BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F20

Length=603
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB83376.1|  hypothetical protein B456_013G244600                    336   4e-113   Gossypium raimondii
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   342   4e-113   Tarenaya hassleriana [spider flower]
emb|CBI16534.3|  unnamed protein product                                341   5e-113   Vitis vinifera
ref|XP_010535935.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    342   7e-113   Tarenaya hassleriana [spider flower]
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              342   7e-113   Brassica rapa
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             341   9e-113   Capsella rubella
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              341   1e-112   Brassica rapa
ref|NP_197478.1|  tubulin alpha-3                                       341   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              341   1e-112   Camelina sativa [gold-of-pleasure]
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              341   1e-112   Brassica rapa
emb|CDY42294.1|  BnaC02g09000D                                          341   1e-112   Brassica napus [oilseed rape]
emb|CDY44941.1|  BnaA02g04460D                                          341   1e-112   Brassica napus [oilseed rape]
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   341   1e-112   Brassica rapa
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             341   1e-112   Capsella rubella
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              340   2e-112   Cicer arietinum [garbanzo]
ref|XP_003629736.1|  Alpha-tubulin                                      340   2e-112   Medicago truncatula
emb|CDX88875.1|  BnaA03g07740D                                          340   2e-112   
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              340   2e-112   Brassica rapa
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    340   2e-112   Tarenaya hassleriana [spider flower]
ref|XP_006584595.1|  PREDICTED: uncharacterized protein LOC100806...    339   3e-112   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   340   3e-112   Elaeis guineensis
gb|KJB83377.1|  hypothetical protein B456_013G244600                    336   3e-112   Gossypium raimondii
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                339   5e-112   Erythranthe guttata [common monkey flower]
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          339   6e-112   Amborella trichopoda
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   338   9e-112   Vitis vinifera
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              338   1e-111   Phoenix dactylifera
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         338   1e-111   Jatropha curcas
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   338   2e-111   Sesamum indicum [beniseed]
ref|XP_008240534.1|  PREDICTED: tubulin alpha-3 chain isoform X2        337   2e-111   Prunus mume [ume]
gb|AGG37284.1|  alpha-tubulin 2                                         338   2e-111   Salix arbutifolia
ref|XP_008449886.1|  PREDICTED: tubulin alpha-3 chain isoform X2        337   3e-111   
ref|XP_002532068.1|  tubulin alpha chain, putative                      337   3e-111   Ricinus communis
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     337   3e-111   Populus trichocarpa [western balsam poplar]
dbj|BAM28754.1|  tubulin                                                335   3e-111   Brassica rapa subsp. chinensis [bok-choy]
ref|NP_001237301.1|  tubulin A                                          337   3e-111   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              337   4e-111   Elaeis guineensis
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   337   4e-111   Nelumbo nucifera [Indian lotus]
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    337   4e-111   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              337   5e-111   Morus notabilis
gb|AGD80034.1|  alpha-tubulin 1                                         337   6e-111   Hevea brasiliensis [jebe]
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              336   8e-111   Cucumis sativus [cucumbers]
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             336   8e-111   Phaseolus vulgaris [French bean]
ref|NP_001275086.1|  uncharacterized LOC102577521                       336   8e-111   Solanum tuberosum [potatoes]
ref|XP_004170946.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    336   8e-111   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              336   9e-111   Cucumis melo [Oriental melon]
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              336   9e-111   Cucumis sativus [cucumbers]
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        336   1e-110   Cucumis melo [Oriental melon]
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                336   1e-110   Erythranthe guttata [common monkey flower]
gb|AHZ58482.1|  alpha-tubulin                                           329   1e-110   Syntrichia caninervis
gb|AAO63773.2|  alpha-tubulin 2                                         336   1e-110   Populus tremuloides
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   336   1e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              335   2e-110   Oryza brachyantha
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             335   2e-110   Gossypium arboreum [tree cotton]
gb|KJB80786.1|  hypothetical protein B456_013G115100                    335   2e-110   Gossypium raimondii
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              335   2e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB83375.1|  hypothetical protein B456_013G244600                    335   2e-110   Gossypium raimondii
ref|XP_006488931.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    335   2e-110   
gb|EPS70933.1|  tubulin alpha-6 chain                                   329   2e-110   Genlisea aurea
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             335   2e-110   Gossypium arboreum [tree cotton]
gb|AIC33057.1|  tubulin alpha-1 chain                                   335   2e-110   Panax ginseng [Asiatic ginseng]
ref|NP_001242878.1|  uncharacterized protein LOC100806907               335   2e-110   Glycine max [soybeans]
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              335   3e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              335   3e-110   Nelumbo nucifera [Indian lotus]
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   334   4e-110   Phoenix dactylifera
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   334   4e-110   Pyrus x bretschneideri [bai li]
ref|NP_001105588.1|  tubulin alpha-6 chain                              334   4e-110   Zea mays [maize]
emb|CAD26886.1|  alpha-tubulin                                          334   4e-110   Miscanthus sinensis
emb|CAD24766.1|  alpha-tubulin                                          334   4e-110   Miscanthus sinensis
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              334   5e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001060075.1|  Os07g0574800                                       334   5e-110   
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             334   5e-110   Prunus persica
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        334   5e-110   Prunus mume [ume]
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   334   5e-110   Populus euphratica
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              334   6e-110   Prunus mume [ume]
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   334   7e-110   Musa acuminata subsp. malaccensis [pisang utan]
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    334   7e-110   Eleusine indica [crabgrass]
emb|CAD24765.1|  alpha-tubulin                                          334   7e-110   Miscanthus sinensis
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   334   7e-110   Eucalyptus grandis [rose gum]
gb|AGY80453.1|  tubulin                                                 333   9e-110   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   333   1e-109   Brachypodium distachyon [annual false brome]
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         333   1e-109   Jatropha curcas
gb|ACN40824.1|  unknown                                                 333   1e-109   Picea sitchensis
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             333   2e-109   Prunus persica
emb|CDP17586.1|  unnamed protein product                                333   2e-109   Coffea canephora [robusta coffee]
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             333   2e-109   Citrus clementina [clementine]
ref|XP_007014666.1|  Tubulin alpha-5                                    333   2e-109   Theobroma cacao [chocolate]
gb|KDO55010.1|  hypothetical protein CISIN_1g0157541mg                  329   2e-109   Citrus sinensis [apfelsine]
gb|AGV54500.1|  tubulin A                                               332   3e-109   Phaseolus vulgaris [French bean]
ref|XP_011461685.1|  PREDICTED: tubulin alpha-3 chain isoform X2        331   3e-109   Fragaria vesca subsp. vesca
gb|ABD92943.1|  alpha tubulin-1B                                        332   3e-109   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92942.1|  alpha tubulin-1D                                        332   3e-109   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              332   3e-109   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAD26891.1|  alpha-tubulin                                          332   4e-109   Miscanthus floridulus
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              332   5e-109   Eucalyptus grandis [rose gum]
ref|NP_001105324.1|  tubulin alpha-5 chain                              331   7e-109   Zea mays [maize]
gb|EYU34086.1|  hypothetical protein MIMGU_mgv1a0196711mg               322   7e-109   Erythranthe guttata [common monkey flower]
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              331   7e-109   Setaria italica
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             331   8e-109   Citrus clementina [clementine]
gb|ABE66388.1|  alpha-tubulin                                           322   8e-109   Striga asiatica [witchweed]
dbj|BAJ06363.1|  alpha-tubulin                                          331   9e-109   Alopecurus aequalis
gb|AGG37286.1|  alpha-tubulin 4                                         331   9e-109   Salix arbutifolia
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              331   1e-108   Populus euphratica
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               331   1e-108   Populus trichocarpa [western balsam poplar]
gb|ABV55994.1|  alpha-tubulin 6                                         330   1e-108   Populus tremuloides
gb|AGG37290.1|  alpha-tubulin 8                                         330   1e-108   Salix arbutifolia
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   330   1e-108   Malus domestica [apple tree]
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              330   2e-108   Populus euphratica
emb|CAD26893.1|  alpha-tubulin                                          330   2e-108   Miscanthus floridulus
emb|CAD26887.1|  alpha-tubulin                                          330   2e-108   Miscanthus sinensis
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             330   2e-108   Hordeum vulgare [barley]
gb|ACN40426.1|  unknown                                                 325   2e-108   Picea sitchensis
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        330   2e-108   Fragaria vesca subsp. vesca
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   330   2e-108   Nicotiana tomentosiformis
emb|CAB77671.1|  alpha-tubulin                                          330   3e-108   Miscanthus sinensis f. glaber
gb|ABO47741.1|  alpha-tubulin                                           329   4e-108   Gossypium hirsutum [American cotton]
emb|CBI29424.3|  unnamed protein product                                323   4e-108   Vitis vinifera
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     325   5e-108   
gb|ABO47735.1|  alpha-tubulin                                           329   5e-108   Gossypium hirsutum [American cotton]
emb|CAB77672.1|  alpha-tubulin                                          329   6e-108   Miscanthus transmorrisonensis
gb|EYU20672.1|  hypothetical protein MIMGU_mgv1a004180mg                332   6e-108   Erythranthe guttata [common monkey flower]
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   329   7e-108   Populus euphratica
ref|XP_003624633.1|  Alpha-tubulin                                      329   7e-108   Medicago truncatula
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              329   7e-108   Glycine max [soybeans]
gb|ACU18775.1|  unknown                                                 320   7e-108   Glycine max [soybeans]
emb|CAD26889.1|  alpha-tubulin                                          328   7e-108   Miscanthus transmorrisonensis
ref|XP_001777081.1|  predicted protein                                  328   8e-108   
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              328   9e-108   Pyrus x bretschneideri [bai li]
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              328   9e-108   Sesamum indicum [beniseed]
emb|CAD26890.1|  alpha-tubulin                                          328   9e-108   Miscanthus sinensis subsp. condensatus
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   328   9e-108   Malus domestica [apple tree]
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     328   1e-107   Populus trichocarpa [western balsam poplar]
ref|XP_002525416.1|  tubulin alpha chain, putative                      328   1e-107   Ricinus communis
ref|XP_001782790.1|  predicted protein                                  328   1e-107   
gb|AAX21196.1|  putative alpha-tubulin                                  319   1e-107   Solanum betaceum [tamarillo]
gb|ABO47738.1|  alpha-tubulin                                           328   1e-107   Gossypium hirsutum [American cotton]
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               328   1e-107   Populus trichocarpa [western balsam poplar]
sp|Q38771.1|TBA_AVESA  RecName: Full=Tubulin alpha chain                328   2e-107   Avena sativa [cultivated oat]
ref|XP_007047652.1|  Tubulin alpha-2 chain                              329   2e-107   
gb|AAN33000.1|  alpha-tubulin 4                                         323   2e-107   Gossypium hirsutum [American cotton]
emb|CAD26892.1|  alpha-tubulin                                          327   3e-107   Miscanthus floridulus
gb|KHN46768.1|  Tubulin alpha-3 chain                                   327   3e-107   Glycine soja [wild soybean]
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    327   3e-107   Brassica rapa
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          326   3e-107   
gb|KJB44614.1|  hypothetical protein B456_007G261000                    327   4e-107   Gossypium raimondii
gb|KHG26159.1|  Tubulin alpha-6 chain                                   327   4e-107   Gossypium arboreum [tree cotton]
gb|AGG37288.1|  alpha-tubulin 6                                         327   4e-107   Salix arbutifolia
ref|XP_004985171.1|  PREDICTED: tubulin alpha-2 chain-like              327   4e-107   
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   324   5e-107   Citrus sinensis [apfelsine]
gb|ABB16994.1|  unknown                                                 327   5e-107   Solanum tuberosum [potatoes]
gb|AEG74028.1|  alpha-tubulin                                           326   6e-107   Apopellia endiviifolia (species B)
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     326   6e-107   
emb|CBI25125.3|  unnamed protein product                                324   6e-107   Vitis vinifera
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             326   6e-107   Phaseolus vulgaris [French bean]
emb|CBI19330.3|  unnamed protein product                                325   6e-107   Vitis vinifera
emb|CBI22190.3|  unnamed protein product                                324   7e-107   Vitis vinifera
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    325   7e-107   
gb|ABR67425.1|  alpha-tubulin 4                                         326   7e-107   Populus tremuloides
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     326   8e-107   Eucalyptus grandis [rose gum]
ref|XP_002675196.1|  alpha-tubulin                                      326   8e-107   Naegleria gruberi strain NEG-M
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   326   8e-107   
tpg|DAA51110.1|  TPA: alpha-tubulin                                     318   8e-107   
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         326   8e-107   Jatropha curcas
gb|AFW89176.1|  hypothetical protein ZEAMMB73_322393                    326   8e-107   
gb|ABO47737.1|  alpha-tubulin                                           326   9e-107   Gossypium hirsutum [American cotton]
gb|KHG20487.1|  Tubulin alpha chain                                     326   9e-107   Gossypium arboreum [tree cotton]
ref|XP_005851144.1|  alpha-tubulin                                      326   9e-107   Chlorella variabilis
gb|KJB29387.1|  hypothetical protein B456_005G097800                    326   9e-107   Gossypium raimondii
emb|CDY25017.1|  BnaC02g39910D                                          325   1e-106   Brassica napus [oilseed rape]
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     325   1e-106   
emb|CAD26888.1|  alpha-tubulin                                          326   1e-106   Miscanthus transmorrisonensis
emb|CDP02221.1|  unnamed protein product                                325   1e-106   Coffea canephora [robusta coffee]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             325   1e-106   Populus trichocarpa [western balsam poplar]
dbj|BAJ06365.1|  alpha-tubulin                                          325   1e-106   Alopecurus aequalis
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        326   1e-106   Brassica rapa
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    325   1e-106   
emb|CDP14299.1|  unnamed protein product                                325   1e-106   Coffea canephora [robusta coffee]
gb|ABK92552.1|  unknown                                                 325   1e-106   Populus trichocarpa [western balsam poplar]
dbj|BAJ98211.1|  predicted protein                                      325   2e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   325   2e-106   Populus euphratica
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        325   2e-106   Tarenaya hassleriana [spider flower]
gb|AHJ80818.1|  Tua1                                                    320   2e-106   Eragrostis tef [tef]
emb|CAD24768.1|  alpha-tubulin                                          325   2e-106   Miscanthus floridulus
gb|AGG37287.1|  alpha-tubulin 5                                         325   2e-106   Salix arbutifolia
emb|CDY66630.1|  BnaCnng51680D                                          325   2e-106   Brassica napus [oilseed rape]
gb|ABD92939.1|  alpha tubulin-5D                                        325   2e-106   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92940.1|  alpha tubulin-5A                                        325   2e-106   Triticum aestivum [Canadian hard winter wheat]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                324   2e-106   Erythranthe guttata [common monkey flower]
ref|NP_849388.1|  tubulin alpha-6 chain                                 324   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002508010.1|  alpha tubulin 2                                    325   2e-106   Micromonas commoda
dbj|BAC24800.1|  alpha tubulin                                          325   2e-106   Physcomitrella patens
gb|KJB58757.1|  hypothetical protein B456_009G224800                    323   2e-106   Gossypium raimondii
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    325   2e-106   Arabis alpina [alpine rockcress]
ref|XP_002886753.1|  alpha-1 tubulin                                    325   2e-106   Arabidopsis lyrata subsp. lyrata
dbj|BAJ86161.1|  predicted protein                                      325   2e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002510010.1|  tubulin alpha chain, putative                      325   2e-106   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           325   2e-106   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         325   2e-106   Pseudotsuga menziesii var. menziesii
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             325   2e-106   Citrus clementina [clementine]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                325   2e-106   Fragaria vesca subsp. vesca
gb|AGG37285.1|  alpha-tubulin 3                                         325   2e-106   Salix arbutifolia
ref|XP_002522104.1|  tubulin alpha chain, putative                      325   2e-106   Ricinus communis
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        323   2e-106   
ref|XP_007018369.1|  Tubulin alpha-2 chain                              325   2e-106   Theobroma cacao [chocolate]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                325   2e-106   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                325   2e-106   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     325   2e-106   Carthamus tinctorius
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   325   2e-106   Fragaria vesca subsp. vesca
ref|XP_005651460.1|  tubulin alpha chain                                325   2e-106   Coccomyxa subellipsoidea C-169
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          325   3e-106   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                325   3e-106   Pyrus x bretschneideri [bai li]
ref|XP_006301274.1|  hypothetical protein CARUB_v10021674mg             325   3e-106   Capsella rubella
ref|XP_007042689.1|  Tubulin alpha-2 chain                              325   3e-106   Theobroma cacao [chocolate]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             325   3e-106   Prunus persica
ref|XP_002465633.1|  hypothetical protein SORBIDRAFT_01g042650          325   3e-106   Sorghum bicolor [broomcorn]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         325   3e-106   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           325   3e-106   Betula pendula [white birch]
ref|NP_171974.1|  tubulin alpha-4 chain                                 325   3e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             325   3e-106   Capsella rubella
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     325   3e-106   Eucalyptus grandis [rose gum]
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                325   3e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                325   3e-106   Elaeis guineensis
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             325   3e-106   Eutrema salsugineum [saltwater cress]
ref|XP_005643073.1|  tubulin alpha chain                                325   3e-106   Coccomyxa subellipsoidea C-169
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             324   3e-106   Selaginella moellendorffii
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          324   4e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     324   4e-106   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     324   4e-106   Pyrus x bretschneideri [bai li]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    324   4e-106   Brassica rapa
gb|AGG37283.1|  alpha-tubulin 1                                         324   4e-106   Salix arbutifolia
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                324   4e-106   Populus euphratica
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        323   4e-106   
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             324   4e-106   Selaginella moellendorffii
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     324   4e-106   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                324   4e-106   Cucumis sativus [cucumbers]
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     323   4e-106   
gb|ABQ59634.1|  alpha-tubulin 5                                         324   5e-106   Populus tremuloides
dbj|BAP59012.1|  alpha tubulin                                          324   5e-106   Taxus cuspidata [ichii]
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    324   5e-106   
gb|KHG18997.1|  Tubulin alpha chain                                     324   5e-106   Gossypium arboreum [tree cotton]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    324   5e-106   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             324   5e-106   Citrus clementina [clementine]
gb|AAO73546.1|  alpha-tubulin                                           324   5e-106   Ceratopteris richardii
ref|NP_001291325.1|  tubulin alpha chain-like                           324   5e-106   Sesamum indicum [beniseed]
gb|ABO47736.1|  alpha-tubulin                                           324   5e-106   Gossypium hirsutum [American cotton]
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    324   5e-106   Tarenaya hassleriana [spider flower]
ref|WP_039310890.1|  hypothetical protein                               324   5e-106   
gb|ABE01246.1|  alpha tubulin                                           324   5e-106   Camellia sinensis [black tea]
gb|EKF30131.1|  epsilon tubulin, putative                               315   6e-106   Trypanosoma cruzi marinkellei
ref|XP_010093625.1|  Tubulin alpha chain                                324   6e-106   Morus notabilis
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              324   6e-106   Camelina sativa [gold-of-pleasure]
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          324   6e-106   
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     323   7e-106   
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              323   7e-106   Malus domestica [apple tree]
gb|ABO47740.1|  alpha-tubulin                                           323   7e-106   Gossypium hirsutum [American cotton]
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     323   7e-106   Helicosporidium sp. ATCC 50920
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          323   7e-106   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           323   7e-106   Naegleria pringsheimi
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              323   7e-106   
emb|CCC46467.1|  putative alpha tubulin, fragment                       317   7e-106   Trypanosoma vivax Y486
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     323   7e-106   Sesamum indicum [beniseed]
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        324   8e-106   
prf||1503274A  alpha1 tubulin                                           323   8e-106
gb|AFV46219.1|  hypothetical protein                                    323   9e-106   Scutellaria baicalensis [Baikal skullcap]
gb|ABK92520.1|  unknown                                                 323   9e-106   Populus trichocarpa [western balsam poplar]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 323   9e-106   Populus trichocarpa [western balsam poplar]
ref|NP_176654.1|  tubulin alpha-1 chain                                 323   9e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   323   9e-106   Vitis vinifera
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              323   1e-105   Nicotiana tomentosiformis
emb|CAD13176.1|  alpha-tubulin                                          323   1e-105   Nicotiana tabacum [American tobacco]
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             323   1e-105   
gb|ABB02631.1|  unknown                                                 323   1e-105   Solanum tuberosum [potatoes]
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              323   1e-105   
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              323   1e-105   
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     323   1e-105   Nelumbo nucifera [Indian lotus]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     323   1e-105   Nicotiana sylvestris
gb|AIX10966.1|  tubulin                                                 323   1e-105   Ornithogalum longebracteatum [sea-onion]
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     323   1e-105   Nicotiana tomentosiformis
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             323   1e-105   Selaginella moellendorffii
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                323   1e-105   Solanum tuberosum [potatoes]
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     323   1e-105   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     323   1e-105   
gb|ACN40181.1|  unknown                                                 323   1e-105   
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     323   1e-105   
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              323   1e-105   
ref|XP_010104543.1|  Tubulin alpha chain                                323   1e-105   
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             323   1e-105   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   323   1e-105   
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        323   1e-105   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              323   1e-105   
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        323   1e-105   
gb|AAO23139.1|  alpha tubulin                                           323   1e-105   
gb|ADW66593.1|  alpha tubulin                                           320   1e-105   
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    323   1e-105   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     323   1e-105   
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              323   1e-105   
gb|ABQ59633.1|  alpha-tubulin 3                                         323   1e-105   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   323   1e-105   
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          323   1e-105   
ref|XP_001764722.1|  predicted protein                                  323   1e-105   
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    323   1e-105   
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              323   1e-105   
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    323   1e-105   
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    322   1e-105   
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                323   1e-105   
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          323   1e-105   
ref|XP_003558477.1|  PREDICTED: tubulin alpha-2 chain                   323   1e-105   
gb|ABO47739.1|  alpha-tubulin                                           323   1e-105   
sp|O22348.1|TBA2_ELEIN  RecName: Full=Tubulin alpha-2 chain; AltN...    323   2e-105   
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                323   2e-105   
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     323   2e-105   
sp|P10872.1|TBA_TETPY  RecName: Full=Tubulin alpha chain                323   2e-105   
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     323   2e-105   
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                323   2e-105   
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   323   2e-105   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    323   2e-105   
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                323   2e-105   
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   323   2e-105   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              323   2e-105   
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   323   2e-105   
gb|AIA82437.1|  alpha-tubulin-like protein 06                           319   2e-105   
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              323   2e-105   
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    323   2e-105   
ref|NP_193232.1|  tubulin alpha-6 chain                                 323   2e-105   
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              323   2e-105   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        322   2e-105   
ref|XP_001022424.1|  Tubulin/FtsZ family, GTPase domain containin...    322   2e-105   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             322   2e-105   
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             322   2e-105   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             322   2e-105   
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             322   2e-105   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              322   2e-105   
gb|EKF98903.1|  epsilon tubulin, putative                               315   2e-105   
ref|XP_003058621.1|  alpha tubulin                                      322   2e-105   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           322   2e-105   
ref|XP_010096739.1|  Tubulin alpha chain                                322   2e-105   
gb|KHN01709.1|  Tubulin alpha chain                                     322   2e-105   
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              322   2e-105   
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    322   2e-105   
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     322   3e-105   
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    322   3e-105   
emb|CAD24767.1|  alpha-tubulin                                          322   3e-105   
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             322   3e-105   
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         322   3e-105   
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     322   3e-105   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             322   4e-105   
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    321   4e-105   
gb|AGV54497.1|  tubulin alpha-3 chain-like protein                      322   4e-105   
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                322   4e-105   
emb|CAB66336.1|  alpha-tubulin                                          322   4e-105   
ref|XP_004034900.1|  hypothetical protein IMG5_110300                   322   4e-105   
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    322   4e-105   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     322   5e-105   
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                322   5e-105   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                322   5e-105   
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                322   5e-105   
gb|ACU19580.1|  unknown                                                 322   5e-105   
ref|XP_008347837.1|  PREDICTED: tubulin alpha-4 chain isoform X2        322   5e-105   
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                322   5e-105   
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                322   5e-105   
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             321   5e-105   
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                321   5e-105   
emb|CCC46464.1|  putative alpha tubulin                                 317   5e-105   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             321   6e-105   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                321   6e-105   
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                321   6e-105   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        321   6e-105   
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              321   6e-105   
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          321   6e-105   
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             321   6e-105   
emb|CDP12358.1|  unnamed protein product                                321   7e-105   
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                321   7e-105   
ref|XP_003603670.1|  Tubulin alpha-7 chain                              321   7e-105   
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    322   7e-105   
ref|XP_010496499.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    320   8e-105   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  321   8e-105   
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             321   8e-105   
emb|CAA67848.1|  alpha-tubulin                                          321   8e-105   
ref|XP_002517492.1|  tubulin alpha chain, putative                      321   8e-105   
gb|ACH68563.1|  alpha-tubulin                                           321   8e-105   
ref|XP_001460309.1|  hypothetical protein                               320   8e-105   
ref|XP_001454509.1|  hypothetical protein                               321   9e-105   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   321   9e-105   
gb|ESL08706.1|  alpha tubulin                                           316   9e-105   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               321   9e-105   
ref|XP_001419217.1|  predicted protein                                  321   9e-105   
ref|XP_007032501.1|  Tubulin alpha-2 chain                              321   1e-104   
ref|XP_003608582.1|  Tubulin alpha-5 chain                              321   1e-104   
ref|NP_001067613.1|  Os11g0247300                                       320   1e-104   
dbj|BAJ97454.1|  predicted protein                                      318   1e-104   
emb|CAI38956.1|  alpha_tubulin,putative                                 320   1e-104   
emb|CDP00974.1|  unnamed protein product                                320   1e-104   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   321   1e-104   
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             320   1e-104   
gb|KEH43997.1|  tubulin beta-1 chain                                    320   1e-104   
dbj|BAB19779.1|  alpha tubulin                                          320   1e-104   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 320   2e-104   
gb|KIZ03400.1|  Tubulin alpha chain                                     320   2e-104   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                320   2e-104   
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          320   2e-104   
gb|AGE09583.1|  TUA1-like protein                                       319   2e-104   
gb|EKG00415.1|  epsilon tubulin, putative                               318   2e-104   
emb|CCD12221.1|  unnamed protein product                                317   2e-104   
emb|CDO97305.1|  unnamed protein product                                320   2e-104   
dbj|BAJ06362.1|  alpha-tubulin                                          320   2e-104   
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   320   2e-104   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              320   2e-104   
gb|ABV55999.1|  alpha-tubulin 7                                         320   2e-104   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           320   2e-104   
ref|NP_001289660.1|  tubulin alpha chain-like                           320   2e-104   
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    320   3e-104   
sp|P09205.1|TBA2_CHLRE  RecName: Full=Tubulin alpha-2 chain             320   3e-104   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              320   3e-104   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   320   3e-104   
gb|AIX10773.1|  alpha tubulin                                           320   3e-104   
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    318   3e-104   
gb|EMT20847.1|  Tubulin alpha-2 chain                                   319   3e-104   
gb|ACY05960.1|  alpha-tubulin                                           317   3e-104   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             320   3e-104   
gb|ABD92930.1|  alpha tubulin-2A                                        320   3e-104   
gb|EPY40566.1|  tubulin alpha                                           316   3e-104   
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             319   3e-104   
gb|EPY32753.1|  tubulin alpha                                           313   3e-104   
gb|AHJ80822.1|  Tua1                                                    319   3e-104   
ref|NP_001167663.1|  tubulin alpha-3 chain                              319   3e-104   
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    319   3e-104   
gb|AFC88832.1|  putative tubulin alpha-3 chain                          319   3e-104   
emb|CAA06619.1|  alpha-tubulin 1                                        319   3e-104   
ref|XP_002951007.1|  alpha tubulin                                      319   3e-104   
ref|XP_001691876.1|  alpha tubulin 1                                    319   3e-104   
emb|CDW82295.1|  alpha tubulin                                          319   4e-104   
gb|AEW46684.1|  beta-tubulin                                            319   4e-104   
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              319   4e-104   
gb|AHJ80815.1|  Tua1                                                    319   4e-104   
gb|AGG37289.1|  alpha-tubulin 7                                         319   4e-104   
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     319   4e-104   
gb|AHJ80817.1|  Tua1                                                    319   4e-104   
gb|ACH70610.1|  alpha tubulin                                           319   5e-104   
ref|XP_006649647.1|  PREDICTED: tubulin alpha-2 chain-like              319   5e-104   
gb|AHJ80816.1|  Tua1                                                    319   5e-104   
gb|EPY25298.1|  tubulin alpha                                           316   6e-104   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              319   6e-104   
gb|EJY81124.1|  Alpha tubulin,putative                                  318   6e-104   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             318   6e-104   
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                318   6e-104   
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             318   6e-104   
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              318   7e-104   
gb|ABO47742.1|  alpha-tubulin                                           318   7e-104   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                318   7e-104   
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              318   7e-104   
ref|XP_001455356.1|  hypothetical protein                               318   8e-104   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              318   8e-104   
gb|ABF98643.1|  Tubulin alpha-1 chain, putative, expressed              318   9e-104   
ref|XP_010496498.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    318   9e-104   
ref|NP_001051132.1|  Os03g0726100                                       318   1e-103   
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                318   1e-103   
gb|KHN42598.1|  Tubulin alpha-2 chain                                   318   1e-103   
emb|CAA62917.1|  alfa-tubulin                                           318   1e-103   
ref|NP_001049400.1|  Os03g0219300                                       318   1e-103   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  318   1e-103   
gb|ETL46639.1|  tubulin alpha chain                                     309   1e-103   
gb|ETL46656.1|  tubulin alpha chain                                     309   1e-103   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             318   1e-103   
gb|AAX63396.1|  alpha-tubulin                                           317   1e-103   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             318   1e-103   
ref|XP_001770881.1|  predicted protein                                  318   1e-103   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   318   1e-103   
gb|ABP65320.1|  alpha tubulin                                           318   2e-103   
gb|ETK93224.1|  tubulin alpha-2 chain                                   308   2e-103   
gb|AAA99441.1|  alpha-tubulin                                           317   2e-103   
ref|XP_001420620.1|  predicted protein                                  317   2e-103   
gb|ETK93242.1|  tubulin alpha chain                                     308   2e-103   
gb|ABG78593.1|  alpha-tubulin                                           317   2e-103   
emb|CCC46465.1|  putative alpha tubulin                                 317   2e-103   
ref|XP_001218934.1|  alpha tubulin                                      317   2e-103   
gb|EPY36663.1|  tubulin alpha                                           317   3e-103   
sp|Q27352.1|TBA_TRYCR  RecName: Full=Tubulin alpha chain                317   3e-103   
ref|XP_802499.1|  alpha tubulin                                         317   3e-103   
ref|XP_001315391.1|  alpha-tubulin 1                                    310   3e-103   
gb|ABA00480.1|  alpha-tubulin                                           317   3e-103   
gb|AAB84298.1|  tubulin                                                 317   3e-103   
gb|AAB86649.1|  alpha-tubulin                                           317   3e-103   
ref|XP_673091.1|  hypothetical protein                                  310   3e-103   
ref|XP_002781275.1|  Tubulin alpha chain, putative                      310   4e-103   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             317   4e-103   
ref|XP_002785264.1|  Tubulin alpha chain, putative                      308   4e-103   
gb|AGN32931.1|  alpha tubulin                                           317   4e-103   
gb|ACI15922.1|  alpha-tubulin                                           317   4e-103   
gb|ABC59068.2|  alpha tubulin 1                                         317   4e-103   
ref|XP_674476.1|  hypothetical protein                                  308   4e-103   
gb|AFC88824.1|  putative tubulin alpha-3 chain                          316   5e-103   
ref|XP_002466376.1|  hypothetical protein SORBIDRAFT_01g006650          316   5e-103   
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              317   5e-103   
ref|NP_001105440.1|  tubulin alpha-3 chain                              316   5e-103   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                316   5e-103   
ref|XP_010414865.1|  PREDICTED: tubulin alpha-1 chain                   316   5e-103   
gb|AAB86648.1|  alpha-tubulin                                           316   6e-103   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             316   7e-103   
ref|XP_008606530.1|  tubulin alpha                                      311   7e-103   
ref|XP_009313070.1|  putative alpha tubulin                             316   8e-103   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                315   1e-102   



>gb|KJB83376.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=271

 Score =   336 bits (861),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVA+DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010531152.1| PREDICTED: tubulin alpha-3 chain [Tarenaya hassleriana]
Length=449

 Score =   342 bits (877),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 180/184 (98%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CBI16534.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   341 bits (874),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGV HDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVGHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010535935.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Tarenaya hassleriana]
Length=450

 Score =   342 bits (876),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009126389.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   342 bits (876),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006286664.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
 ref|XP_010493056.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010493058.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 gb|EOA19562.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
Length=450

 Score =   341 bits (875),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009126388.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|NP_197478.1| tubulin alpha-3 [Arabidopsis thaliana]
 ref|NP_197479.1| tubulin alpha-5 [Arabidopsis thaliana]
 ref|XP_002871906.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873963.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006400538.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 ref|XP_006400540.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 ref|XP_010420793.1| PREDICTED: tubulin alpha-3 chain [Camelina sativa]
 sp|Q56WH1.2|TBA3_ARATH RecName: Full=Tubulin alpha-3 chain [Arabidopsis thaliana]
 sp|B9DHQ0.2|TBA5_ARATH RecName: Full=Tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAK32888.1|AF367301_1 AT5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAA32888.1| alpha-tubulin [Arabidopsis thaliana]
 gb|AAA32891.1| alpha-5 tubulin [Arabidopsis thaliana]
 gb|AAK64169.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAL38340.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85097.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31860.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31861.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN28834.1| At5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAN65084.1| unknown protein [Arabidopsis thaliana]
 gb|EFH48165.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50222.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AED92747.1| tubulin alpha-3 [Arabidopsis thaliana]
 gb|AED92748.1| tubulin alpha-5 [Arabidopsis thaliana]
 gb|ESQ41991.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 gb|ESQ41993.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 gb|KFK26213.1| tubulin alpha-3 alpha-5 chain [Arabis alpina]
 gb|KFK26214.1| hypothetical protein AALP_AA8G217400 [Arabis alpina]
Length=450

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010454260.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010454262.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=450

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009126391.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CDY42294.1| BnaC02g09000D [Brassica napus]
 emb|CDY42295.1| BnaC02g09010D [Brassica napus]
Length=450

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CDY44941.1| BnaA02g04460D [Brassica napus]
 emb|CDY44942.1| BnaA02g04470D [Brassica napus]
Length=450

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009120857.1| PREDICTED: tubulin alpha-3 chain [Brassica rapa]
 emb|CDX92501.1| BnaA10g15400D [Brassica napus]
 emb|CDX92502.1| BnaA10g15410D [Brassica napus]
Length=450

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006286795.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
 gb|EOA19693.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
Length=450

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_004504311.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=449

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_003629736.1| Alpha-tubulin [Medicago truncatula]
 gb|AET04212.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CDX88875.1| BnaA03g07740D [Brassica napus]
 emb|CDX70890.1| BnaC03g09740D [Brassica napus]
Length=450

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 178/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009131752.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 178/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010535933.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Tarenaya hassleriana]
Length=449

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 179/184 (97%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006584595.1| PREDICTED: uncharacterized protein LOC100806907 isoform X1 [Glycine 
max]
Length=423

 Score =   339 bits (869),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 178/184 (97%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSS GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010923361.1| PREDICTED: tubulin alpha-3 chain [Elaeis guineensis]
Length=450

 Score =   340 bits (872),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 178/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KJB83377.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=346

 Score =   336 bits (862),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVA+DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|EYU31677.1| hypothetical protein MIMGU_mgv1a006281mg [Erythranthe guttata]
Length=449

 Score =   339 bits (870),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 178/184 (97%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGVMPSDNSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006858944.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
 gb|ERN20411.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
Length=449

 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+S+GVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDNSIGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002285721.1| PREDICTED: tubulin alpha-3 chain [Vitis vinifera]
Length=449

 Score =   338 bits (868),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGV HDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVGHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008804327.1| PREDICTED: tubulin alpha-1 chain-like [Phoenix dactylifera]
Length=450

 Score =   338 bits (868),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVG+AHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGIAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDE+R G YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEIRAGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KDP42087.1| hypothetical protein JCGZ_01875 [Jatropha curcas]
Length=450

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 178/184 (97%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_011089722.1| PREDICTED: tubulin alpha-3 chain [Sesamum indicum]
Length=449

 Score =   338 bits (866),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008240534.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Prunus mume]
Length=424

 Score =   337 bits (863),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG AHDAFNTFFSETG+G 
Sbjct  1    MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGN  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AGG37284.1| alpha-tubulin 2 [Salix arbutifolia]
Length=450

 Score =   338 bits (866),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+F+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008449886.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Cucumis melo]
Length=435

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002532068.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF30323.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   337 bits (865),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGV HDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVGHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002303998.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|EEE78977.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   337 bits (865),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+F+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>dbj|BAM28754.1| tubulin [Brassica rapa subsp. chinensis]
Length=377

 Score =   335 bits (858),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVG SCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGFSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDL LD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLGLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|NP_001237301.1| tubulin A [Glycine max]
 gb|AAX86047.1| tubulin A [Glycine max]
Length=450

 Score =   337 bits (865),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDS+ GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSTFGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010934670.1| PREDICTED: tubulin alpha-3 chain-like [Elaeis guineensis]
Length=450

 Score =   337 bits (864),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDGMMPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010257632.1| PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera]
Length=449

 Score =   337 bits (864),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006579487.1| PREDICTED: tubulin A isoform X1 [Glycine max]
Length=449

 Score =   337 bits (864),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDS+ GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSTFGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010112637.1| Tubulin alpha-3 chain [Morus notabilis]
 gb|EXC34492.1| Tubulin alpha-3 chain [Morus notabilis]
Length=449

 Score =   337 bits (863),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGV+HDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVSHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AGD80034.1| alpha-tubulin 1 [Hevea brasiliensis]
Length=449

 Score =   337 bits (863),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDGMMPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_004149645.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 ref|XP_004164931.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN54025.1| hypothetical protein Csa_4G268090 [Cucumis sativus]
Length=449

 Score =   336 bits (862),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_007159433.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
 gb|ESW31427.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
Length=449

 Score =   336 bits (862),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSS GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVR G YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|NP_001275086.1| uncharacterized LOC102577521 [Solanum tuberosum]
 gb|ABC01891.1| tubulin alpha-5 chain-like protein [Solanum tuberosum]
Length=449

 Score =   336 bits (862),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S G AHDAFNTFFSETGAGK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSPGAAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_004170946.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-3 chain-like [Cucumis 
sativus]
Length=447

 Score =   336 bits (862),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGF+IYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFSIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008464962.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis melo]
Length=449

 Score =   336 bits (862),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGF+IYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFSIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_004141134.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN59749.1| Tubulin alpha-3 chain [Cucumis sativus]
Length=449

 Score =   336 bits (862),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGF+IYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFSIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008449885.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Cucumis melo]
Length=449

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|EYU23006.1| hypothetical protein MIMGU_mgv1a006283mg [Erythranthe guttata]
Length=449

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++ GV HDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTFGVGHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AHZ58482.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=261

 Score =   329 bits (844),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD+S G   DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDASTGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AAO63773.2| alpha-tubulin 2 [Populus tremuloides]
Length=450

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 184/184 (100%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIRPDGVMPSDASVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+F+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010673470.1| PREDICTED: tubulin alpha-3 chain [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD++VGV HDAFNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDNTVGVGHDAFNTFFSETSAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006657877.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=450

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KHG19627.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VG  HDAFNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGACHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KJB80786.1| hypothetical protein B456_013G115100 [Gossypium raimondii]
Length=449

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VG  HDAFNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGACHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009406530.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVAQDAFNTFFSETSAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KJB83375.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=449

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVA+DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006488931.1| PREDICTED: tubulin alpha-1 chain-like isoform X2 [Citrus sinensis]
Length=428

 Score =   335 bits (858),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDGMMPSD+++GVAHDAFNTFFSET AG+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDNTIGVAHDAFNTFFSETSAGR  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKL+DNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|EPS70933.1| tubulin alpha-6 chain, partial [Genlisea aurea]
Length=269

 Score =   329 bits (843),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG+MPSD+SVG AHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGLMPSDTSVGAAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVD CLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDQCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KHG06160.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVA+DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AIC33057.1| tubulin alpha-1 chain [Panax ginseng]
Length=449

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDNTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+F+DLEPTVIDE+RTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEIRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|NP_001242878.1| uncharacterized protein LOC100806907 [Glycine max]
 gb|ACU18050.1| unknown [Glycine max]
Length=450

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCW LYCLEHGIQPDGMMPSDSS GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWGLYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009408459.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   335 bits (859),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDSSVG+A DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDSSVGMACDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010276368.1| PREDICTED: tubulin alpha-3 chain-like [Nelumbo nucifera]
Length=450

 Score =   335 bits (858),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 177/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVAHDAFNTFFSETG GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGTGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLE TVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLESTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008813089.1| PREDICTED: tubulin alpha-3 chain [Phoenix dactylifera]
Length=450

 Score =   334 bits (857),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG MPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGTMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+F+DLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009375870.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   334 bits (857),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD++VG AHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGSAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|NP_001105588.1| tubulin alpha-6 chain [Zea mays]
 sp|P33627.1|TBA6_MAIZE RecName: Full=Tubulin alpha-6 chain; AltName: Full=Alpha-6-tubulin 
[Zea mays]
 emb|CAA44863.1| alpha-tubulin #6 [Zea mays]
 gb|ACN35801.1| unknown [Zea mays]
 gb|AFE82989.1| tubulin alpha-5 [Saccharum hybrid cultivar]
 tpg|DAA63282.1| TPA: alpha tubulin6 [Zea mays]
Length=450

 Score =   334 bits (857),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAD26886.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   334 bits (857),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAD24766.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   334 bits (857),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009413318.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   334 bits (857),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDSSVGVA DAFNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDSSVGVATDAFNTFFSETSAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|NP_001060075.1| Os07g0574800 [Oryza sativa Japonica Group]
 sp|P28752.1|TBA1_ORYSJ RecName: Full=Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 emb|CAA77988.1| alpha 1 tubulin [Oryza sativa Japonica Group]
 emb|CAA62918.1| alfa-tubulin [Oryza sativa Japonica Group]
 dbj|BAC83168.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 dbj|BAD30236.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 gb|ABG78594.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF21989.1| Os07g0574800 [Oryza sativa Japonica Group]
 gb|EAZ04436.1| hypothetical protein OsI_26583 [Oryza sativa Indica Group]
 gb|EAZ40391.1| hypothetical protein OsJ_24840 [Oryza sativa Japonica Group]
 dbj|BAG90561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91280.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17548.1| alpha tubulin [Oryza sativa]
Length=450

 Score =   334 bits (857),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_007204346.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
 gb|EMJ05545.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
Length=449

 Score =   334 bits (857),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG AHDAFNTFFSETG+G 
Sbjct  1    MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGN  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008240533.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Prunus mume]
Length=449

 Score =   334 bits (857),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG AHDAFNTFFSETG+G 
Sbjct  1    MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGN  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_011025144.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=450

 Score =   334 bits (857),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVG AHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGGAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+F+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008223650.1| PREDICTED: tubulin alpha-3 chain-like [Prunus mume]
Length=450

 Score =   334 bits (856),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGV  DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDASVGVGRDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009400845.1| PREDICTED: tubulin alpha-3 chain [Musa acuminata subsp. malaccensis]
Length=450

 Score =   334 bits (856),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVASDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>sp|O22349.1|TBA3_ELEIN RecName: Full=Tubulin alpha-3 chain; AltName: Full=Alpha-3-tubulin 
[Eleusine indica]
 gb|AAC05719.1| alpha-tubulin 3 [Eleusine indica]
Length=450

 Score =   334 bits (856),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAD24765.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   334 bits (856),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREFISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKE+AANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKENAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010044940.1| PREDICTED: tubulin alpha-3 chain [Eucalyptus grandis]
 gb|KCW87066.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=449

 Score =   334 bits (856),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGM+PSD++VGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMLPSDATVGVAADAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+F+DLEPTVIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AGY80453.1| tubulin [Dendrocalamus latiflorus]
Length=450

 Score =   333 bits (855),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVD CLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDQCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_003562846.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=450

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MPSDS+VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDSTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S+G  HD+FNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSIGTEHDSFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTI+PSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ACN40824.1| unknown [Picea sitchensis]
Length=449

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGV  DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAV VDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVIVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_007205189.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
 gb|EMJ06388.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
Length=450

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGV  DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDASVGVGRDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CDP17586.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI  DGMMPSD++VG+AHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHADGMMPSDTTVGIAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+F+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006445597.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 ref|XP_006488930.1| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Citrus sinensis]
 gb|ESR58837.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 gb|KDO54446.1| hypothetical protein CISIN_1g013113mg [Citrus sinensis]
Length=449

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDGMMPSD+++GVAHDAFNTFFSET AG+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDNTIGVAHDAFNTFFSETSAGR  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKL+DNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_007014666.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY32285.1| Tubulin alpha-5 [Theobroma cacao]
Length=449

 Score =   333 bits (853),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEH I PDGMMPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIHPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KDO55010.1| hypothetical protein CISIN_1g0157541mg, partial [Citrus sinensis]
Length=353

 Score =   329 bits (844),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG MPSD+SVG  HDAFNTFFSETG+G+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGTMPSDTSVGACHDAFNTFFSETGSGQ  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEP+VIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPSVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AGV54500.1| tubulin A [Phaseolus vulgaris]
Length=449

 Score =   332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 176/184 (96%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSS GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVR G YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            V EP
Sbjct  181  VGEP  184



>ref|XP_011461685.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Fragaria vesca subsp. 
vesca]
Length=411

 Score =   331 bits (848),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+++GV  DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDNTIGVGRDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABD92943.1| alpha tubulin-1B [Triticum aestivum]
Length=450

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABD92942.1| alpha tubulin-1D [Triticum aestivum]
 gb|ABD92944.1| alpha tubulin-1A [Triticum aestivum]
 gb|EMS54563.1| Tubulin alpha-1 chain [Triticum urartu]
 gb|EMT26472.1| Tubulin alpha-1 chain [Aegilops tauschii]
Length=450

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009389058.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVACDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAD26891.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   332 bits (851),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAF+TFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFSTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010054663.1| PREDICTED: tubulin alpha-3 chain-like [Eucalyptus grandis]
 gb|KCW89881.1| hypothetical protein EUGRSUZ_A02108 [Eucalyptus grandis]
Length=450

 Score =   332 bits (850),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAGIQVGNSCWELYCLEH I PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVG+EIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTVGREIVNLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLE+LSVEYGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLEQLSVEYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|NP_001105324.1| tubulin alpha-5 chain [Zea mays]
 sp|Q02245.1|TBA5_MAIZE RecName: Full=Tubulin alpha-5 chain; AltName: Full=Alpha-5-tubulin 
[Zea mays]
 emb|CAA44862.1| alpha-tubulin #5 [Zea mays]
 gb|AAA33437.1| alpha-tubulin [Zea mays]
 gb|AAA16225.1| alpha-tubulin [Zea mays]
 emb|CAD20822.1| alpha tubulin [Zea mays]
 tpg|DAA41190.1| TPA: alpha tubulin5 [Zea mays]
Length=450

 Score =   331 bits (849),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+ DG MPSDSSVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEHDGTMPSDSSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|EYU34086.1| hypothetical protein MIMGU_mgv1a0196711mg, partial [Erythranthe 
guttata]
Length=199

 Score =   322 bits (826),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MP D++VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_004958110.1| PREDICTED: tubulin alpha-3 chain-like [Setaria italica]
Length=450

 Score =   331 bits (849),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+ DG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEADGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006443441.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
 ref|XP_006479124.1| PREDICTED: tubulin alpha-3 chain-like [Citrus sinensis]
 gb|ESR56681.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
Length=449

 Score =   331 bits (849),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVG  HDAFNTFFSETG+G+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGACHDAFNTFFSETGSGQ  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEP+VIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPSVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABE66388.1| alpha-tubulin [Striga asiatica]
Length=206

 Score =   322 bits (826),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD++VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSP VSTA
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPHVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>dbj|BAJ06363.1| alpha-tubulin [Alopecurus aequalis]
Length=450

 Score =   331 bits (848),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AGG37286.1| alpha-tubulin 4 [Salix arbutifolia]
Length=450

 Score =   331 bits (848),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEH IQPDGMMPSD+SVG AHDAFNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSVGAAHDAFNTFFSETSSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQL+SGKEDAANNFARGHYTVGKEIVDLC+D
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCVD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_011048194.1| PREDICTED: tubulin alpha-6 chain-like [Populus euphratica]
Length=450

 Score =   331 bits (848),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEH IQPDGMMPSD+S G AHDAFNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSPGAAHDAFNTFFSETSSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQL+SGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002325422.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE99803.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   331 bits (848),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+S+G  HD+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGAEHDSFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEP+VIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABV55994.1| alpha-tubulin 6 [Populus tremuloides]
Length=449

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGV HD+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEP+VIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIV+LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AGG37290.1| alpha-tubulin 8 [Salix arbutifolia]
Length=449

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+S+G  HD+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGAEHDSFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEP+VIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008351479.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
Length=449

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD++VG  HDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGGGHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_011021469.1| PREDICTED: tubulin alpha-3 chain-like [Populus euphratica]
Length=449

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+S+GV HD+FNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGVEHDSFNTFFSETRAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEP+VIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAD26893.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVG AHDAFNTFFSETG+G+
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAD26887.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVG AHDAFNTFFSETG+G+
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>sp|Q43473.1|TBA1_HORVU RecName: Full=Tubulin alpha-1 chain [Hordeum vulgare]
 emb|CAA67942.1| alpha-tubulin 1 [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI  DG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGINQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_004295008.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+++GV  DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDNTIGVGRDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009622332.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009766182.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
Length=449

 Score =   330 bits (846),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEH I PDGMMPSD+S GV HDAFNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHDIHPDGMMPSDNSPGVGHDAFNTFFSETSAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAB77671.1| alpha-tubulin [Miscanthus sinensis f. glaber]
Length=450

 Score =   330 bits (846),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVA DAFNTFFSETG+GK
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVADDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABO47741.1| alpha-tubulin [Gossypium hirsutum]
Length=449

 Score =   329 bits (844),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGNSCWELYCLEH I PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGF+VF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   323 bits (829),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   325 bits (832),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABO47735.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG06862.1| Tubulin alpha-6 chain [Gossypium arboreum]
 gb|KJB66054.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
 gb|KJB66055.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
Length=449

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGNSCWELYCLEH I PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGF+VF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAB77672.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   329 bits (843),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVG AHDAFNTFFSETG+G+
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGLYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFL F+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLAFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|EYU20672.1| hypothetical protein MIMGU_mgv1a004180mg [Erythranthe guttata]
Length=540

 Score =   332 bits (850),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 190/200 (95%), Gaps = 1/200 (1%)
 Frame = +3

Query  6    KTNKDSTLKER-ERERMREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGV  182
            K+N +     R E + MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVG+
Sbjct  76   KSNSEKRRINRFELKVMREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGI  135

Query  183  AHDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFA  362
            A+D+FNTFFSET AGKHVPRA+F+DLEPTV+DEVRTG+YRQLFHPEQLISGKEDAANNFA
Sbjct  136  ANDSFNTFFSETSAGKHVPRAIFLDLEPTVVDEVRTGSYRQLFHPEQLISGKEDAANNFA  195

Query  363  RGHYTVGKEIVDLCLDRVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKK  542
            RGHYTVGK+IVDLCLDRVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVEYGKK
Sbjct  196  RGHYTVGKDIVDLCLDRVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVEYGKK  255

Query  543  SKLGFTIYPSPQVSTAVVEP  602
            SKLGFTIYPSPQVSTAVVEP
Sbjct  256  SKLGFTIYPSPQVSTAVVEP  275



>ref|XP_011034391.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=449

 Score =   329 bits (843),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGV HD+FNTFFSETG GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGLGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEP+VIDEVRTGTYRQLFHPEQL+SGKEDAANNFARGHYTVG+EIV+LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGREIVELCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_003624633.1| Alpha-tubulin [Medicago truncatula]
 gb|ABK28851.1| alpha-tubulin [Medicago truncatula]
 gb|ABN08980.1| Tubulin/FtsZ, C-terminal [Medicago truncatula]
 gb|AES80851.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   329 bits (843),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD++ GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTTPGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVG+EIV+LCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGF VF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFFVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_003554022.1| PREDICTED: tubulin alpha-6 chain-like [Glycine max]
 gb|KHN34688.1| Tubulin alpha-3 chain [Glycine soja]
Length=451

 Score =   329 bits (843),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEP+VIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVG+EIV+LCLD
Sbjct  61   HVPRALFVDLEPSVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score =   320 bits (819),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVGYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAD26889.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=438

 Score =   328 bits (841),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQ GN+CWELYCLEHGI+PDG MPSD+SVG AHDAFNTFFSETG+G+
Sbjct  1    MREIISIHIGQAGIQGGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGLYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   328 bits (842),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD++VG   DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   328 bits (842),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG A D+FNTFFSETG+G 
Sbjct  1    MREIISLHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAATDSFNTFFSETGSGN  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGK+IVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLS++YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSLDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_011075054.1| PREDICTED: tubulin alpha-3 chain-like [Sesamum indicum]
Length=449

 Score =   328 bits (842),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVG  +D+FNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGTENDSFNTFFSETRAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG++I+DLCLD
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGRDIIDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAD26890.1| alpha-tubulin [Miscanthus sinensis subsp. condensatus]
Length=450

 Score =   328 bits (842),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCL HGI+PDG MPSD+SVG AHDAFNTFFSETG+G+
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLGHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGG GSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGAGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008349406.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_008366135.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_009339175.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   328 bits (842),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD++VG   DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGSGRDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002297631.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|ABK92439.1| unknown [Populus trichocarpa]
 gb|EEE82436.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEH IQPDGMMPSD+S G AHDAFNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSPGAAHDAFNTFFSETSSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQL+SGKEDAANNFARGHYTVGKEIVDLC+D
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCVD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   328 bits (841),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDG+M SD+S+G  HD+FNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMSSDTSIGSEHDSFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTI+PSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   328 bits (841),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD++VG   DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AAX21196.1| putative alpha-tubulin [Solanum betaceum]
Length=204

 Score =   319 bits (818),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MP D +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABO47738.1| alpha-tubulin [Gossypium hirsutum]
 gb|KJB40985.1| hypothetical protein B456_007G086400 [Gossypium raimondii]
Length=449

 Score =   328 bits (841),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGNSCWELYCLEH I PDG MPSD+S+GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSMGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGF+VF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 182/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGV HD+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEP+VIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIV+LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTI+PSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>sp|Q38771.1|TBA_AVESA RecName: Full=Tubulin alpha chain [Avena sativa]
 emb|CAA66075.1| alpha-tubulin [Avena sativa]
Length=447

 Score =   328 bits (840),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCL 
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLG  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVR+LADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRQLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = +3

Query  12   NKDSTLK-ERERERMREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAH  188
            NK S L  +   E+MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD++VG   
Sbjct  37   NKKSPLAGQSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGD  96

Query  189  DAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARG  368
            DAFNTFFSETG+GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARG
Sbjct  97   DAFNTFFSETGSGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARG  156

Query  369  HYTVGKEIVDLCLDRVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSK  548
            HYT+GKEIVDLCLDR+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSK
Sbjct  157  HYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSK  216

Query  549  LGFTIYPSPQVSTAVVEP  602
            LGFT+YPSPQVST+VVEP
Sbjct  217  LGFTVYPSPQVSTSVVEP  234



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   323 bits (827),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAD26892.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   327 bits (839),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAF+TFFSETG+GK
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFSTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGK DAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKADAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLG+TIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGYTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KHN46768.1| Tubulin alpha-3 chain [Glycine soja]
Length=443

 Score =   327 bits (838),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG MPSD+SVG+AHDAFNTFFSETG GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTSVGIAHDAFNTFFSETGFGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEP+VIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVG+EIV+LCLD
Sbjct  61   HVPRALFVDLEPSVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   326 bits (836),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   327 bits (838),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAGIQVGN+CWELYCLEHGIQPDGMMP D+SVG  HDAFNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGMMPGDTSVGACHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVR+G +RQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGAFRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTI+PSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAGIQVGN+CWELYCLEHGIQPDGMMP D+SVG  HDAFNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGMMPGDTSVGACHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVR+G +RQLFHPEQLISGKEDAANNFARGHYTVG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGAFRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTI+PSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AGG37288.1| alpha-tubulin 6 [Salix arbutifolia]
Length=449

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHG+QPDG MP D+SVG+ HD+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGMQPDGTMPGDTSVGMEHDSFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEP+VIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIV+LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_004985171.1| PREDICTED: tubulin alpha-2 chain-like [Setaria italica]
Length=448

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVARDAFNTFFSETSAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEV+TGTYRQLFHPEQLIS KEDAANNFARGHYTVG+E+VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVKTGTYRQLFHPEQLISHKEDAANNFARGHYTVGREVVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YG+KSKLGFTIYPSPQ+STA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   324 bits (831),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABB16994.1| unknown [Solanum tuberosum]
Length=467

 Score =   327 bits (838),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 173/184 (94%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+IS+HIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S G AHDAFNTFFSETGAGK
Sbjct  19   MREIISVHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSPGAAHDAFNTFFSETGAGK  78

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
             VPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  79   RVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  138

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
             VRKLA NCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  139  PVRKLAINCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  198

Query  591  VVEP  602
            VVEP
Sbjct  199  VVEP  202



>gb|AEG74028.1| alpha-tubulin [Pellia endiviifolia (species B)]
 gb|AEG74032.1| alpha-tubulin [Pellia endiviifolia (species B)]
Length=448

 Score =   326 bits (836),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 174/184 (95%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG M SD+SV V  DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMSSDTSVVVGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   326 bits (835),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   324 bits (830),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD + G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_007161955.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
 gb|ESW33949.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
Length=448

 Score =   326 bits (836),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG MPSD++VG+AHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTTVGIAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEP+VIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG+EIV+LCLD
Sbjct  61   HVPRALFVDLEPSVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   325 bits (832),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   324 bits (831),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   325 bits (833),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABR67425.1| alpha-tubulin 4 [Populus tremuloides]
Length=450

 Score =   326 bits (836),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEH IQPDGMMPSD+S G AHDAFNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSPGAAHDAFNTFFSETSSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLF+PEQL+SGKEDAANNFARGHYTVGKEIVDLC+D
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFYPEQLMSGKEDAANNFARGHYTVGKEIVDLCVD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KCW87065.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=458

 Score =   326 bits (836),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 183/193 (95%), Gaps = 9/193 (5%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGM+PSD++VGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMLPSDATVGVAADAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+F+DLEPTVIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSP-----  575
            RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSP     
Sbjct  121  RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQAVSN  180

Query  576  ----QVSTAVVEP  602
                QVSTAVVEP
Sbjct  181  FCHLQVSTAVVEP  193



>ref|XP_002675196.1| alpha-tubulin [Naegleria gruberi]
 ref|XP_002677003.1| alpha-tubulin TUBA2 [Naegleria gruberi]
 ref|XP_002680089.1| alpha-tubulin [Naegleria gruberi]
 sp|P11237.1|TBA1_NAEGR RecName: Full=Tubulin alpha-1/2/3 chain [Naegleria gruberi]
 emb|CAA31074.1| unnamed protein product [Naegleria gruberi]
 emb|CAA31075.1| unnamed protein product [Naegleria gruberi]
 emb|CAA31076.1| unnamed protein product [Naegleria gruberi]
 gb|EFC42452.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44259.1| alpha-tubulin TUBA2 [Naegleria gruberi]
 gb|EFC47345.1| alpha-tubulin [Naegleria gruberi]
Length=453

 Score =   326 bits (836),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAG+QVGN+CWELYCLEHGIQPDG+MPSD ++GV  DAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGVQVGNACWELYCLEHGIQPDGLMPSDKTIGVEDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVF+DLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVFS+VGGGTGSGLG+LLLERLSV+YGKKSKLGFT+YPSPQV+TA
Sbjct  121  RIRKLADNCTGLQGFLVFSSVGGGTGSGLGALLLERLSVDYGKKSKLGFTVYPSPQVATA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009366459.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   326 bits (835),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD+SVG   D+FNTFFSETG+G 
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDTSVGSETDSFNTFFSETGSGS  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>tpg|DAA51110.1| TPA: alpha-tubulin, partial [Zea mays]
 tpg|DAA51116.1| TPA: alpha-tubulin, partial [Zea mays]
Length=240

 Score =   318 bits (816),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MP D ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   326 bits (835),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD SVG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AFW89176.1| hypothetical protein ZEAMMB73_322393 [Zea mays]
Length=448

 Score =   326 bits (835),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVG+A DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGIARDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEV+TG YRQLFHPEQLIS KEDAANNFARGHYTVG+E++DLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVKTGAYRQLFHPEQLISHKEDAANNFARGHYTVGREVIDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YG+KSKLGFTIYPSPQ+STA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   326 bits (835),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   326 bits (835),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   326 bits (835),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPR VFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRCVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   326 bits (835),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   325 bits (832),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAD26888.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   326 bits (835),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQ GN+CWELYCLEH I+PDG MPSD+SVG AHDAFNTFFSETG+G+
Sbjct  1    MREIISIHIGQAGIQGGNACWELYCLEHSIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGLYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDHTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>dbj|BAJ06365.1| alpha-tubulin [Alopecurus aequalis]
Length=449

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETG GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDTSVGVAKDAFNTFFSETGTGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLIS KEDAANNFARGHYTVG+E+VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHKEDAANNFARGHYTVGREVVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFL+F+AVGGGTGSGLGSLLLERLSV+YG+KSKLGFTIYPSPQ+STA
Sbjct  121  RIRKLADNCTGLQGFLIFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   326 bits (835),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CDP14299.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI PDGMMPSD SVG+A+D+FNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIHPDGMMPSDKSVGIANDSFNTFFSETSAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA++VDLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG++I+DLCLD
Sbjct  61   HVPRAIYVDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGRDIIDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFL+F+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTI+PSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIFPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>dbj|BAJ98211.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIH+GQAGIQ+GN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MREVISIHVGQAGIQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   320 bits (819),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MP D ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CAD24768.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI+PDG  PSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTTPSDTSVGVAHDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADN TGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNRTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABD92939.1| alpha tubulin-5D [Triticum aestivum]
 gb|ABD92941.1| alpha tubulin-5B [Triticum aestivum]
Length=449

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLIS  EDAANNFARGHYTVG+E+VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YG+KSKLGFTIYPSPQ+STA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABD92940.1| alpha tubulin-5A [Triticum aestivum]
Length=449

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLIS  EDAANNFARGHYTVG+E+VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YG+KSKLGFTIYPSPQ+STA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGNSCWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MP D +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002508010.1| alpha tubulin 2 [Micromonas sp. RCC299]
 ref|XP_002506067.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO67325.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO69268.1| alpha tubulin 2 [Micromonas sp. RCC299]
Length=449

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAGIQ GN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQTGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGF+VF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD SVG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002886753.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63012.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSDS+VGV HDAFNTFFSET +G+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDSTVGVCHDAFNTFFSETSSGQ  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVD CL+
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDTCLE  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV++GKKSKLGFTIYPSPQVSTA
Sbjct  121  RLRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDFGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>dbj|BAJ86161.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88353.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLIS  EDAANNFARGHYTVG+E+VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YG+KSKLGFTIYPSPQ+STA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD++VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_005651460.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE26916.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006301274.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
 gb|EOA34172.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
Length=450

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSDS+VG  HDAFNTFFSET +G+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDSNVGACHDAFNTFFSETSSGQ  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EIVD CLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDTCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV++GKKSKLGFTIYPSPQVSTA
Sbjct  121  RLRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDFGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002465633.1| hypothetical protein SORBIDRAFT_01g042650 [Sorghum bicolor]
 gb|EER92631.1| hypothetical protein SORBIDRAFT_01g042650 [Sorghum bicolor]
Length=448

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 180/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDNSVGVARDAFNTFFSETSAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEV+TG YRQLFHPEQLIS KEDAANNFARGHYTVG+E+VDLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVKTGAYRQLFHPEQLISHKEDAANNFARGHYTVGREVVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YG+KSKLGFTIYPSPQ+STA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQISTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_005643073.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 sp|Q9ZRJ4.1|TBA_CHLVU RecName: Full=Tubulin alpha chain [Chlorella vulgaris]
 dbj|BAA03955.1| alpha-tubulin [Chlorella vulgaris]
 gb|EIE18529.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREVISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002989731.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
 ref|XP_002991763.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ07167.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ09208.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
Length=451

 Score =   324 bits (831),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MP+D +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPNDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   323 bits (829),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_008236966.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=427

 Score =   323 bits (829),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI PDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVF DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFADLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDICLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MP D +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDQTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF AVGGGTGSGLGSLLLERLSV+YGKKSKLGFTIYPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +3

Query  48   RMREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAG  227
            +MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAG
Sbjct  4    KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAG  63

Query  228  KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCL  407
            KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCL
Sbjct  64   KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  123

Query  408  DRVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVST  587
            DR+RKLADNCTGLQGFLVF AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQ+ST
Sbjct  124  DRIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQIST  183

Query  588  AVVEP  602
            +VVEP
Sbjct  184  SVVEP  188



>gb|ABE01246.1| alpha tubulin [Camellia sinensis]
Length=449

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MREV+SIHIGQAGIQVGNSCWELYCLEHGI PDGMMPSD++VG AHDAFNTFFSET AGK
Sbjct  1    MREVLSIHIGQAGIQVGNSCWELYCLEHGILPDGMMPSDTTVGYAHDAFNTFFSETNAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTV+DEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGK+I+++CLD
Sbjct  61   HVPRAIFVDLEPTVVDEVRTGKYRQLFHPEQLISGKEDAANNFARGHYTVGKDIIEICLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            RVRKLADNCTGLQGFLV +AVGGGTGSGLGSLLLERLSVEYGKKSKLGFTIYPSPQVSTA
Sbjct  121  RVRKLADNCTGLQGFLVTNAVGGGTGSGLGSLLLERLSVEYGKKSKLGFTIYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>gb|EKF30131.1| epsilon tubulin, putative, partial [Trypanosoma cruzi marinkellei]
Length=212

 Score =   315 bits (808),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE I IHIGQAG QVGN+CWEL+CLEHGIQPDG MPSD ++GV  DAFNTFFSETGAGK
Sbjct  1    MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGAMPSDKTIGVEDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRAVF+DLEPTV+DE+RTGTYRQLFHPEQLISGKEDAANN+ARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEIRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLV+ AVGGGTGSGLG+LLLERLSV+YGKKSKLG+T+YPSPQVSTA
Sbjct  121  RIRKLADNCTGLQGFLVYHAVGGGTGSGLGALLLERLSVDYGKKSKLGYTVYPSPQVSTA  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGL SLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLASLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  51   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  230
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  231  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  410
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  411  RVRKLADNCTGLQGFLVFSAVgggtgsglgslllerlsVEYGKKSKLGFTIYPSPQVSTA  590
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSV+YGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  591  VVEP  602
            VVEP
Sbjct  181  VVEP  184



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370