BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F19

Length=557
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769062.1|  PREDICTED: sterol 3-beta-glucosyltransferase...  75.9    1e-12   Nicotiana sylvestris
gb|ABC96116.1|  sterol glucosyltransferase                            73.6    8e-12   Withania somnifera [ashwagandha]
ref|XP_009595971.1|  PREDICTED: sterol 3-beta-glucosyltransferase...  72.0    3e-11   
ref|XP_006359808.1|  PREDICTED: sterol 3-beta-glucosyltransferase...  58.2    8e-07   
ref|XP_004237799.1|  PREDICTED: sterol 3-beta-glucosyltransferase...  57.0    2e-06   Solanum lycopersicum
ref|XP_011101335.1|  PREDICTED: sterol 3-beta-glucosyltransferase...  56.2    4e-06   Sesamum indicum [beniseed]
emb|CBI18214.3|  unnamed protein product                              55.5    6e-06   Vitis vinifera
ref|XP_010665137.1|  PREDICTED: sterol 3-beta-glucosyltransferase...  55.5    6e-06   Vitis vinifera
ref|XP_007019521.1|  UDP-Glycosyltransferase superfamily protein ...  52.4    6e-05   
ref|XP_008237852.1|  PREDICTED: sterol 3-beta-glucosyltransferase...  49.7    5e-04   Prunus mume [ume]
ref|XP_008237853.1|  PREDICTED: sterol 3-beta-glucosyltransferase...  49.3    6e-04   Prunus mume [ume]



>ref|XP_009769062.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009769070.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009769077.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009769083.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009769092.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 isoform 
X3 [Nicotiana sylvestris]
 ref|XP_009769098.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 isoform 
X4 [Nicotiana sylvestris]
Length=667

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 85/163 (52%), Gaps = 24/163 (15%)
 Frame = +1

Query  76   MESNGN--CKISRNLEDVVESHPGEKSMFQIHSSHSLIQDGNQSVMSRTNGDH--AGSPL  243
            M+SNGN   K  +NLED VES           +  SL    +   + + + D   + S L
Sbjct  1    MDSNGNGSTKTYKNLEDGVES-----------TGQSLDWTSDVGSLDKKSLDKQLSISSL  49

Query  244  EVSGKSD---DVIVSDAFENRMRRLSSVVGT-SSNVQSDAS-SPESPYRRATSLPGADLS  408
            EV   +D   D + SD  + R    S +VG  SS+  SD   +PE  Y+R   L  +   
Sbjct  50   EVPSNADERSDAVFSDELDGRRTSTSPLVGIRSSDEHSDECLTPEVKYQRTHPLQPS---  106

Query  409  WSAPPRARRGLGHSITAPASAHRNLVLEGQEGVFSRSMTDKKI  537
             SAPPR R GL + ITAP +  RNL LEGQ+  FSRSMT++++
Sbjct  107  -SAPPRLRGGLEYCITAPVTTRRNLFLEGQDMAFSRSMTERRL  148



>gb|ABC96116.1| sterol glucosyltransferase [Withania somnifera]
Length=701

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 93/183 (51%), Gaps = 26/183 (14%)
 Frame = +1

Query  76   MESNGNCKISRNLEDVVESHPGEKSMFQIHSSHSLIQDGNQSVMSRTNG---------DH  228
            M+SNG+   +++L+D+ +   G ++  ++  S     D + SV               D 
Sbjct  1    MDSNGHNGTTKSLQDLGD---GVETTGRLGKSLDRTSDVDSSVQLDKKSLDKQLPRALDQ  57

Query  229  AGSPLEVSGKSD---DVIVSDAFENRMRRLSSVVGTSSNVQ--SDASSPESPYRRATSL-  390
            + S LEV   SD   D   SD  +      SS+V T S+ +   D  +PE  Y+R   L 
Sbjct  58   STSHLEVPDNSDERCDAGFSDELDGWRTSSSSLVDTRSSDEHSDDCLTPEMKYQRTHPLQ  117

Query  391  PGADLS------WSA--PPRARRGLGHSITAPASAHRNLVLEGQEGVFSRSMTDKKITPR  546
            P   L       WS+  PPRARRGL H ITAP + HR+L LEGQ+  FSRS+T+++ +P 
Sbjct  118  PSLVLESPESNGWSSSVPPRARRGLEHCITAPVTTHRSLFLEGQDMAFSRSLTERRDSPG  177

Query  547  HEL  555
            H L
Sbjct  178  HNL  180



>ref|XP_009595971.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 [Nicotiana 
tomentosiformis]
 ref|XP_009595972.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 [Nicotiana 
tomentosiformis]
 ref|XP_009595973.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 [Nicotiana 
tomentosiformis]
Length=670

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 90/161 (56%), Gaps = 17/161 (11%)
 Frame = +1

Query  76   MESNGN--CKISRNLEDVVESHPGEKSMFQIHSSHSLIQDGNQSVMSRTNGDHAGSPLEV  249
            M+SNGN   +  +NLED VE+    +S+   +   S +Q   +S+  + +  +    LEV
Sbjct  1    MDSNGNGSTETYKNLEDGVETT--VQSLDCTNDVVSSVQLDKKSLDKQLSISY----LEV  54

Query  250  SGKSDD---VIVSDAFENRMRRLSSVVGT-SSNVQSDAS-SPESPYRRATSLPGADLSWS  414
               +D+    ++SD  + +    SS+VG  SS+  SD   +PE  Y+R   L  +    S
Sbjct  55   PSNADEWSHAVLSDELDGQRTSSSSLVGIRSSDEHSDVCLTPEVKYQRTHPLQPS----S  110

Query  415  APPRARRGLGHSITAPASAHRNLVLEGQEGVFSRSMTDKKI  537
            APPR R GL H ITAP +  R+L LEGQ+  FSRSMT++++
Sbjct  111  APPRLRGGLEHCITAPVTTRRSLFLEGQDMAFSRSMTERRL  151



>ref|XP_006359808.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1-like [Solanum 
tuberosum]
Length=640

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 59/118 (50%), Gaps = 11/118 (9%)
 Frame = +1

Query  217  NGDHAGSPLEVSGKSD---DVIVSDAFENRMRRLSSV--VGTSSNVQSDASSPESPYRRA  381
            NG+ +    EV   +D   D   SD  +      SS+  + +S     +  +PE  Y R 
Sbjct  7    NGNQSTRDSEVPNNADERCDATFSDELDGGRTSSSSLKDIRSSDEHVDECLTPEMKYERT  66

Query  382  TSLPGADLSWSAPPRARRGLGHSITAPASAHRNLVLEGQEGVFSRSMTDKKITPRHEL  555
                    S S PP ARRGL H ITAP +    L  EGQ+  FSRS+T+++++PRH L
Sbjct  67   HR------SSSPPPLARRGLEHCITAPVTIGGGLFPEGQDMAFSRSLTERRVSPRHNL  118



>ref|XP_004237799.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 [Solanum 
lycopersicum]
 ref|XP_004237800.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 [Solanum 
lycopersicum]
 ref|XP_010320093.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 [Solanum 
lycopersicum]
 ref|XP_010320094.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 [Solanum 
lycopersicum]
Length=643

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  412  SAPPRARRGLGHSITAPASAHRNLVLEGQEGVFSRSMTDKKITPRHEL  555
            S PP+ARRGL H ITAP +    L  EGQ+  FSRS+T+++++PRH +
Sbjct  71   SPPPQARRGLEHCITAPVTIGGGLFPEGQDMAFSRSLTERRVSPRHNV  118



>ref|XP_011101335.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 [Sesamum 
indicum]
Length=696

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 70/151 (46%), Gaps = 16/151 (11%)
 Frame = +1

Query  145  KSMFQIHSSHSLIQDGNQSVMSRTNGDHAGSPLEVS----GKSDDVIVSDAFENRMRRLS  312
            KS+ QI+ + SL+Q  +    SR   D      EV      +S DV      + R   LS
Sbjct  27   KSIDQIYDNDSLLQTNSPPATSRGAEDEGDGLPEVPSIDLNRSCDVGPDGLKDPRTSMLS  86

Query  313  SVVGTSSNVQSDAS-SPESPYRRATSLPGA---------DLSWSAPPRARRGLGHSITAP  462
            +      N  SD   +PE  ++R   L  +         D S S+ P+  RGL H ITAP
Sbjct  87   ASDNQPINEHSDLCLTPEGKHQRTNLLQSSSAVEVSQLRDPSLSSSPQVLRGLDHCITAP  146

Query  463  ASAHRNLVLEGQEGVFSRSMTDKKITPRHEL  555
               HRNL LE QE  FSRSMT++  +P   L
Sbjct  147  V--HRNLFLENQEAAFSRSMTERWGSPLPAL  175



>emb|CBI18214.3| unnamed protein product [Vitis vinifera]
Length=698

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  430  RRGLGHSITAPASAHRNLVLEGQEGVFSRSMTDKKITPRHEL  555
            RRGL H ITAPA  H+NL+++G E    RSMT+KK  PRH+L
Sbjct  135  RRGLDHCITAPAGTHKNLLIDGNEIGLFRSMTEKKEGPRHDL  176



>ref|XP_010665137.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 [Vitis vinifera]
 ref|XP_010665138.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 [Vitis vinifera]
 ref|XP_010665139.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 [Vitis vinifera]
Length=631

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  430  RRGLGHSITAPASAHRNLVLEGQEGVFSRSMTDKKITPRHEL  555
            RRGL H ITAPA  H+NL+++G E    RSMT+KK  PRH+L
Sbjct  68   RRGLDHCITAPAGTHKNLLIDGNEIGLFRSMTEKKEGPRHDL  109



>ref|XP_007019521.1| UDP-Glycosyltransferase superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY16746.1| UDP-Glycosyltransferase superfamily protein isoform 1 [Theobroma 
cacao]
Length=626

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +1

Query  430  RRGLGHSITAPASAHRNLVLEGQEGVFSRSMTDKKITPRHEL  555
            R+GL H ITAP    RNL+++  E  FSRSMT+KK TPRH+L
Sbjct  88   RKGLDHCITAPVGTPRNLLIDDNEITFSRSMTEKK-TPRHDL  128



>ref|XP_008237852.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 isoform 
X1 [Prunus mume]
Length=653

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  412  SAPPRARRGLGHSITAPASAHRNLVLEGQEGVFSRSMTDKKITPRHEL  555
            S+P   +RGL H ITAP    + L++E  E  FSRSMT+KK  PRH+ 
Sbjct  85   SSPQTPQRGLDHYITAPIGTPKGLLIEDHEIKFSRSMTEKKGLPRHDF  132



>ref|XP_008237853.1| PREDICTED: sterol 3-beta-glucosyltransferase UGT80B1 isoform 
X2 [Prunus mume]
Length=623

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  412  SAPPRARRGLGHSITAPASAHRNLVLEGQEGVFSRSMTDKKITPRHEL  555
            S+P   +RGL H ITAP    + L++E  E  FSRSMT+KK  PRH+ 
Sbjct  55   SSPQTPQRGLDHYITAPIGTPKGLLIEDHEIKFSRSMTEKKGLPRHDF  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800