  543
             LPADECRYAV+DFDF+T ES  KS+IFF+AWSPDTA+VRSKMIYASSKDRFKREL GIQ
Sbjct  172  SLPADECRYAVFDFDFVTAESCQKSKIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQ  231

Query  544  VELQATDP  567
            VELQATDP
Sbjct  232  VELQATDP  239



>ref|XP_004246462.1| PREDICTED: actin-depolymerizing factor 1 [Solanum lycopersicum]
Length=139

 Score =   228 bits (580),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIV+KIEEKQKQV+VEK+GEPAQ Y+DFTACL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPAQGYEDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYAS+K+RFKREL GIQVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASTKERFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_007206123.1| hypothetical protein PRUPE_ppa013110mg [Prunus persica]
 ref|XP_008223136.1| PREDICTED: actin-depolymerizing factor 2 [Prunus mume]
 gb|EMJ07322.1| hypothetical protein PRUPE_ppa013110mg [Prunus persica]
Length=139

 Score =   227 bits (579),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASG AV DDCKLKFLELK KR YRFIV+KIEE+QKQVIVEKLGEPA+SY++FTA L
Sbjct  1    MANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIEEEQKQVIVEKLGEPAESYENFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KFK27528.1| hypothetical protein AALP_AA8G395200 [Arabis alpina]
Length=139

 Score =   227 bits (579),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEE+QKQV+VEK+GEP QS+DDF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKVGEPGQSHDDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYA++DFDF+T E+  KS+IFFIAWSPDTA+VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PANECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010669849.1| PREDICTED: actin-depolymerizing factor 4-like [Beta vulgaris 
subsp. vulgaris]
Length=139

 Score =   227 bits (579),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV D CKLKFLELKTKR YRFI++KIEEKQKQVIVEK+GEP++SY+DFTA +
Sbjct  1    MANAASGMAVDDQCKLKFLELKTKRTYRFIIFKIEEKQKQVIVEKVGEPSESYEDFTASI  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KSRIFFIAW+PDTAKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWAPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>emb|CBI31711.3| unnamed protein product [Vitis vinifera]
Length=202

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YR IV++IEEKQKQVIVEK+GEP QSY+DF A L
Sbjct  64   MANAASGMAVHDDCKLKFLELKAKRTYRSIVFQIEEKQKQVIVEKVGEPTQSYEDFAASL  123

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  124  PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  183

Query  550  LQATDP  567
            LQATDP
Sbjct  184  LQATDP  189



>gb|KJB78850.1| hypothetical protein B456_013G022900 [Gossypium raimondii]
Length=149

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  TMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTAC  366
            + AN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQV+VEK+GEP  SY+ FTA 
Sbjct  10   SQANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTDSYEAFTAS  69

Query  367  LPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQV  546
            LPADECRYAVYDFDF+T+E+  KSRIFFIAWSPDT+KVRSKMIYASSKDRFKREL GIQV
Sbjct  70   LPADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQV  129

Query  547  ELQATDP  567
            ELQATDP
Sbjct  130  ELQATDP  136



>ref|XP_004495011.1| PREDICTED: actin-depolymerizing factor 2-like [Cicer arietinum]
Length=139

 Score =   227 bits (579),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+D+CKLKFLELK KR YR+I+YKIEEKQKQV+V+KLGEPA  YDDFTA L
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYIIYKIEEKQKQVVVDKLGEPANGYDDFTANL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAW PDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWCPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>emb|CDX88730.1| BnaA03g09190D [Brassica napus]
Length=154

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  ANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLP  372
            AN+ASGMAVHDDCKLKFLELK KR YRFIVYKIEE+QKQV+VEKLGEP QS+DDF A LP
Sbjct  17   ANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASLP  76

Query  373  ADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVEL  552
            ADECRYA++DFDF+T E+  KS+IFFIAWSPDTA+VRSKMIYASSKDRFKREL GIQVEL
Sbjct  77   ADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVEL  136

Query  553  QATDP  567
            QATDP
Sbjct  137  QATDP  141



>emb|CDP06641.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   228 bits (581),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            +AN+ASGMAVHDDCKL+FLELK KR YRFIVYKIEEKQKQV+VEK+GEP +SY+DFTA L
Sbjct  25   IANAASGMAVHDDCKLRFLELKAKRTYRFIVYKIEEKQKQVVVEKVGEPTKSYEDFTASL  84

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  85   PVDECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  144

Query  550  LQATDP  567
            LQATDP
Sbjct  145  LQATDP  150



>ref|XP_006424771.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 ref|XP_006488279.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Citrus 
sinensis]
 gb|ESR38011.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
Length=141

 Score =   227 bits (578),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  ANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLP  372
            AN+ASGMAVHDDCKLKFLELK KR YRFIV+KIEEKQKQVIVEKLGEP Q+Y+DF A LP
Sbjct  4    ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLP  63

Query  373  ADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVEL  552
            A+ECRYAVYD+DF+T E+  KSRIFFIAWSPDTA+VRSKMIYASSKDRFKREL GIQVEL
Sbjct  64   AEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVEL  123

Query  553  QATDP  567
            QATDP
Sbjct  124  QATDP  128



>ref|XP_009120511.1| PREDICTED: actin-depolymerizing factor 3-like [Brassica rapa]
Length=139

 Score =   227 bits (578),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR +RFIVYKIEE+QKQV+VEKLGEP QS+DDF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+T ES  KS+IFF+AWSPDTA+VRSKMIYASSKDR KREL GIQVE
Sbjct  61   PADECRYAVFDFDFVTAESCQKSKIFFVAWSPDTARVRSKMIYASSKDRCKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|NP_851227.1| actin depolymerizing factor 3 [Arabidopsis thaliana]
 sp|Q9ZSK4.1|ADF3_ARATH RecName: Full=Actin-depolymerizing factor 3; Short=ADF-3; Short=AtADF3 
[Arabidopsis thaliana]
 gb|AAK25879.1|AF360169_1 putative actin depolymerizing factor 3 [Arabidopsis thaliana]
 gb|AAD09109.1| actin depolymerizing factor 3 [Arabidopsis thaliana]
 dbj|BAB08356.1| actin depolymerizing factor 3 [Arabidopsis thaliana]
 gb|AAK91351.1| AT5g59880/mmn10_100 [Arabidopsis thaliana]
 gb|AAL07194.1| putative actin depolymerizing factor 3 [Arabidopsis thaliana]
 gb|AAM16189.1| AT5g59880/mmn10_100 [Arabidopsis thaliana]
 gb|AAM63276.1| actin depolymerizing factor 3-like protein [Arabidopsis thaliana]
 gb|AED97245.1| actin depolymerizing factor 3 [Arabidopsis thaliana]
Length=139

 Score =   226 bits (577),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELKTKR +RFI+YKIEE QKQVIVEK+GEP Q+++D  A L
Sbjct  1    MANAASGMAVHDDCKLKFMELKTKRTHRFIIYKIEELQKQVIVEKIGEPGQTHEDLAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA++DFDF++ E VP+SRIFF+AWSPDTA+VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIFDFDFVSSEGVPRSRIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_011094830.1| PREDICTED: actin-depolymerizing factor 1 isoform X1 [Sesamum 
indicum]
Length=150

 Score =   227 bits (578),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  ANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLP  372
            AN+ASGMAVHDDCKL+FLELK KR +RFIV+KIEEKQKQV+VEK+GEP Q+YDDFTA LP
Sbjct  13   ANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPTQNYDDFTASLP  72

Query  373  ADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVEL  552
             DECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVEL
Sbjct  73   VDECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVEL  132

Query  553  QATDP  567
            QATDP
Sbjct  133  QATDP  137



>gb|AFK39900.1| unknown [Lotus japonicus]
 gb|AFK46679.1| unknown [Lotus japonicus]
Length=137

 Score =   226 bits (576),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+F+ELKTKR YRFIVYKIE+KQ  VIVEKLGEP Q Y+DFTA L
Sbjct  1    MANAASGMAVHDDCKLRFMELKTKRTYRFIVYKIEDKQ--VIVEKLGEPGQGYEDFTANL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDF++LTE +VPKSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  59   PADECRYAVYDFEYLTEGNVPKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>ref|XP_010669850.1| PREDICTED: actin-depolymerizing factor 4 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score =   226 bits (577),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV D CKLKFLELKTKR YRFI++KIEEKQKQVIVEK+GEP++SY+DF A +
Sbjct  1    MANAASGMAVDDQCKLKFLELKTKRTYRFIIFKIEEKQKQVIVEKVGEPSESYEDFAASI  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KSRIFFIAWSPDTAKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004504229.1| PREDICTED: actin-depolymerizing factor 2-like [Cicer arietinum]
Length=146

 Score =   226 bits (576),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 118/133 (89%), Gaps = 7/133 (5%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFI+YKIEE QKQVIVEKLGEP Q Y+DF ACL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIIYKIEENQKQVIVEKLGEPIQGYEDFAACL  60

Query  370  PA-------DECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRE  528
            PA       DECRYAVYDF+FLTE +VPKSRIFFIAWSPDT++VR+KMIYASSKDRFKRE
Sbjct  61   PAFPANLPADECRYAVYDFEFLTEGNVPKSRIFFIAWSPDTSRVRNKMIYASSKDRFKRE  120

Query  529  LGGIQVELQATDP  567
            L GIQ+ELQATDP
Sbjct  121  LDGIQIELQATDP  133



>gb|EYU26572.1| hypothetical protein MIMGU_mgv1a015955mg [Erythranthe guttata]
Length=139

 Score =   226 bits (575),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR++RFIV+KIEEKQKQVIVEK+GEP +SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRSHRFIVFKIEEKQKQVIVEKVGEPNESYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRY VYDFDF+T E+  KS+IFFIAWSPDTA++R+KMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYTVYDFDFVTAENCQKSKIFFIAWSPDTARIRNKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>emb|CDP00056.1| unnamed protein product [Coffea canephora]
Length=135

 Score =   225 bits (574),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAVHDDCKLKFLELK KR YRFI+YKIEEKQKQVIVEKLGEPA  Y++FTA LPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVIVEKLGEPANGYEEFTANLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            AVYD+DF+TEE+VPKSRIFFIAWSPDT+KVRSKMIYASSKDRFKREL GIQVELQATDP
Sbjct  61   AVYDYDFMTEENVPKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVELQATDP  119



>ref|XP_002316301.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|ABK95121.1| unknown [Populus trichocarpa]
 gb|EEF02472.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   226 bits (575),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FL+LK KR YRFIV+KIEEKQKQVIVEKLGEPA SY++F+A L
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVIVEKLGEPADSYENFSASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFD++TEE+  KSRI FIAW PDTA+VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDYVTEENCQKSRIVFIAWCPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010909358.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=139

 Score =   225 bits (574),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR YRFI+YKIEEK KQVIVEK+GEP  SY+DFTA L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIYKIEEKLKQVIVEKVGEPTLSYEDFTAAL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+TEE+  KS+IFFIAWSPDT+KVRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KHN05922.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=139

 Score =   225 bits (574),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHD+CKLKFLELK KR YR+IV+KIEEK KQVIVEKLG+PA  YD+F A L
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRYIVFKIEEKSKQVIVEKLGDPANGYDEFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004307556.2| PREDICTED: uncharacterized protein LOC101301142 [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  TTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTA  363
            + MAN+ASGMAVHDDCKLKFL+LK KR YRFIVYKIEEKQKQV+VEK+GEP++SY+DF+A
Sbjct  306  SNMANAASGMAVHDDCKLKFLDLKAKRTYRFIVYKIEEKQKQVVVEKVGEPSESYEDFSA  365

Query  364  CLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQ  543
            CLPADECRYAVYDFD++TEE+  KSRI FIAWSPD ++VRSKMIYASSKDRFKREL GIQ
Sbjct  366  CLPADECRYAVYDFDYVTEENCQKSRIIFIAWSPDISRVRSKMIYASSKDRFKRELDGIQ  425

Query  544  VELQATDP  567
            VELQATDP
Sbjct  426  VELQATDP  433



>ref|XP_006436042.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 ref|XP_006486066.1| PREDICTED: actin-depolymerizing factor 2-like [Citrus sinensis]
 gb|ESR49282.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 gb|KDO67706.1| hypothetical protein CISIN_1g032498mg [Citrus sinensis]
Length=139

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV DDCKLKFLELK KR YRFIV+KIEEKQKQV+VEKLGEP+ SY++FTA L
Sbjct  1    MANAASGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSDSYENFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T+E+  KS+I FIAWSPDT+KVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSKIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006292022.1| hypothetical protein CARUB_v10018211mg [Capsella rubella]
 gb|EOA24920.1| hypothetical protein CARUB_v10018211mg [Capsella rubella]
Length=139

 Score =   225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR++RFIVYKIEEKQKQV+VEK+GEP Q+YD+F ACL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRSHRFIVYKIEEKQKQVVVEKVGEPVQTYDEFAACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYA+YDFDF+T E+  KS+IFFI W PD AKVRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PANECRYAIYDFDFVTAENCQKSKIFFITWCPDIAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|NP_190187.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
 sp|Q39250.1|ADF1_ARATH RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1; Short=AtADF1 
[Arabidopsis thaliana]
 pdb|1F7S|A Chain A, Crystal Structure Of Adf1 From Arabidopsis Thaliana
 gb|AAB03696.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
 gb|AAC72407.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
 emb|CAB88325.1| actin depolymerizing factor 1 (ADF1) [Arabidopsis thaliana]
 gb|AAK59658.1| putative actin depolymerizing factor ADF1 [Arabidopsis thaliana]
 gb|AAL33770.1| putative actin depolymerizing factor 1 [Arabidopsis thaliana]
 gb|AAM63066.1| actin-depolymerizing factor ADF-1 (AtADF1) [Arabidopsis thaliana]
 gb|ACG24243.1| hypothetical protein [Zea mays]
 gb|AEE78100.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
Length=139

 Score =   224 bits (572),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQV+VEK+G+P Q+Y++F ACL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQPIQTYEEFAACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002311154.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
 gb|EEE88521.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
Length=218

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +1

Query  163  IFLRSPRTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQ  342
            IF    R  MAN+ASGMAVHDDCKLKFLELK KR +RFIV+KIEEKQKQVIVEKLG+P  
Sbjct  71   IFFYQNREKMANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTD  130

Query  343  SYDDFTACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFK  522
            SY+DFTA LPA+ECRYAVYDFD++T+E+  KSRI F+AWSPDT++VRSKMIYASSKDRFK
Sbjct  131  SYEDFTASLPANECRYAVYDFDYVTDENCQKSRIVFVAWSPDTSRVRSKMIYASSKDRFK  190

Query  523  RELGGIQVELQATDP  567
            REL GIQ+ELQATDP
Sbjct  191  RELDGIQIELQATDP  205



>ref|XP_008776502.1| PREDICTED: actin-depolymerizing factor 7 [Phoenix dactylifera]
Length=139

 Score =   224 bits (572),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR YRFI++KIEEK KQVIVEKLGEP  SY+DFTA L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIEEKLKQVIVEKLGEPTLSYEDFTAAL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFDF+TEE+  KS+IFFIAWSPDT+KVRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006281292.1| hypothetical protein CARUB_v10027342mg [Capsella rubella]
 gb|EOA14190.1| hypothetical protein CARUB_v10027342mg [Capsella rubella]
Length=139

 Score =   224 bits (572),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQVIVEK+GEP Q+YDDF A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPIQTYDDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PAEECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_008343560.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   224 bits (572),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHD+CKLKFLELK +R YRFIVYKIEEKQ  VIVEKLGEP  SY+DF+A L
Sbjct  1    MANAASGMAVHDECKLKFLELKARRTYRFIVYKIEEKQNGVIVEKLGEPTDSYEDFSASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFD++TEE+  KSRI F+AWSPDTAKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PANECRYAVYDFDYVTEENCQKSRIVFVAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_007027089.1| Actin depolymerizing factor 4 isoform 1 [Theobroma cacao]
 gb|EOY07591.1| Actin depolymerizing factor 4 isoform 1 [Theobroma cacao]
Length=193

 Score =   226 bits (576),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 119/136 (88%), Gaps = 4/136 (3%)
 Frame = +1

Query  172  RSPRTTMAN----SASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPA  339
            R P ++  N     ASGMAVHD+CKLKFLELK KR YRFIV+KIEEKQKQVIVEKLGEPA
Sbjct  45   RDPLSSFPNKPKRDASGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPA  104

Query  340  QSYDDFTACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRF  519
            QSY+DF   LPADECRYAVYDFDFLT E+V KSRIFFIAWSPDT++VRSKMIYASSKDRF
Sbjct  105  QSYEDFAKSLPADECRYAVYDFDFLTPENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRF  164

Query  520  KRELGGIQVELQATDP  567
            KREL GIQVELQATDP
Sbjct  165  KRELDGIQVELQATDP  180



>ref|NP_001078247.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
 gb|AEE78101.1| actin depolymerizing factor 1 [Arabidopsis thaliana]
Length=150

 Score =   224 bits (572),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = +1

Query  154  ISPIFLRSPRTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGE  333
            +S IF    R+  AN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQV+VEK+G+
Sbjct  2    VSSIFHLLSRS--ANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQ  59

Query  334  PAQSYDDFTACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKD  513
            P Q+Y++F ACLPADECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKD
Sbjct  60   PIQTYEEFAACLPADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKD  119

Query  514  RFKRELGGIQVELQATDP  567
            RFKREL GIQVELQATDP
Sbjct  120  RFKRELDGIQVELQATDP  137



>ref|XP_009357677.1| PREDICTED: actin-depolymerizing factor 1 [Pyrus x bretschneideri]
Length=139

 Score =   224 bits (570),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHD+CKLKFLELK +R YRFIVYKIEEKQ  V+VEKLGEP  SY+DF+A L
Sbjct  1    MANAASGMAVHDECKLKFLELKARRTYRFIVYKIEEKQNGVVVEKLGEPTDSYEDFSASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFD++TEE+  KSRI F+AWSPDTAKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PANECRYAVYDFDYVTEENCQKSRIVFVAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|AAR23800.1| putative actin-depolymerizing factor 2 [Helianthus annuus]
Length=139

 Score =   223 bits (569),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHD+CKLKF++LK KR +RFI+YKIEEKQKQV+VEK+GEPAQ+YD+F ACL
Sbjct  1    MANAASGMAVHDECKLKFMDLKAKRTHRFIIYKIEEKQKQVMVEKVGEPAQTYDEFAACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAV+D+DFLT E V KSRIFFIAWSPDTA+VR+KMIYASSKDRFKREL GIQVE
Sbjct  61   PENECRYAVFDYDFLTPEGVQKSRIFFIAWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATD  564
            LQATD
Sbjct  121  LQATD  125



>gb|ABK94603.1| unknown [Populus trichocarpa]
Length=139

 Score =   223 bits (569),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR +RFIV+KIEEKQKQVIVEKLG+P  SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTDSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFD++T+E+  KSRI F+AWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PANECRYAVYDFDYVTDENCQKSRIVFVAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KGN58886.1| hypothetical protein Csa_3G734880 [Cucumis sativus]
Length=139

 Score =   223 bits (569),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASG+AVHDDCKLKFLELK KR YRFIV+KIEEKQKQV+VEK+GEP QSY+DF   L
Sbjct  1    MANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P+DECRYA+YDFDF+TEE+  KSRIFFIAWSPD+++VRSKMIYASSKDRFKREL G QVE
Sbjct  61   PSDECRYAIYDFDFVTEENCQKSRIFFIAWSPDSSRVRSKMIYASSKDRFKRELDGFQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009586917.1| PREDICTED: actin-depolymerizing factor 1 [Nicotiana tomentosiformis]
 ref|XP_009774799.1| PREDICTED: actin-depolymerizing factor 1 [Nicotiana sylvestris]
Length=139

 Score =   223 bits (568),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIV+KIEEKQKQV+VEK+GEP +SY+DF A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPTESYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006476590.1| PREDICTED: actin-depolymerizing factor 1-like [Citrus sinensis]
Length=139

 Score =   222 bits (566),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANS+SGMAVHDDCKLKFLELK KR+YRFIV+KIEEK +QV VEKLGEP +SY+DFTA L
Sbjct  1    MANSSSGMAVHDDCKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF T+E+  KS+IFF+AWSPDT+++RSKM+YASSKDRF+REL G+QVE
Sbjct  61   PADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYASSKDRFRRELDGVQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009126640.1| PREDICTED: actin-depolymerizing factor 4 isoform X1 [Brassica 
rapa]
 ref|XP_009126641.1| PREDICTED: actin-depolymerizing factor 4 isoform X2 [Brassica 
rapa]
Length=139

 Score =   222 bits (566),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQV+VEK+GEP Q+Y+DF A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGEPIQTYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PAEECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010920670.1| PREDICTED: actin-depolymerizing factor 7 [Elaeis guineensis]
Length=139

 Score =   222 bits (566),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR YRFI++KIEEK KQ+IVEK+GEP  SY+DFTA L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIEEKLKQIIVEKVGEPTLSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+TEE+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010514926.1| PREDICTED: actin-depolymerizing factor 1 [Camelina sativa]
Length=139

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+F+ELK KR +RFIVYKIEEKQKQV+VEK+GEP Q+YDDF A L
Sbjct  1    MANAASGMAVHDDCKLRFMELKAKRTHRFIVYKIEEKQKQVVVEKVGEPIQTYDDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQA DP
Sbjct  121  LQAADP  126



>ref|XP_003637508.1| Actin-depolymerizing factor [Medicago truncatula]
 gb|AFK41269.1| unknown [Medicago truncatula]
 gb|KEH42380.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
Length=139

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+D+CKLKFLELK KR YR+I+YKIEEKQKQV+V+K+G+PA  YDDFTA L
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYIIYKIEEKQKQVVVDKVGDPANGYDDFTANL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAW PD ++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWCPDISRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009406976.1| PREDICTED: actin-depolymerizing factor 7 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=146

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  LRSPRTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSY  348
            +R+ R   AN+ASGMAV+DDCKLKFLELK KR YRF+++KI+EKQK+V+VEK+GEP+ SY
Sbjct  1    MRANRLAQANAASGMAVNDDCKLKFLELKAKRTYRFVIFKIDEKQKEVVVEKVGEPSSSY  60

Query  349  DDFTACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRE  528
            +DF A LP DECRYA+YDFDF+TEE++ KS+IFFIAWSPD+++VRSKM+YASSKDRFKRE
Sbjct  61   EDFAASLPTDECRYAIYDFDFVTEENLQKSKIFFIAWSPDSSRVRSKMLYASSKDRFKRE  120

Query  529  LGGIQVELQATDP  567
            L GIQVELQATDP
Sbjct  121  LDGIQVELQATDP  133



>sp|Q9FVI2.1|ADF1_PETHY RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1 [Petunia 
x hybrida]
 gb|AAG16973.1|AF183903_1 actin-depolymerizing factor 1 [Petunia x hybrida]
 gb|AAK72617.1| actin-depolymerizing factor 1 [Petunia x hybrida]
Length=139

 Score =   222 bits (565),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQV+VEK+GEP +SY+DF A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKIGEPTESYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAVYDFDF+T E+  KSRIFFIAW PDTA+VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PENECRYAVYDFDFVTAENCQKSRIFFIAWCPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQA DP
Sbjct  121  LQACDP  126



>ref|NP_851228.1| actin depolymerizing factor 4 [Arabidopsis thaliana]
 sp|Q9ZSK3.2|ADF4_ARATH RecName: Full=Actin-depolymerizing factor 4; Short=ADF-4; Short=AtADF4 
[Arabidopsis thaliana]
 dbj|BAB08357.1| actin depolymerizing factor 4 [Arabidopsis thaliana]
 gb|AAM61326.1| actin depolymerizing factor 4-like protein [Arabidopsis thaliana]
 dbj|BAH19834.1| AT5G59890 [Arabidopsis thaliana]
 gb|AED97247.1| actin depolymerizing factor 4 [Arabidopsis thaliana]
Length=139

 Score =   222 bits (565),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQVIVEK+GEP  +Y+DF A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006418975.1| hypothetical protein EUTSA_v10002704mg [Eutrema salsugineum]
 gb|ESQ37411.1| hypothetical protein EUTSA_v10002704mg [Eutrema salsugineum]
Length=139

 Score =   221 bits (564),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQVIVEK+GEP Q++++F A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPVQTFEEFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>emb|CBI16177.3| unnamed protein product [Vitis vinifera]
Length=132

 Score =   221 bits (563),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAVHDDCKLKFLELK KR YRFIVYKIEEKQKQV+VEK+GEP QSY+DFTA LPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVVVEKVGEPTQSYEDFTASLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            AVYDFDF+TEE+  KS+IFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVELQATDP
Sbjct  61   AVYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDP  119



>ref|XP_008369858.1| PREDICTED: actin-depolymerizing factor 2-like [Malus domestica]
 ref|XP_009374666.1| PREDICTED: actin-depolymerizing factor 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=139

 Score =   221 bits (564),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YR IV+KIEEKQKQV+VE +GEPA++Y+ FT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKQKQVVVEHVGEPAETYEQFTEKL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA++DFDFLT E V KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIFDFDFLTPEGVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_007009413.1| Actin depolymerizing factor 4 isoform 1 [Theobroma cacao]
 gb|EOY18223.1| Actin depolymerizing factor 4 isoform 1 [Theobroma cacao]
Length=475

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +1

Query  112  KYLFFALKLYISAQISPIFLRSPRTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKI  291
            + LFF+ +      +  +F    R TMAN+ASGMAV DDCKLKFLELK KR YRFIV+KI
Sbjct  311  RSLFFSEEALDFLGLFSLFSSLSRETMANAASGMAVDDDCKLKFLELKAKRTYRFIVFKI  370

Query  292  EEKQKQVIVEKLGEPAQSYDDFTACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDT  471
            EEKQKQV+VEKLGEP  SY+ FTA LPADECRYAVYDFDF+TEE+  KSRI FIAWSPDT
Sbjct  371  EEKQKQVVVEKLGEPTDSYEAFTASLPADECRYAVYDFDFVTEENCQKSRIIFIAWSPDT  430

Query  472  AKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            +KVRSKMIYASSKDRFKREL GIQVELQATDP
Sbjct  431  SKVRSKMIYASSKDRFKRELDGIQVELQATDP  462



>ref|XP_008442569.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis melo]
Length=139

 Score =   221 bits (564),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV DDCKLKFLELK KR YRFIV+KIEEKQKQV+VEK+GEP QSY+DF   L
Sbjct  1    MANAASGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P+DECRYA+YDFDF+TEE+  KSRIFFIAWSPD+++VRSKMIYASSKDRFKREL G QVE
Sbjct  61   PSDECRYAIYDFDFVTEENCQKSRIFFIAWSPDSSRVRSKMIYASSKDRFKRELDGFQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006418976.1| hypothetical protein EUTSA_v10002704mg [Eutrema salsugineum]
 gb|ESQ37412.1| hypothetical protein EUTSA_v10002704mg [Eutrema salsugineum]
Length=146

 Score =   221 bits (564),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  LRSPRTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSY  348
            + +P    AN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQVIVEK+GEP Q++
Sbjct  1    MHNPIIIEANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPVQTF  60

Query  349  DDFTACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRE  528
            ++F A LPADECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKRE
Sbjct  61   EEFAASLPADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRE  120

Query  529  LGGIQVELQATDP  567
            L GIQVELQATDP
Sbjct  121  LDGIQVELQATDP  133



>ref|XP_004302775.1| PREDICTED: actin-depolymerizing factor 3-like [Fragaria vesca 
subsp. vesca]
Length=139

 Score =   221 bits (563),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELKTKR YR IV+KIEEKQKQVIVE  G+PAQ+Y+ FT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKTKRTYRSIVFKIEEKQKQVIVEATGDPAQTYEAFTDSL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYAV+DFDFLT E VPKSRIFFIAWSPDT++VR+KMIYASSKDRFKREL GIQ+E
Sbjct  61   PTDECRYAVFDFDFLTPEGVPKSRIFFIAWSPDTSRVRNKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATD  564
            LQATD
Sbjct  121  LQATD  125



>ref|XP_009337572.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
Length=139

 Score =   221 bits (563),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ SGMAVHD+CKLKFLELK KR YRFIVYKIEEKQ +VIVEKLGEP  SY+DF+A L
Sbjct  1    MANARSGMAVHDECKLKFLELKAKRTYRFIVYKIEEKQNEVIVEKLGEPTDSYEDFSASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFD++TEE+  KSRI F+AWSPDTAKVRSKMIYASSKD FKREL GIQ+E
Sbjct  61   PANECRYAVYDFDYVTEENCQKSRIIFVAWSPDTAKVRSKMIYASSKDTFKRELDGIQME  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010543331.1| PREDICTED: actin-depolymerizing factor 1-like [Tarenaya hassleriana]
Length=139

 Score =   221 bits (563),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ SGMAVHD+CKLKFLELK KR +RFIV+KIEEKQKQV+VEK+GEP   Y+DF A L
Sbjct  1    MANAVSGMAVHDECKLKFLELKAKRRHRFIVFKIEEKQKQVMVEKVGEPPLGYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+TEE+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_008788089.1| PREDICTED: actin-depolymerizing factor 7-like [Phoenix dactylifera]
Length=139

 Score =   221 bits (563),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR +RFI++KI+EK KQVIVEK+GEP  SY+DFTA L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTHRFIIFKIDEKLKQVIVEKVGEPTMSYEDFTAAL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+TEE+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004172071.1| PREDICTED: actin-depolymerizing factor 1-like, partial [Cucumis 
sativus]
Length=138

 Score =   221 bits (562),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  ANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLP  372
            AN+ASG+AVHDDCKLKFLELK KR YRFIV+KIEEKQKQV+VEK+GEP QSY+DF   LP
Sbjct  1    ANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSLP  60

Query  373  ADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVEL  552
            +DECRYA+YDFDF+TEE+  KSRIFFIAWSPD+++VRSKMIYASSKDRFKREL G QVEL
Sbjct  61   SDECRYAIYDFDFVTEENCQKSRIFFIAWSPDSSRVRSKMIYASSKDRFKRELDGFQVEL  120

Query  553  QATDP  567
            QATDP
Sbjct  121  QATDP  125



>gb|EPS63340.1| hypothetical protein M569_11446, partial [Genlisea aurea]
Length=138

 Score =   221 bits (562),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  ANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLP  372
            AN+ASGMAVHD+CKL+FLELK KR YRFI++KIE+KQKQV+VEK+G+PAQ Y+DFTA LP
Sbjct  1    ANAASGMAVHDECKLRFLELKAKRTYRFIIFKIEDKQKQVVVEKVGDPAQGYEDFTASLP  60

Query  373  ADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVEL  552
            A+ECRYAVYDFDF+T E+  KSRIFFIAWSPDT+++R+KMIYASSKDRFKREL GIQVEL
Sbjct  61   ANECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRIRNKMIYASSKDRFKRELDGIQVEL  120

Query  553  QATDP  567
            QATDP
Sbjct  121  QATDP  125



>ref|XP_008387742.1| PREDICTED: actin-depolymerizing factor 2-like [Malus domestica]
Length=158

 Score =   221 bits (564),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YR IV+KIEEKQKQV+VE +GEPA++Y+ FT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKQKQVVVEHVGEPAETYEQFTEKL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA++DFDFLT E V KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIFDFDFLTPEGVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004142080.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 ref|XP_004169676.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 gb|KGN54230.1| hypothetical protein Csa_4G294380 [Cucumis sativus]
Length=139

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+D+CKLKFLELK+KR +RFIV+KIEEK KQV+VEKLG P+QSY+DF A L
Sbjct  1    MANAASGMAVNDECKLKFLELKSKRTHRFIVFKIEEKLKQVVVEKLGGPSQSYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFDF+TEE+  KSRIFFIAWSPD +KVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSRIFFIAWSPDDSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004294586.1| PREDICTED: actin-depolymerizing factor 2 [Fragaria vesca subsp. 
vesca]
Length=139

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASG AV DDCKLKFL+LK KR YRFIV+KIEEK KQV+VEKLGEPAQSY++FTA L
Sbjct  1    MANAASGFAVDDDCKLKFLDLKAKRTYRFIVFKIEEKLKQVVVEKLGEPAQSYEEFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KSRIFFIAWSPDT++VR+KMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRNKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010249803.1| PREDICTED: actin-depolymerizing factor [Nelumbo nucifera]
Length=139

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAV+DDCKLKFLELK KR YRFIV+KI+EK +QV+VE+LG P +SY+DFTACL
Sbjct  1    MANSASGMAVNDDCKLKFLELKAKRNYRFIVFKIDEKIQQVMVERLGNPEESYEDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAV+DFDF T+E+  KS+IFFIAWSPDT+KVRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>emb|CDX88731.1| BnaA03g09180D [Brassica napus]
Length=199

 Score =   223 bits (567),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQV+VEK+GEP  SY+DF A L
Sbjct  61   MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGEPILSYEDFAASL  120

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQVE
Sbjct  121  PAEECRYAIYDFDFVTTENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  180

Query  550  LQATDP  567
            LQATDP
Sbjct  181  LQATDP  186



>ref|XP_008233662.1| PREDICTED: uncharacterized protein LOC103332693 [Prunus mume]
Length=531

 Score =   233 bits (593),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 136/172 (79%), Gaps = 6/172 (3%)
 Frame = +1

Query  70   FSGLKRAPLYIRAQKYLFFALKLYISAQISPIFLRS---PR---TTMANSASGMAVHDDC  231
            F G  R PL      +L  +L L +S   SP F R    PR     MAN+ASGMAVHD+C
Sbjct  303  FQGATRCPLPTVRPVHLSLSLSLSLSLSRSPRFSRHFSLPRHFLGKMANAASGMAVHDEC  362

Query  232  KLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRYAVYDFDF  411
            KLKFLELK KR YRFIVYKIEEKQKQVIVEK+GEPA SY+DF+A LPADECRYAVYDFD+
Sbjct  363  KLKFLELKAKRTYRFIVYKIEEKQKQVIVEKVGEPADSYEDFSASLPADECRYAVYDFDY  422

Query  412  LTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            +TEE+  KSRI FIAWSPDT+KVRSKMIYASSKDRFKREL GIQVELQATDP
Sbjct  423  VTEENCQKSRIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVELQATDP  474



>ref|XP_002528457.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF33940.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   220 bits (561),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR++RFIV+KIE  QKQV+VEKLG+P  SY+DF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRSHRFIVFKIEMVQKQVVVEKLGQPTDSYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFD++T+E+  KSRI FIAWSPDTAKVR+KMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDYVTDENCQKSRIVFIAWSPDTAKVRNKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010426028.1| PREDICTED: actin-depolymerizing factor 1-like [Camelina sativa]
Length=139

 Score =   220 bits (561),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVH+DCKL+F+ELK KR +RFIVYKIEEKQKQV+VEK+GEP Q+YDDF A L
Sbjct  1    MANAASGMAVHEDCKLRFMELKAKRTHRFIVYKIEEKQKQVVVEKVGEPIQTYDDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQA DP
Sbjct  121  LQAADP  126



>gb|KDO76170.1| hypothetical protein CISIN_1g046281mg, partial [Citrus sinensis]
Length=133

 Score =   220 bits (560),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANS+SGMAVHD+CKLKFLELK KR+YRFIV+KIEEK +QV VEKLGEP +SY+DFTA L
Sbjct  1    MANSSSGMAVHDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF T+E+  KS+IFF+AWSPDT+++RSKM+YASSKDRF+REL G+QVE
Sbjct  61   PADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYASSKDRFRRELDGVQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009131961.1| PREDICTED: actin-depolymerizing factor 4-like [Brassica rapa]
Length=139

 Score =   220 bits (561),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQV+VEK+GEP  SY+DF A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGEPILSYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PAEECRYAIYDFDFVTTENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|ACJ84058.1| unknown [Medicago truncatula]
Length=139

 Score =   220 bits (561),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+D+CKLKFLELK KR YR+I+YKIEEKQKQV+V+K+G+PA  YDDFTA L
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYIIYKIEEKQKQVVVDKVGDPANGYDDFTANL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+ EE+  KSRIFFIAW PD ++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVAEENCQKSRIFFIAWCPDISRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009421345.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   220 bits (560),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR YRFIV+KI+EK KQVIVE LGEP  +YDDFTA L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVIVETLGEPNLTYDDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYA+YDFDF+TEE+  KS+IFFIAWSPDTA+VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PTNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTARVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009404611.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   220 bits (560),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR YRFI++KI+EKQKQVIVEKLGEP  +YDDFTA L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKQKQVIVEKLGEPNLTYDDFTATL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYA+YDFDF+ EE+  KS+I FIAWSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PTNECRYAIYDFDFVNEENCQKSKIIFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KCW50261.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=132

 Score =   219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAVHDDCKLKFLELK KR YRFIVYKIEEKQKQVIVEKLGEP  SY+DFTA LPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPTNSYEDFTASLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            AVYDFD++TEE+  KSRI FIAWSPDT+KVR+KMIYASSKDRFKREL GIQVELQATDP
Sbjct  61   AVYDFDYVTEENCQKSRIIFIAWSPDTSKVRNKMIYASSKDRFKRELDGIQVELQATDP  119



>ref|XP_010455715.1| PREDICTED: actin-depolymerizing factor 4 [Camelina sativa]
 ref|XP_010443776.1| PREDICTED: actin-depolymerizing factor 4 [Camelina sativa]
 ref|XP_010483637.1| PREDICTED: actin-depolymerizing factor 4 [Camelina sativa]
Length=139

 Score =   220 bits (560),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQVIVEK+GEP  +Y+DF A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PAEECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009406977.1| PREDICTED: actin-depolymerizing factor 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR YRF+++KI+EKQK+V+VEK+GEP+ SY+DF A L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFVIFKIDEKQKEVVVEKVGEPSSSYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYA+YDFDF+TEE++ KS+IFFIAWSPD+++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PTDECRYAIYDFDFVTEENLQKSKIFFIAWSPDSSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010937681.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=139

 Score =   219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR YRFI++KI+EK KQVIVEK+GEP  SY+DFTA L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKLKQVIVEKVGEPTLSYEDFTANL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+TEE+  KS+IFFIAWSPD+++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDSSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>emb|CDY09242.1| BnaA02g06680D [Brassica napus]
Length=153

 Score =   219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  ANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLP  372
            AN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQVIVEK+GEP Q+Y+DF A LP
Sbjct  16   ANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPIQTYEDFAASLP  75

Query  373  ADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVEL  552
            A+ECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQVEL
Sbjct  76   AEECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVEL  135

Query  553  QATDP  567
            QATDP
Sbjct  136  QATDP  140



>emb|CAJ38388.1| actin-depolymerizing factor [Plantago major]
Length=139

 Score =   219 bits (558),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ SGMAVHDDCKL+FLELK KR +RF+V+KIEEKQKQV+VEK+GEPA++Y+DF A L
Sbjct  1    MANAVSGMAVHDDCKLRFLELKAKRTHRFVVFKIEEKQKQVVVEKVGEPAETYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRY VYDFDF+T E+  KSRIFFIAWSPDTA++RSKMIYASSK+RFKREL GIQVE
Sbjct  61   PENECRYGVYDFDFVTAENCQKSRIFFIAWSPDTARIRSKMIYASSKERFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KDP44204.1| hypothetical protein JCGZ_05671 [Jatropha curcas]
Length=132

 Score =   219 bits (557),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAVHDDCKL+FLELK KR YRFIV+KIEEKQKQV+VEKLGEP QSY+DFTA LPADECRY
Sbjct  1    MAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            AVYDFDF+T E+  KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVELQATDP
Sbjct  61   AVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDP  119



>ref|XP_009416252.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416253.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   219 bits (558),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR YRFIV+KI+EKQK+V+V+K+GEP+ +YDDF A L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKQKEVVVDKVGEPSSNYDDFAAAL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYA+YDFDF+TEE+  KS+IFFIAWSPD+++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PTDECRYAIYDFDFVTEENCQKSKIFFIAWSPDSSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KJB76068.1| hypothetical protein B456_012G069600 [Gossypium raimondii]
Length=139

 Score =   219 bits (558),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGM VHDDC+LKFLELK KR Y FIV+KIEEK KQVIVEKLGEP   Y+ FT+ L
Sbjct  1    MANAASGMVVHDDCELKFLELKAKRTYHFIVFKIEEKHKQVIVEKLGEPTDRYEAFTSSL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T+E+  KSRI FIAWSPDT+KVRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIIFIAWSPDTSKVRSKMVYASSKDRFKRELNGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010503215.1| PREDICTED: actin-depolymerizing factor 1-like [Camelina sativa]
Length=139

 Score =   219 bits (558),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+F+ELK KR +RFIVYKIEEK KQV+VEK+GEP Q+YDDF A L
Sbjct  1    MANAASGMAVHDDCKLRFMELKAKRTHRFIVYKIEEKLKQVVVEKVGEPIQTYDDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQA DP
Sbjct  121  LQAADP  126



>ref|XP_010111772.1| Actin-depolymerizing factor 1 [Morus notabilis]
 gb|EXC31686.1| Actin-depolymerizing factor 1 [Morus notabilis]
Length=132

 Score =   219 bits (557),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAVHD+CKLKFLELK KR +RFIVYKIEEKQKQV+VEK+GEPA+SYDDFT  LPADECRY
Sbjct  1    MAVHDECKLKFLELKAKRTHRFIVYKIEEKQKQVVVEKVGEPAKSYDDFTGSLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            A+YDFDF+TEE+  KS+IFFIAWSPDTA+VRSKMIYASSKDRFKREL GIQVELQATDP
Sbjct  61   AIYDFDFVTEENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDP  119



>ref|XP_009374667.1| PREDICTED: actin-depolymerizing factor 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=139

 Score =   219 bits (557),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YR IV+KIEEKQKQV+VE +GEPA++Y+ FT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKQKQVVVEHVGEPAETYEQFTEKL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA ECRYA++DFDFLT E V KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PAGECRYAIFDFDFLTPEGVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_008447631.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis melo]
Length=139

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+D+CKLKFLELK+KR +RFIV+KIEEK KQV+VEKLG P+QSY+DF A L
Sbjct  1    MANAASGMAVNDECKLKFLELKSKRTHRFIVFKIEEKLKQVVVEKLGGPSQSYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFDF+TEE+  KSRIFFIAW PD +KVRSKMIYASSKDRFKREL GIQVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSRIFFIAWCPDDSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_007206122.1| hypothetical protein PRUPE_ppa013109mg [Prunus persica]
 gb|EMJ07321.1| hypothetical protein PRUPE_ppa013109mg [Prunus persica]
Length=139

 Score =   218 bits (556),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR YR IV+KIEEKQKQV+VE +GEP ++Y+ F   L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKQKQVVVESVGEPTETYEQFAGKL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDFLT E V KSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVFDFDFLTPEGVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006439576.1| hypothetical protein CICLE_v10023304mg [Citrus clementina]
 gb|ESR52816.1| hypothetical protein CICLE_v10023304mg [Citrus clementina]
Length=140

 Score =   218 bits (556),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  ANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLP  372
            ANS+SGMAVHD+CKLKFLELK KR+YRFIV+KIEEK +QV VEKLGEP +SY+DFTA LP
Sbjct  3    ANSSSGMAVHDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASLP  62

Query  373  ADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVEL  552
            ADECRYAVYDFDF T+E+  KS+IFF+AWSPDT+++RSKM+YASSKDRF+REL G+QVEL
Sbjct  63   ADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYASSKDRFRRELDGVQVEL  122

Query  553  QATDP  567
            QATDP
Sbjct  123  QATDP  127



>ref|XP_007218574.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
 gb|EMJ19773.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
Length=139

 Score =   218 bits (556),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAVHDDCKLKFLELK KR +RFIV+KIEEK +QVIVEK+G P +SYDDF A +
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKVGGPDESYDDFAASM  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF T E+  KS+IFFIAW+PDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_008393892.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
 ref|XP_008353979.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   218 bits (555),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR +RFIV+KIEEK +QVIVEKLG P +SYDDF+A +
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRNFRFIVFKIEEKIQQVIVEKLGGPDESYDDFSASM  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF T E+  KS+IFFIAW+PDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELEGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|AAD09110.1| actin depolymerizing factor 4 [Arabidopsis thaliana]
Length=139

 Score =   218 bits (555),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIEEKQKQVIVEK+GEP  +Y+DF A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL G QVE
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGRQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KDP25456.1| hypothetical protein JCGZ_20612 [Jatropha curcas]
Length=139

 Score =   218 bits (555),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAVHDDCKLKF ELK KR+YRFIV+KIEE  +QV VEKLG+P QSY+DFTA L
Sbjct  1    MANSASGMAVHDDCKLKFQELKAKRSYRFIVFKIEEGIQQVTVEKLGKPQQSYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAV+DFDF T E+V KS+IFFIAWSPDT++VRSKM+YASSKDRF+REL G+QVE
Sbjct  61   PANECRYAVFDFDFTTNENVQKSKIFFIAWSPDTSRVRSKMLYASSKDRFRRELDGVQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_011029243.1| PREDICTED: actin-depolymerizing factor isoform X2 [Populus euphratica]
Length=139

 Score =   218 bits (555),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAV D+CKL+F+ELK KR++RFIV+KIEEK +QV+VE LGEP QSYDDFTA L
Sbjct  1    MANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFDF T+E+V KS+IFF+AWSPDT+K+RSKM+YASS+DRF+REL G+QVE
Sbjct  61   PANECRYAVYDFDFTTDENVQKSKIFFVAWSPDTSKIRSKMLYASSRDRFRRELDGVQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009419950.1| PREDICTED: actin-depolymerizing factor 4 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   218 bits (555),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            M+N+ASGMAV+DDCKLKFLELK KR YRFI++KI+EKQKQVIV+KLGEP  +Y+DF A L
Sbjct  1    MSNAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKQKQVIVDKLGEPTLAYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+TEE+  KS+IFFIAWSPD A+VR+KM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDIARVRNKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009150048.1| PREDICTED: actin-depolymerizing factor 2 [Brassica rapa]
Length=137

 Score =   218 bits (554),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 113/126 (90%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR +R IVYKIE+KQ  VIVEKLGEP QSYDDF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYA+YDFDF+TEE+  KS+IFFIAWSPDTAKVR KMIYASSKDRFKREL GIQVE
Sbjct  59   PENECRYAIYDFDFVTEENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>gb|AEJ88268.1| putative actin-depolymerizing factor [Wolffia arrhiza]
Length=139

 Score =   218 bits (554),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR +RFIV+KI+EKQKQVIVEK+GEPA +Y+DF A L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTHRFIVFKIDEKQKQVIVEKIGEPALTYEDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYA+YDFDF+T E+  KS+IFFIAWSPDTA+VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PDNECRYAIYDFDFVTSENCQKSKIFFIAWSPDTARVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|AEZ00870.1| putative actin depolymerizing factor protein, partial [Elaeis 
guineensis]
Length=179

 Score =   219 bits (558),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR +R+I++KI+EK KQVIVEK+GEP  SY+DFTA L
Sbjct  41   MANAASGMAVNDDCKLKFLELKAKRTHRYIIFKIDEKLKQVIVEKVGEPTLSYEDFTAAL  100

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+TEE+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  101  PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  160

Query  550  LQATDP  567
            LQATDP
Sbjct  161  LQATDP  166



>gb|AEJ90198.1| actin depolymerizing factor 1 [Rosa hybrid cultivar]
Length=140

 Score =   218 bits (554),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 116/127 (91%), Gaps = 1/127 (1%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHD+CKLKFLELKTKR YR IVYKIEEKQKQVIVE  G+P Q+Y++FT  L
Sbjct  1    MANAASGMAVHDECKLKFLELKTKRTYRSIVYKIEEKQKQVIVEATGDPTQTYENFTDSL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGI-QV  546
            P+DECRYAV+DFDFLT E VPKSRIFFIAWSPDT++VR+KMIYASSKDRFKREL GI ++
Sbjct  61   PSDECRYAVFDFDFLTPEGVPKSRIFFIAWSPDTSRVRNKMIYASSKDRFKRELDGISRI  120

Query  547  ELQATDP  567
            ELQATDP
Sbjct  121  ELQATDP  127



>ref|XP_008371032.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   218 bits (554),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ SGMAVHD+CK+KFLELK KR YRFIVYKIEEKQ +VIVEKLG+P  SY+DF+A L
Sbjct  1    MANARSGMAVHDECKIKFLELKAKRTYRFIVYKIEEKQNEVIVEKLGQPTDSYEDFSASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFD++TEE+  KSRI F+AWSPDTAKVRSKMIYASSKD FKREL GIQ+E
Sbjct  61   PANECRYAVYDFDYVTEENCRKSRIXFVAWSPDTAKVRSKMIYASSKDTFKRELDGIQME  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002468086.1| hypothetical protein SORBIDRAFT_01g039300 [Sorghum bicolor]
 gb|EER95084.1| hypothetical protein SORBIDRAFT_01g039300 [Sorghum bicolor]
Length=139

 Score =   218 bits (554),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV DDCK KFLELK KR YRF+V+KIEEKQKQV+V+KLGEP  +YDDF A L
Sbjct  1    MANAASGMAVDDDCKRKFLELKAKRTYRFVVFKIEEKQKQVVVDKLGEPNLTYDDFAATL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRY VYDFDF+TEE   KS+IFFIAWSPDTAK+RSKM+YASSK+RFKREL GIQVE
Sbjct  61   PADECRYCVYDFDFVTEEGCQKSKIFFIAWSPDTAKIRSKMLYASSKERFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002303579.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011022717.1| PREDICTED: actin-depolymerizing factor 1-like [Populus euphratica]
 gb|EEE78558.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAV+D CKL+FLELK KR++RFIV+KIEEK +QV+VE LGEP QSYDDFTA L
Sbjct  1    MANSASGMAVNDGCKLRFLELKAKRSHRFIVFKIEEKTQQVVVETLGEPQQSYDDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYAVYDFDF T+E+V KS+IFF+AWSPD +K+RSKM+YASSKDRF+REL G+QVE
Sbjct  61   PIDECRYAVYDFDFTTDENVQKSKIFFVAWSPDASKIRSKMLYASSKDRFRRELDGVQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_008244913.1| PREDICTED: actin-depolymerizing factor 10 [Prunus mume]
Length=139

 Score =   217 bits (553),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAVHDDCKLKFLELK KR +RFIV+KIEEK +QVIVEK+G P +SYDDF + +
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKVGGPDESYDDFASSM  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF T E+  KS+IFFIAW+PDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>emb|CDP09013.1| unnamed protein product [Coffea canephora]
Length=132

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAVHDDCKLKFLELK KR YRFIV+KIEEKQKQVIVEK+GEP QSY+DF A LPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPGQSYEDFAASLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            AV+DFDF+T E+  KSRIFFIAWSPDT+KVRSKMIYASSKDRFKREL GIQVELQATDP
Sbjct  61   AVFDFDFVTAENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVELQATDP  119



>ref|XP_009420088.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR YRFIV+KI+EK KQVIVEK+GEP   YDDF A L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVIVEKVGEPTLGYDDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYA+YDFDF+TEE+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PNNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002509779.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF51166.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANS+SGMAV+D+CKLKFLELK KR+YRFIV+KIEEK +QV VEKLG+P +SY+DFTA L
Sbjct  1    MANSSSGMAVNDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGQPQESYEDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYD DF T E+V KS+IFF+AWSPDT+KVRSKM+YASSKDRF+REL G+QVE
Sbjct  61   PANECRYAVYDLDFTTNENVQKSKIFFVAWSPDTSKVRSKMLYASSKDRFRRELDGVQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KFK33962.1| hypothetical protein AALP_AA5G084200 [Arabis alpina]
Length=137

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFL+LK KR +RFIVYKIE+KQ  VIV+KLGEP +SY+DF A L
Sbjct  1    MANAASGMAVHDDCKLKFLDLKAKRTFRFIVYKIEDKQ--VIVDKLGEPDKSYEDFAASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+TEE+  KS+IFFIAWSPDTAKVR KMIYASSKDRFKREL GIQVE
Sbjct  59   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTAKVRMKMIYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>ref|XP_006367965.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum tuberosum]
Length=136

 Score =   217 bits (552),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAVHDDCKLKFLELK KR YRFI+YKIEEKQKQV+VEKLGEP +S++DF A LPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVVVEKLGEPTESHEDFAAGLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            AVYDFDF+TEE+  KSRIFFIAWSPDTA+VRSKMIYASSKDRFKREL G QVELQATDP
Sbjct  61   AVYDFDFMTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGFQVELQATDP  119



>ref|XP_009353719.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
 ref|XP_009338379.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338380.1| PREDICTED: actin-depolymerizing factor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=139

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASG AV DDCKLKFLELK KR YRFIV+KI+EK+ +VIVEKLGEPA+SY+DFTA L
Sbjct  1    MANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAVYDFDF+T E+  KSRIFFI WSPDTA+VR+KMIYASSKDRFKREL GIQVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIGWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_008357628.1| PREDICTED: actin-depolymerizing factor 1-like [Malus domestica]
Length=139

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASG AV+DDCKLKFLELK KR YRFIV+KI+EK+ +VIVEKLGEPA+SY+DFTA L
Sbjct  1    MANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAVYDFDF+T E+  KSRIFF+ WSPDTA+VR+KMIYASSKDRFKREL GIQVE
Sbjct  61   PDNECRYAVYDFDFVTVENCQKSRIFFVGWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KEH20707.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
Length=132

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAVHDDCKL+F+ELK KR +RFI+YKIEEKQKQVIVEKLGEP Q Y++F ACLPADECRY
Sbjct  1    MAVHDDCKLRFMELKAKRTHRFIIYKIEEKQKQVIVEKLGEPVQGYEEFAACLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            AV+D++F+TE +VPKSRIFFIAWSPDT++VRSKMIYASSKDRFKREL GIQ+ELQATDP
Sbjct  61   AVFDYEFMTEGNVPKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIELQATDP  119



>ref|XP_008794195.1| PREDICTED: actin-depolymerizing factor-like [Phoenix dactylifera]
Length=139

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAV+D+CKLKFLELKTKR +RFI++KI+EK +QV VEKLG+P +SYDDFTA L
Sbjct  1    MANSASGMAVNDECKLKFLELKTKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+T+E+  KS+IFFI+WSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009591841.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana tomentosiformis]
Length=127

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 7/126 (6%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR +RFI+YKIEEKQKQV+VEKLGEP +SY+DFTA L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIIYKIEEKQKQVVVEKLGEPTESYEDFTAGL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF TEE+V KS+IFFIAWSPDTA+VRSKMIYASSKDRFKR       E
Sbjct  61   PADECRYAVYDFDFTTEENVQKSKIFFIAWSPDTARVRSKMIYASSKDRFKR-------E  113

Query  550  LQATDP  567
            LQATDP
Sbjct  114  LQATDP  119



>ref|XP_009388628.1| PREDICTED: actin-depolymerizing factor 7 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR YRFIV+KI+EK KQV+VEK+GEP   YDDF+A L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVVVEKVGEPTLGYDDFSASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAV+DFDF+TEE+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PTNECRYAVFDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|NP_001047657.1| Os02g0663800 [Oryza sativa Japonica Group]
 sp|Q6EUH7.1|ADF1_ORYSJ RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1; Short=OsADF1 
[Oryza sativa Japonica Group]
 dbj|BAD27692.1| putative actin-depolymerizing factor [Oryza sativa Japonica Group]
 dbj|BAF09571.1| Os02g0663800 [Oryza sativa Japonica Group]
 dbj|BAG91513.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            M+NSASGMAV D+CKLKFLELK KR++RFIV+KI EK +QV+V++LG+P +SYDDFTACL
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+T+E+  KS+IFFI+W+PDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006846080.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
 gb|ERN07755.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
Length=139

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+D+CKLKFLELK KR YR++V+KIEEK KQVIVEKLGEP   Y+ FTA L
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYVVFKIEEKLKQVIVEKLGEPTDGYEAFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFDF+TEE+  KS+IFFIAWSPD AKVRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSKIFFIAWSPDIAKVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002877448.1| hypothetical protein ARALYDRAFT_484979 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53707.1| hypothetical protein ARALYDRAFT_484979 [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELK KR +R IVYKIE+KQ  VIVEKLGEP QSYDDF A L
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRY +YDFDF+T E+  KS+IFFIAWSPDTAKVR KMIYASSKDRFKREL GIQVE
Sbjct  59   PADECRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>emb|CDY31586.1| BnaA10g12850D [Brassica napus]
Length=132

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAVHDDCKLKFLELK KR +RFIVYKIEE+QKQV+VEKLGEP QS+DDF A LPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            AV+DFDF+T ES  KS+IFF+AWSPDTA+VRSKMIYASSKDRFKREL GIQVELQATDP
Sbjct  61   AVFDFDFVTAESCQKSKIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDP  119



>ref|XP_010528350.1| PREDICTED: actin-depolymerizing factor 1-like [Tarenaya hassleriana]
Length=132

 Score =   216 bits (549),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAVHDDCKLKFLELK KR +RFIV+KIEEKQKQVIVEKLG+P+QSY+DF+A LPADECRY
Sbjct  1    MAVHDDCKLKFLELKAKRMHRFIVFKIEEKQKQVIVEKLGDPSQSYEDFSASLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            AVYDFDF+T E+  KSRIFF+AWSPDT++VRSKMIYASSKDRFKREL GIQVELQATDP
Sbjct  61   AVYDFDFVTAENCQKSRIFFVAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDP  119



>ref|XP_002298043.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011029242.1| PREDICTED: actin-depolymerizing factor isoform X1 [Populus euphratica]
 gb|EEE82848.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=141

 Score =   216 bits (549),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  ANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLP  372
            ANSASGMAV D+CKL+F+ELK KR++RFIV+KIEEK +QV+VE LGEP QSYDDFTA LP
Sbjct  4    ANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASLP  63

Query  373  ADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVEL  552
            A+ECRYAVYDFDF T+E+V KS+IFF+AWSPDT+K+RSKM+YASS+DRF+REL G+QVEL
Sbjct  64   ANECRYAVYDFDFTTDENVQKSKIFFVAWSPDTSKIRSKMLYASSRDRFRRELDGVQVEL  123

Query  553  QATDP  567
            QATDP
Sbjct  124  QATDP  128



>ref|XP_004953378.1| PREDICTED: actin-depolymerizing factor 1-like [Setaria italica]
Length=139

 Score =   216 bits (549),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            M+NSASGMAV D+CKLKFLELK KR++RFIV+KI EK +QV+V++LGEP +SY+DFTACL
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGEPGESYEDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+T+E+  KS+IFFI+W+PDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010053689.1| PREDICTED: actin-depolymerizing factor [Eucalyptus grandis]
 gb|KCW78051.1| hypothetical protein EUGRSUZ_D02275 [Eucalyptus grandis]
Length=139

 Score =   216 bits (549),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAV+D+CKLKFLELK KR +RFIV+KI+EK +QV VEK+G P ++YDDFTAC+
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNHRFIVFKIDEKIQQVSVEKVGSPEETYDDFTACM  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAV+DFDF+T+E+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PANECRYAVFDFDFITDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006418977.1| hypothetical protein EUTSA_v10002714mg [Eutrema salsugineum]
 gb|ESQ37413.1| hypothetical protein EUTSA_v10002714mg [Eutrema salsugineum]
Length=137

 Score =   215 bits (548),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKFLELK KR +R IVYKIE+KQ  VIVEKLGEP QSYDDF A L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRY +YDFDF+TEE+  KS+IFFIAWSPDTAKVR KMIYASSKDRFKREL GIQVE
Sbjct  59   PDNECRYCIYDFDFVTEENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>emb|CDX99133.1| BnaA06g18240D [Brassica napus]
Length=167

 Score =   216 bits (551),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 114/128 (89%), Gaps = 2/128 (2%)
 Frame = +1

Query  184  TTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTA  363
            + +AN+ASGMAVHDDCKLKFLELK KR +R IVYKIE+KQ  VIVEKLGEP QSYDDF A
Sbjct  29   SVLANAASGMAVHDDCKLKFLELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAA  86

Query  364  CLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQ  543
             LP +ECRYA+YDFDF+TEE+  KS+IFFIAWSPDTAKVR KMIYASSKDRFKREL GIQ
Sbjct  87   SLPDNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQ  146

Query  544  VELQATDP  567
            VELQATDP
Sbjct  147  VELQATDP  154



>ref|XP_009358343.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
Length=139

 Score =   215 bits (548),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASG AV+DDCKLKFLELK KR YRFIV+KI+EK+ +VIVEKLG+PA+SY+DFTA L
Sbjct  1    MANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGQPAESYEDFTANL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAVYDFDF+T E+  KSRIFF+ WSPDTA+VR+KMIYASSKDRFKREL GIQVE
Sbjct  61   PDNECRYAVYDFDFVTVENCQKSRIFFVGWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006843593.1| hypothetical protein AMTR_s00007p00126220 [Amborella trichopoda]
 gb|ERN05268.1| hypothetical protein AMTR_s00007p00126220 [Amborella trichopoda]
Length=139

 Score =   215 bits (548),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAVHD+CKL+FLELKTKR++RFIV+KI+EK +QV+VEKLG+P  +YDDF A L
Sbjct  1    MANSASGMAVHDNCKLRFLELKTKRSHRFIVFKIDEKIQQVMVEKLGQPNDTYDDFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYAV+DFDF+T+E+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQ+E
Sbjct  61   PPDECRYAVFDFDFVTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQLE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010922979.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=256

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV+DDCKLKFLELK KR +R+I++KI+EK KQVIVEK+GEP  SY+DFTA L
Sbjct  118  MANAASGMAVNDDCKLKFLELKAKRTHRYIIFKIDEKLKQVIVEKVGEPTLSYEDFTAAL  177

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYA+YDFDF+TEE+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  178  PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  237

Query  550  LQATDP  567
            LQATDP
Sbjct  238  LQATDP  243



>ref|NP_566882.1| actin depolymerizing factor 2 [Arabidopsis thaliana]
 sp|Q39251.1|ADF2_ARATH RecName: Full=Actin-depolymerizing factor 2; Short=ADF-2; Short=AtADF2 
[Arabidopsis thaliana]
 gb|AAK43859.1|AF370482_1 actin depolymerizing factor 2; ADF2 [Arabidopsis thaliana]
 gb|AAK62370.1|AF386925_1 actin depolymerizing factor 2 [Arabidopsis thaliana]
 gb|AAB03697.1| actin depolymerizing factor 2 [Arabidopsis thaliana]
 gb|AAL47369.1| actin depolymerizing factor 2 (ADF2) [Arabidopsis thaliana]
 gb|AAN15696.1| actin depolymerizing factor 2 [Arabidopsis thaliana]
 gb|AEE78099.1| actin depolymerizing factor 2 [Arabidopsis thaliana]
Length=137

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELK KR +R IVYKIE+KQ  VIVEKLGEP QSYDDF A L
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PAD+CRY +YDFDF+T E+  KS+IFFIAWSPDTAKVR KMIYASSKDRFKREL GIQVE
Sbjct  59   PADDCRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>ref|XP_009386059.1| PREDICTED: actin-depolymerizing factor [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAV+D+CKLKFLELK KR +RFIV+KI+EK +QV+VEKLG P +SYDDFTAC 
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNFRFIVFKIDEKIQQVMVEKLGRPDESYDDFTACF  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAV+DFDF+T+E+  KS+IFFIAWSPD++KVRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PPNECRYAVFDFDFVTDENCQKSKIFFIAWSPDSSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010558792.1| PREDICTED: actin-depolymerizing factor 2-like isoform X1 [Tarenaya 
hassleriana]
Length=139

 Score =   214 bits (545),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASG+AVH DCKL+FL+LK KR YR+IVYKIE +QK+VIVEKLGEP +SY+DF+A L
Sbjct  1    MANAASGVAVHGDCKLRFLDLKAKRTYRYIVYKIEMEQKEVIVEKLGEPTESYEDFSAAL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFD++T+E+  KSRI FIAWSPD +KVR+KMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDYVTDENCQKSRIVFIAWSPDASKVRNKMIYASSKDRFKRELDGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010503214.1| PREDICTED: actin-depolymerizing factor 2 [Camelina sativa]
Length=137

 Score =   214 bits (544),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 112/126 (89%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELK KR +R IVYKIE++Q  VIVEKLGEP Q+YDDF A L
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDRQ--VIVEKLGEPEQTYDDFAASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRY +YDFDF+T E+  KS+IFFIAWSPDTAKVR KMIYASSKDRFKREL GIQVE
Sbjct  59   PADECRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>emb|CDX86048.1| BnaC03g55630D [Brassica napus]
Length=167

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 114/129 (88%), Gaps = 2/129 (2%)
 Frame = +1

Query  181  RTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFT  360
             + +AN+ASGMAVHDDCKLKFLELK KR +R IVYKIE+KQ  VIVEKLGEP QSYDDF 
Sbjct  28   ESVLANAASGMAVHDDCKLKFLELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFA  85

Query  361  ACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGI  540
            A LP +ECRYA+YDFDF+TEE+  KS+IFFIAWSPDTAKVR KMIYASSKDRFK+EL GI
Sbjct  86   ASLPDNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKKELDGI  145

Query  541  QVELQATDP  567
            QVELQATDP
Sbjct  146  QVELQATDP  154



>ref|XP_004306801.2| PREDICTED: actin-depolymerizing factor 10 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469032.1| PREDICTED: actin-depolymerizing factor 10 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=139

 Score =   214 bits (544),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            M+N++SGMAVHDDCKLKFLELK KR +RFIV+KIEEK +QVIVEK+G P ++Y+DFT  +
Sbjct  1    MSNASSGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKIGGPDETYEDFTNSI  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF TEE+  KS+IFFI+WSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVYDFDFTTEENCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELEGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002271495.1| PREDICTED: actin-depolymerizing factor 10 [Vitis vinifera]
 emb|CAN73839.1| hypothetical protein VITISV_012391 [Vitis vinifera]
Length=139

 Score =   213 bits (543),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAVHD+CKLKFLELK KR +RFIV+KI+E+ +QV+VEKLG P ++Y+DFT  L
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNHRFIVFKIDERIQQVMVEKLGSPDETYEDFTNSL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF T+E+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_008438059.1| PREDICTED: actin-depolymerizing factor 7-like [Cucumis melo]
Length=139

 Score =   213 bits (543),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANS+SGMAVHD+CKLKFL+LK KR YRFIV+KIEEK +QV VEK+G P ++YDDFTA +
Sbjct  1    MANSSSGMAVHDECKLKFLDLKAKRKYRFIVFKIEEKMQQVTVEKVGGPDETYDDFTASI  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFDF TEE+  KS+I+FIAWSPD++++RSKM+YASSKDRFKREL GIQVE
Sbjct  61   PANECRYAVYDFDFTTEENCQKSKIYFIAWSPDSSRIRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010419619.1| PREDICTED: actin-depolymerizing factor 8-like [Camelina sativa]
Length=141

 Score =   213 bits (542),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGM V D+CKLKFLELK KR YRFIV+KI+EK +QV +EKLG P ++YDDFT+C+
Sbjct  1    MANSASGMKVSDECKLKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSCI  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYAVYDFDF TE++  KS+IFFIAWSPDT++VRSKM+YASSKDRFKRE+ GIQVE
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMEGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006292028.1| hypothetical protein CARUB_v10018217mg [Capsella rubella]
 gb|EOA24926.1| hypothetical protein CARUB_v10018217mg [Capsella rubella]
Length=137

 Score =   213 bits (542),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 112/126 (89%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELK KR +R IVYKIE+KQ  VIVEKLGEP QSYDDF A L
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRY +YD+DF+T E+  KS+IFFIAWSPDTAKVR KMIYASSKDRFKREL GIQVE
Sbjct  59   PAEECRYCIYDYDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>gb|AEW90956.1| actin depolymerizing factor 4-2 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=139

 Score =   213 bits (542),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            M+NSASGMAV DDCKLKF ELK KR++RFIV+KI+EK +QV+V+++GE  +SYDDFTACL
Sbjct  1    MSNSASGMAVCDDCKLKFQELKAKRSFRFIVFKIDEKVQQVVVDRVGEKTESYDDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+T+E+  KS+IFFI+W+PDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010514925.1| PREDICTED: actin-depolymerizing factor 2-like [Camelina sativa]
Length=137

 Score =   213 bits (541),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELK KR +R IVYKIE++Q  V+VEKLGEP QSYDDF A L
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDRQ--VVVEKLGEPEQSYDDFAASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRY +YDFDF+T E+  KS+IFFIAWSPDTAKVR KMIYASSKDRFKREL GIQVE
Sbjct  59   PEDECRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>ref|XP_010456252.1| PREDICTED: actin-depolymerizing factor 8-like [Camelina sativa]
Length=141

 Score =   213 bits (541),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGM V D+CK+KFLELK KR YRFIV+KI+EK +QV +EKLG P ++YDDFT+C+
Sbjct  1    MANSASGMNVSDECKIKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSCI  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYAVYDFDF TE++  KS+IFFIAWSPDT++VRSKM+YASSKDRFKRE+ GIQVE
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMEGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006647644.1| PREDICTED: actin-depolymerizing factor 1-like [Oryza brachyantha]
Length=139

 Score =   212 bits (540),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            M+NSASGMAV D+CKLKF +LK KR++RFIV+KI EK +QV+V++LG+P +SYDDF+ACL
Sbjct  1    MSNSASGMAVCDECKLKFQDLKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFSACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+T+E+  KS+IFFI+WSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_007040194.1| Actin depolymerizing factor 8 [Theobroma cacao]
 gb|EOY24695.1| Actin depolymerizing factor 8 [Theobroma cacao]
Length=139

 Score =   212 bits (540),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAV+D+CK KFLELK KR+YRFIV+KIEEK +QV+VEKLG P+ SYDD +A L
Sbjct  1    MANSASGMAVNDECKRKFLELKAKRSYRFIVFKIEEKIQQVVVEKLGGPSDSYDDLSASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAVYDFDF T+E+  KS+IFFIAWSPDT++VRSKM+YASSKDRF+REL G+QVE
Sbjct  61   PANECRYAVYDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFRRELDGVQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010426027.1| PREDICTED: actin-depolymerizing factor 2-like [Camelina sativa]
Length=137

 Score =   212 bits (539),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELK KR +R IVYKIE++Q  VIVEKLGEP Q+YDDF A L
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDRQ--VIVEKLGEPEQTYDDFAASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRY +YDFDF+T E+  KS+IFFIAWSPDTAKVR KMIYASSKDRFKREL GIQVE
Sbjct  59   PEDECRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>ref|XP_006436041.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 gb|ESR49281.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 gb|KDO67707.1| hypothetical protein CISIN_1g032498mg [Citrus sinensis]
Length=132

 Score =   212 bits (539),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  MAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLPADECRY  390
            MAV DDCKLKFLELK KR YRFIV+KIEEKQKQV+VEKLGEP+ SY++FTA LPADECRY
Sbjct  1    MAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSDSYENFTASLPADECRY  60

Query  391  AVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVELQATDP  567
            AVYDFDF+T+E+  KS+I FIAWSPDT+KVRSKMIYASSKDRFKREL GIQVELQATDP
Sbjct  61   AVYDFDFVTDENCQKSKIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVELQATDP  119



>gb|KDP22276.1| hypothetical protein JCGZ_26107 [Jatropha curcas]
Length=137

 Score =   212 bits (539),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAVHDDCKLKFLELK KR YRFI +KIE++Q  VI++KLG P Q+YDDFTA L
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNYRFITFKIEDQQ--VIIDKLGTPQQTYDDFTASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAV+DFDF T+E+  KS+IFFIAWSPDT++VR KM+YASSKDRFKREL GIQVE
Sbjct  59   PANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>ref|XP_010662752.1| PREDICTED: actin-depolymerizing factor 1 [Vitis vinifera]
Length=139

 Score =   212 bits (539),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAV+D+CKLKFLELK KR +RFIV+KIEEK +QV+VEKLG P +SYD FT+ L
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNHRFIVFKIEEKIQQVVVEKLGSPDESYDAFTSSL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAV+DFDF T+E+  KS+IFFIAW+PDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PANECRYAVFDFDFTTDENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004984753.1| PREDICTED: actin-depolymerizing factor 7-like isoform X2 [Setaria 
italica]
Length=139

 Score =   211 bits (538),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAV DDCK +FLELK KR YRF+V++I+E+QKQV+VEKLGEP  +YD F A L
Sbjct  1    MANAASGMAVDDDCKRRFLELKAKRTYRFVVFRIDEEQKQVVVEKLGEPNLTYDVFAAIL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRY +YDFDF+TEE   KS+IFFIAWSPDTAK+RSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYCIYDFDFVTEEGCQKSKIFFIAWSPDTAKIRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010534301.1| PREDICTED: actin-depolymerizing factor 1-like [Tarenaya hassleriana]
Length=139

 Score =   211 bits (538),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASG+AVHDDCKL+FL+LK KR YR++VYKIE  QKQV+VEKLGEP +SY+ F A L
Sbjct  1    MANAASGVAVHDDCKLRFLDLKAKRTYRYVVYKIEMDQKQVVVEKLGEPTESYEAFAASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFD++T+E+  KSRI F+AWSPD +KVR+KMIYASSKDRFKREL GIQ+E
Sbjct  61   PADECRYAVYDFDYVTDENCQKSRIVFVAWSPDESKVRNKMIYASSKDRFKRELEGIQIE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004503768.1| PREDICTED: actin-depolymerizing factor 7-like [Cicer arietinum]
Length=137

 Score =   211 bits (538),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 114/126 (90%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+F ELK+KR+YRFIV+KIEE+Q  V+VEKLGEP++SYDDF A  
Sbjct  1    MANAASGMAVHDDCKLRFQELKSKRSYRFIVFKIEEQQ--VVVEKLGEPSESYDDFMASF  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF T+E+  KS+IFF AWSPDT++VR KM+YASSKDRFKREL GIQVE
Sbjct  59   PADECRYAVYDFDFTTDENCQKSKIFFYAWSPDTSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>gb|AET05009.2| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
Length=137

 Score =   211 bits (537),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+F ELK+KR+YRFIV+KIEE+Q  V+VEKLGEP+ SYDDF A  
Sbjct  1    MANAASGMAVHDDCKLRFQELKSKRSYRFIVFKIEEQQ--VVVEKLGEPSDSYDDFMASF  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF T E+  KS+I+F+AWSPDT++VR KM+YASSKDRFKREL GIQVE
Sbjct  59   PADECRYAVYDFDFTTNENCQKSKIYFVAWSPDTSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>ref|XP_008392560.1| PREDICTED: actin-depolymerizing factor 7-like [Malus domestica]
Length=137

 Score =   211 bits (537),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR+YRFI+YKIE  Q+Q++++KLGEP +SY+DFTA  
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRSYRFILYKIE--QQQIVIDKLGEPNESYEDFTASF  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF TEE+  KS+IFFIAWSPDT+KVR KM+YASSKDRFKREL GI  E
Sbjct  59   PADECRYAVYDFDFTTEENCQKSKIFFIAWSPDTSKVRMKMVYASSKDRFKRELDGISFE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>sp|P30175.1|ADF_LILLO RecName: Full=Actin-depolymerizing factor; Short=ADF [Lilium 
longiflorum]
 emb|CAA78483.1| actin depolymerizing factor [Lilium longiflorum]
Length=139

 Score =   211 bits (537),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANS+SGMAV D+CKLKF+ELK KR +RFIV+KIEEK +QV VE+LG+P +SYDDFT CL
Sbjct  1    MANSSSGMAVDDECKLKFMELKAKRNFRFIVFKIEEKVQQVTVERLGQPNESYDDFTECL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAV+DFDF+T+E+  KS+IFFI+WSPDT++VRSKM+YAS+KDRFKREL GIQVE
Sbjct  61   PPNECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYASTKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|KHG18554.1| Actin-depolymerizing factor [Gossypium arboreum]
 gb|KJB27404.1| hypothetical protein B456_004G210500 [Gossypium raimondii]
Length=139

 Score =   211 bits (536),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAV+D+CK++FLELK KR+YRFIV+KIEE  +QV+VEKLG P + YDDF+ACL
Sbjct  1    MANSASGMAVNDECKMRFLELKAKRSYRFIVFKIEENIQQVMVEKLGGPKEKYDDFSACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P +ECRYAV+DFDF T+E+V KS+IFFIAWSPDT++VRSKM+YASSKDRF+REL G+QVE
Sbjct  61   PHNECRYAVFDFDFTTDENVQKSKIFFIAWSPDTSRVRSKMLYASSKDRFRRELDGVQVE  120

Query  550  LQATD  564
            LQATD
Sbjct  121  LQATD  125



>gb|KCW71635.1| hypothetical protein EUGRSUZ_E00162 [Eucalyptus grandis]
Length=139

 Score =   211 bits (536),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANS+SGMAV D+CKLKFLELKTKR YRFIV+KIEEK +QV +EKLG P ++YDDF++ L
Sbjct  1    MANSSSGMAVDDECKLKFLELKTKRIYRFIVFKIEEKIQQVTIEKLGSPEETYDDFSSSL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF T+E+  KS+IFFIAW+P+T++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFTTDENCQKSKIFFIAWAPETSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_010910598.1| PREDICTED: actin-depolymerizing factor [Elaeis guineensis]
Length=178

 Score =   212 bits (540),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  TMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTAC  366
             MANS SG+AV D+CKLKFLELK KR +RFIV+KI+EK +QV VE+LG+P +SYDDFTAC
Sbjct  39   NMANSPSGIAVDDECKLKFLELKAKRNFRFIVFKIDEKIQQVTVERLGQPDESYDDFTAC  98

Query  367  LPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQV  546
            LP +ECRYAV+DFDF+T+E+  KS+IFFIAWSPDT+KVRSKM+YASSKDRFKREL GIQV
Sbjct  99   LPPNECRYAVFDFDFVTDENCQKSKIFFIAWSPDTSKVRSKMVYASSKDRFKRELDGIQV  158

Query  547  ELQATDP  567
            ELQATDP
Sbjct  159  ELQATDP  165



>ref|XP_008804935.1| PREDICTED: actin-depolymerizing factor isoform X2 [Phoenix dactylifera]
Length=139

 Score =   211 bits (536),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAV+D+CKLKFLELK KR +RFI++KI+EK +QV VEKLG+P +SYDDFTA L
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYAV+DFDF+T+E+  KS+I FI+WSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PANECRYAVFDFDFVTDENCQKSKIIFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_009384093.1| PREDICTED: actin-depolymerizing factor 1 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   211 bits (536),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAV D+CKLKFLELK KR +RFIV+KI+E+ +QV+VEKLG+P ++YDDF A +
Sbjct  1    MANSASGMAVSDECKLKFLELKAKRNFRFIVFKIDERIQQVMVEKLGQPGETYDDFAASM  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+T+E   KS+IFFI+WSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFVTDEHCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|AGW22223.1| actin-depolymerizing factor 4 [Triticum aestivum]
Length=139

 Score =   211 bits (536),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            M+NSASGMAV D+CKLKF ELK KR++RFIV+KI EK +QV+V+++GE  +SYDDFTACL
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKTESYDDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+T+E+  KS+IFFI+W+PDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>gb|AEP25120.1| actin depolymerising factor [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AIT97057.1| actin-depolymerizing factor 11 [Triticum aestivum]
Length=139

 Score =   211 bits (536),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            M+NSASGMAV D+CKLKF ELK KR++RFIV+KI EK +QV+V+++GE  +SYDDFTACL
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKTESYDDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+T+E+  KS+IFFI+W+PDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_002872934.1| hypothetical protein ARALYDRAFT_490501 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49193.1| hypothetical protein ARALYDRAFT_490501 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   210 bits (535),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGM V+D+CKLKFLELK KR YRFIV+KI+EK +QV +EKLG P ++YDDFT+ +
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSAI  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYAVYDFDF TE++  KS+IFFIAWSPDT++VRSKM+YASSKDRFKRE+ GIQVE
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_007038697.1| Actin depolymerizing factor 7 [Theobroma cacao]
 gb|EOY23198.1| Actin depolymerizing factor 7 [Theobroma cacao]
Length=137

 Score =   210 bits (535),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 114/126 (90%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGMAVHD+CKLKFLELK KR YRFIV+KI+++Q  V+V+K+G P ++YDDF A L
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNYRFIVFKIQDQQ--VVVDKVGSPQETYDDFQASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+T E+  KS+IFFIAWSPDT+KVRSKM+YASSKDRFKREL GIQVE
Sbjct  59   PADECRYAVFDFDFITSENCQKSKIFFIAWSPDTSKVRSKMVYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>ref|XP_008385227.1| PREDICTED: actin-depolymerizing factor 1-like, partial [Malus 
domestica]
Length=147

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  ANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLP  372
            AN+ASG  V DDCKLKFLELK KR YRFIV+KI+EK+ +VIVEKLG PA+SY+DFTA LP
Sbjct  10   ANAASGFXVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGXPAESYEDFTANLP  69

Query  373  ADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVEL  552
             +ECRYAVYDFDF+T E+  KSRIFFI WSPDTA+VR+KMIYASSKDRFKREL GIQVEL
Sbjct  70   DNECRYAVYDFDFVTAENCQKSRIFFIGWSPDTARVRNKMIYASSKDRFKRELDGIQVEL  129

Query  553  QATDP  567
            QATDP
Sbjct  130  QATDP  134



>emb|CBI40336.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  TMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTAC  366
             MANSASGMAVHD+CKLKFLELK KR +RFIV+KI+E+ +QV+VEKLG P ++Y+DFT  
Sbjct  117  NMANSASGMAVHDECKLKFLELKAKRNHRFIVFKIDERIQQVMVEKLGSPDETYEDFTNS  176

Query  367  LPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQV  546
            LPADECRYAV+DFDF T+E+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQV
Sbjct  177  LPADECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQV  236

Query  547  ELQATDP  567
            ELQATDP
Sbjct  237  ELQATDP  243



>gb|KFK27529.1| hypothetical protein AALP_AA8G395300 [Arabis alpina]
Length=137

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKL+FLELK KR +RFIVYKIE   KQV+VEK+GEP  +YDDF A L
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIE--GKQVVVEKVGEPILTYDDFAASL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PA+ECRYA+YDFDF+T E+  KS+IFFIAW PD AKVRSKMIYASSKDRFKREL GIQVE
Sbjct  59   PAEECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>gb|AEW90955.1| actin depolymerizing factor 4-1 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=139

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            M+NSASGMAV D CKLKF ELK KR++RFIV+KI EK +QV+V+++GE  +SYDDFTACL
Sbjct  1    MSNSASGMAVCDQCKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKNESYDDFTACL  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAV+DFDF+T+E+  KS+IFFI+W+PDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_006490391.1| PREDICTED: actin-depolymerizing factor 7-like [Citrus sinensis]
Length=137

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 110/126 (87%), Gaps = 2/126 (2%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MAN+ASGMAVHDDCKLKF+ELK KR YRFI++KI+   +QV+VEKLG P  SYDDFT  L
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRNYRFIIFKID--NQQVVVEKLGSPGDSYDDFTTSL  58

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            PADECRYAVYDFDF+T E+  KS+IFFIAWSPD +KVRSKM+YASSKDRFKREL GIQ E
Sbjct  59   PADECRYAVYDFDFITHENCQKSKIFFIAWSPDPSKVRSKMVYASSKDRFKRELDGIQFE  118

Query  550  LQATDP  567
            LQATDP
Sbjct  119  LQATDP  124



>ref|XP_002892045.1| hypothetical protein ARALYDRAFT_887267 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68304.1| hypothetical protein ARALYDRAFT_887267 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  190  MANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACL  369
            MANSASGM V DDCKLKFLELK KR YRFIV+KI+EK +QV+++KLG P ++YDDFT  +
Sbjct  1    MANSASGMHVSDDCKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYDDFTRSI  60

Query  370  PADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVE  549
            P DECRYAVYDFDF T E+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQVE
Sbjct  61   PEDECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  550  LQATDP  567
            LQATDP
Sbjct  121  LQATDP  126



>ref|XP_004984752.1| PREDICTED: actin-depolymerizing factor 7-like isoform X1 [Setaria 
italica]
Length=155

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  RTTMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFT  360
            R   AN+ASGMAV DDCK +FLELK KR YRF+V++I+E+QKQV+VEKLGEP  +YD F 
Sbjct  14   RWVQANAASGMAVDDDCKRRFLELKAKRTYRFVVFRIDEEQKQVVVEKLGEPNLTYDVFA  73

Query  361  ACLPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGI  540
            A LPADECRY +YDFDF+TEE   KS+IFFIAWSPDTAK+RSKM+YASSKDRFKREL GI
Sbjct  74   AILPADECRYCIYDFDFVTEEGCQKSKIFFIAWSPDTAKIRSKMLYASSKDRFKRELDGI  133

Query  541  QVELQATDP  567
            QVELQATDP
Sbjct  134  QVELQATDP  142



>ref|XP_009411533.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=169

 Score =   210 bits (535),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  ANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTACLP  372
            AN+ASGMAV D+CKLKFLELK KR +RFIV+KI+E+ +QV+V+KLG+P +SYDDFTA LP
Sbjct  32   ANAASGMAVSDECKLKFLELKAKRNFRFIVFKIDERIQQVMVDKLGQPDESYDDFTASLP  91

Query  373  ADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQVEL  552
            ADECRYAV+DFDF+T+E+  KS+IFFIAWSPD A+VRSKM+YASSKDRFKREL GIQVEL
Sbjct  92   ADECRYAVFDFDFVTDENCQKSKIFFIAWSPDAARVRSKMLYASSKDRFKRELDGIQVEL  151

Query  553  QATDP  567
            QATDP
Sbjct  152  QATDP  156



>emb|CDY38025.1| BnaCnng08860D [Brassica napus]
Length=176

 Score =   210 bits (535),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +1

Query  187  TMANSASGMAVHDDCKLKFLELKTKRAYRFIVYKIEEKQKQVIVEKLGEPAQSYDDFTAC  366
             MANSASGM V+D+CKLKFLELK KR YRFIV+KI+EK +QV++E +G P ++YDDFT C
Sbjct  36   NMANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIEMVGNPEKTYDDFTKC  95

Query  367  LPADECRYAVYDFDFLTEESVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELGGIQV  546
            +P +ECRYAVYDFDF T E+  KS+IFFIAWSPDT++VRSKM+YASSKDRFKREL GIQV
Sbjct  96   MPENECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQV  155

Query  547  ELQATDP  567
            ELQATDP
Sbjct  156  ELQATDP  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960