BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F18

Length=484
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797403.1|  PREDICTED: pectate lyase-like                      113   1e-26   Nicotiana sylvestris
ref|XP_009627245.1|  PREDICTED: pectate lyase-like                      111   6e-26   
ref|XP_011071024.1|  PREDICTED: pectate lyase-like                      106   4e-24   Sesamum indicum [beniseed]
ref|XP_009599232.1|  PREDICTED: pectate lyase-like                      104   2e-23   Nicotiana tomentosiformis
ref|XP_009758350.1|  PREDICTED: pectate lyase-like                      104   2e-23   Nicotiana sylvestris
emb|CDP00293.1|  unnamed protein product                                103   3e-23   Coffea canephora [robusta coffee]
gb|EYU28712.1|  hypothetical protein MIMGU_mgv1a006498mg                101   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_002311599.2|  pectate lyase family protein                     99.8    1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006363934.1|  PREDICTED: pectate lyase-like                    99.0    3e-21   Solanum tuberosum [potatoes]
ref|XP_004228388.1|  PREDICTED: pectate lyase                         98.2    5e-21   Solanum lycopersicum
gb|EYU22437.1|  hypothetical protein MIMGU_mgv1a006496mg              97.8    6e-21   Erythranthe guttata [common monkey flower]
ref|XP_010320663.1|  PREDICTED: probable pectate lyase 3              95.9    2e-20   
gb|EPS73633.1|  hypothetical protein M569_01123                       96.7    2e-20   Genlisea aurea
emb|CAN79927.1|  hypothetical protein VITISV_042447                   96.3    3e-20   Vitis vinifera
ref|XP_002282500.3|  PREDICTED: pectate lyase                         96.3    3e-20   Vitis vinifera
emb|CBI22159.3|  unnamed protein product                              96.3    3e-20   Vitis vinifera
ref|XP_006357289.1|  PREDICTED: probable pectate lyase 3-like         95.9    4e-20   Solanum tuberosum [potatoes]
ref|XP_010112093.1|  putative pectate lyase 7                         95.1    6e-20   Morus notabilis
ref|XP_011025954.1|  PREDICTED: probable pectate lyase P59            94.4    1e-19   Populus euphratica
ref|XP_008443432.1|  PREDICTED: probable pectate lyase 19             90.5    3e-18   Cucumis melo [Oriental melon]
ref|XP_011086389.1|  PREDICTED: pectate lyase-like                    90.1    4e-18   Sesamum indicum [beniseed]
ref|XP_009342871.1|  PREDICTED: pectate lyase-like                    89.4    8e-18   Pyrus x bretschneideri [bai li]
ref|XP_007037229.1|  Pectate lyase family protein                     89.4    9e-18   
gb|KGN59593.1|  hypothetical protein Csa_3G827350                     88.6    1e-17   Cucumis sativus [cucumbers]
ref|XP_004147462.1|  PREDICTED: probable pectate lyase 7-like         88.6    2e-17   
ref|XP_007227702.1|  hypothetical protein PRUPE_ppa005744mg           88.2    2e-17   Prunus persica
emb|CAN69905.1|  hypothetical protein VITISV_001007                   87.0    2e-17   Vitis vinifera
ref|XP_010105747.1|  putative pectate lyase P59                       87.4    3e-17   
ref|XP_008221660.1|  PREDICTED: probable pectate lyase 3              87.4    3e-17   Prunus mume [ume]
gb|KJB80030.1|  hypothetical protein B456_013G077600                  86.3    5e-17   Gossypium raimondii
ref|XP_004165454.1|  PREDICTED: pectate lyase-like                    86.7    7e-17   
ref|XP_004152537.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  86.7    8e-17   
ref|XP_010096345.1|  putative pectate lyase 7                         86.3    8e-17   
gb|KJB80029.1|  hypothetical protein B456_013G077600                  86.7    9e-17   Gossypium raimondii
ref|XP_007046218.1|  Pectate lyase family protein, putative           86.3    1e-16   
gb|KHG07401.1|  putative pectate lyase P59                            85.9    1e-16   Gossypium arboreum [tree cotton]
ref|XP_008339935.1|  PREDICTED: probable pectate lyase 3              85.9    2e-16   
ref|XP_002270089.1|  PREDICTED: pectate lyase                         85.9    2e-16   Vitis vinifera
ref|XP_008389523.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  85.5    2e-16   
ref|XP_011013803.1|  PREDICTED: pectate lyase-like                    85.1    2e-16   Populus euphratica
ref|XP_006374492.1|  hypothetical protein POPTR_0015s07590g           85.1    2e-16   Populus trichocarpa [western balsam poplar]
gb|AAQ62997.1|  oil palm polygalacturonase allergen PEST411           85.1    3e-16   Elaeis guineensis
ref|XP_008357758.1|  PREDICTED: pectate lyase-like                    85.1    3e-16   
ref|XP_010925369.1|  PREDICTED: pectate lyase                         85.1    3e-16   Elaeis guineensis
gb|KJB44678.1|  hypothetical protein B456_007G265100                  84.7    3e-16   Gossypium raimondii
ref|XP_006477525.1|  PREDICTED: pectate lyase-like                    84.0    6e-16   Citrus sinensis [apfelsine]
ref|XP_010066949.1|  PREDICTED: pectate lyase                         84.0    7e-16   Eucalyptus grandis [rose gum]
gb|KJB78284.1|  hypothetical protein B456_012G187800                  83.6    1e-15   Gossypium raimondii
gb|KHN13652.1|  Pectate lyase                                         83.2    1e-15   Glycine soja [wild soybean]
ref|XP_003552513.1|  PREDICTED: pectate lyase-like                    83.2    1e-15   Glycine max [soybeans]
ref|XP_007032453.1|  Pectate lyase family protein                     83.2    1e-15   
ref|XP_010033216.1|  PREDICTED: pectate lyase-like                    83.2    1e-15   
gb|KCW52797.1|  hypothetical protein EUGRSUZ_J02132                   83.2    1e-15   Eucalyptus grandis [rose gum]
gb|KJB80047.1|  hypothetical protein B456_013G078300                  82.8    2e-15   Gossypium raimondii
gb|AAQ62996.1|  oil palm polygalacturonase allergen PEST361           82.8    2e-15   Elaeis guineensis
ref|XP_010915114.1|  PREDICTED: LOW QUALITY PROTEIN: pectate lyas...  82.4    2e-15   
gb|KHG08055.1|  putative pectate lyase P59                            82.4    3e-15   Gossypium arboreum [tree cotton]
ref|XP_011005067.1|  PREDICTED: probable pectate lyase P59            82.4    3e-15   Populus euphratica
gb|KHN45481.1|  Putative pectate lyase 3                              81.6    3e-15   Glycine soja [wild soybean]
ref|XP_008341537.1|  PREDICTED: pectate lyase-like                    82.4    3e-15   Malus domestica [apple tree]
gb|KJB80049.1|  hypothetical protein B456_013G078500                  82.4    3e-15   Gossypium raimondii
ref|XP_002323835.1|  hypothetical protein POPTR_0017s11450g           82.0    3e-15   
gb|KJB13233.1|  hypothetical protein B456_002G064100                  82.0    3e-15   Gossypium raimondii
gb|KJB80041.1|  hypothetical protein B456_013G078000                  82.0    3e-15   Gossypium raimondii
ref|XP_002511525.1|  Pectate lyase precursor, putative                81.6    4e-15   Ricinus communis
ref|XP_008221658.1|  PREDICTED: pectate lyase-like                    81.6    5e-15   Prunus mume [ume]
ref|XP_003554335.1|  PREDICTED: pectate lyase-like                    81.6    5e-15   Glycine max [soybeans]
ref|XP_007224275.1|  hypothetical protein PRUPE_ppa019055mg           81.3    7e-15   Prunus persica
emb|CBI15265.3|  unnamed protein product                              80.5    8e-15   Vitis vinifera
ref|XP_002272638.2|  PREDICTED: pectate lyase-like                    80.9    9e-15   Vitis vinifera
ref|XP_010068708.1|  PREDICTED: pectate lyase-like                    80.5    1e-14   Eucalyptus grandis [rose gum]
ref|XP_008230729.1|  PREDICTED: pectate lyase                         80.5    1e-14   Prunus mume [ume]
ref|XP_009403112.1|  PREDICTED: pectate lyase-like                    80.5    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO76053.1|  hypothetical protein CISIN_1g013757mg                 80.5    1e-14   Citrus sinensis [apfelsine]
ref|XP_006439649.1|  hypothetical protein CICLE_v10020193mg           80.5    1e-14   Citrus clementina [clementine]
ref|XP_002520133.1|  Pectate lyase precursor, putative                80.5    1e-14   Ricinus communis
ref|XP_004489168.1|  PREDICTED: pectate lyase-like                    80.1    2e-14   Cicer arietinum [garbanzo]
ref|XP_010256490.1|  PREDICTED: pectate lyase-like                    79.7    2e-14   
ref|XP_009360393.1|  PREDICTED: probable pectate lyase 3              79.7    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_009794547.1|  PREDICTED: pectate lyase-like                    74.7    3e-14   Nicotiana sylvestris
ref|XP_007215366.1|  hypothetical protein PRUPE_ppa005602mg           79.3    3e-14   Prunus persica
ref|XP_008793504.1|  PREDICTED: pectate lyase-like                    79.3    3e-14   Phoenix dactylifera
ref|XP_008786760.1|  PREDICTED: pectate lyase-like                    79.3    4e-14   Phoenix dactylifera
ref|XP_004302354.1|  PREDICTED: pectate lyase-like                    79.0    4e-14   Fragaria vesca subsp. vesca
gb|KJB62823.1|  hypothetical protein B456_009G438700                  79.0    4e-14   Gossypium raimondii
ref|XP_008374522.1|  PREDICTED: pectate lyase-like                    78.6    5e-14   
ref|XP_009369346.1|  PREDICTED: pectate lyase-like                    78.6    5e-14   Pyrus x bretschneideri [bai li]
gb|KHG16093.1|  hypothetical protein F383_07683                       78.6    6e-14   Gossypium arboreum [tree cotton]
ref|XP_002306040.1|  hypothetical protein POPTR_0004s12300g           78.6    6e-14   
emb|CDP14850.1|  unnamed protein product                              78.2    7e-14   Coffea canephora [robusta coffee]
ref|XP_002270112.1|  PREDICTED: pectate lyase                         78.2    7e-14   Vitis vinifera
ref|XP_009389712.1|  PREDICTED: pectate lyase-like                    78.2    8e-14   
gb|KJB40824.1|  hypothetical protein B456_007G078600                  78.2    8e-14   Gossypium raimondii
ref|XP_009381244.1|  PREDICTED: pectate lyase-like                    77.8    8e-14   
emb|CAN69904.1|  hypothetical protein VITISV_001006                   78.2    8e-14   Vitis vinifera
gb|KJB62833.1|  hypothetical protein B456_009G439300                  77.4    1e-13   Gossypium raimondii
ref|XP_009408830.1|  PREDICTED: pectate lyase-like                    77.4    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003609009.1|  Pectate lyase                                    77.0    2e-13   
gb|AES91206.2|  pectate lyase P59-like protein                        76.6    2e-13   Medicago truncatula
gb|KJB19290.1|  hypothetical protein B456_003G094800                  76.6    3e-13   Gossypium raimondii
ref|XP_009380431.1|  PREDICTED: pectate lyase-like                    76.6    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007151201.1|  hypothetical protein PHAVU_004G026400g           76.3    3e-13   Phaseolus vulgaris [French bean]
gb|AAB69758.1|  putative pectate lyase Nt59                           74.3    4e-13   Nicotiana tabacum [American tobacco]
gb|KHN13240.1|  Putative pectate lyase 3                              75.9    4e-13   Glycine soja [wild soybean]
gb|ACU23277.1|  unknown                                               75.9    5e-13   Glycine max [soybeans]
ref|XP_003543726.1|  PREDICTED: pectate lyase                         75.9    5e-13   Glycine max [soybeans]
gb|KJB32164.1|  hypothetical protein B456_005G227000                  75.1    9e-13   Gossypium raimondii
ref|XP_008339934.1|  PREDICTED: probable pectate lyase 3              75.1    1e-12   Malus domestica [apple tree]
ref|XP_009779191.1|  PREDICTED: probable pectate lyase P59            74.7    1e-12   Nicotiana sylvestris
ref|XP_008446316.1|  PREDICTED: probable pectate lyase P59            74.7    1e-12   Cucumis melo [Oriental melon]
ref|XP_007138209.1|  hypothetical protein PHAVU_009G189800g           74.7    1e-12   Phaseolus vulgaris [French bean]
ref|XP_004231596.1|  PREDICTED: probable pectate lyase P59            70.1    1e-12   Solanum lycopersicum
ref|XP_009599825.1|  PREDICTED: probable pectate lyase P59 isofor...  74.3    2e-12   Nicotiana tomentosiformis
emb|CDX70590.1|  BnaC03g06740D                                        74.3    2e-12   
ref|XP_010670318.1|  PREDICTED: pectate lyase-like                    74.3    2e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN11586.1|  Putative pectate lyase 3                              72.0    2e-12   Glycine soja [wild soybean]
ref|XP_006588322.1|  PREDICTED: probable pectate lyase 3-like         71.6    2e-12   Glycine max [soybeans]
ref|XP_006842121.1|  hypothetical protein AMTR_s00078p00106380        73.9    2e-12   Amborella trichopoda
ref|XP_009615547.1|  PREDICTED: probable pectate lyase P59            73.9    2e-12   Nicotiana tomentosiformis
gb|KGN47799.1|  hypothetical protein Csa_6G404140                     73.6    2e-12   Cucumis sativus [cucumbers]
ref|XP_004146792.1|  PREDICTED: probable pectate lyase P59-like       73.9    3e-12   
ref|XP_011087066.1|  PREDICTED: pectate lyase                         73.6    3e-12   
ref|XP_004162547.1|  PREDICTED: probable pectate lyase P59-like       73.6    3e-12   
gb|KJB60995.1|  hypothetical protein B456_009G334500                  73.6    3e-12   Gossypium raimondii
ref|XP_002871648.1|  pectate lyase family protein                     73.6    3e-12   
ref|XP_006363498.1|  PREDICTED: probable pectate lyase P59-like       68.9    4e-12   Solanum tuberosum [potatoes]
ref|XP_007139601.1|  hypothetical protein PHAVU_008G043600g           73.2    4e-12   Phaseolus vulgaris [French bean]
ref|XP_008456459.1|  PREDICTED: pectate lyase-like                    73.2    4e-12   Cucumis melo [Oriental melon]
ref|XP_010242445.1|  PREDICTED: pectate lyase                         72.4    6e-12   Nelumbo nucifera [Indian lotus]
emb|CDX81636.1|  BnaC08g39650D                                        72.8    6e-12   
gb|KJB84349.1|  hypothetical protein B456_N020200                     72.4    8e-12   Gossypium raimondii
ref|XP_009599826.1|  PREDICTED: probable pectate lyase P59 isofor...  72.4    8e-12   Nicotiana tomentosiformis
ref|XP_008239834.1|  PREDICTED: pectate lyase-like                    72.0    9e-12   Prunus mume [ume]
ref|XP_007209148.1|  hypothetical protein PRUPE_ppa005859mg           72.0    9e-12   Prunus persica
gb|KJB62844.1|  hypothetical protein B456_009G4398001                 69.7    9e-12   Gossypium raimondii
ref|XP_004514773.1|  PREDICTED: probable pectate lyase 3-like         72.0    1e-11   Cicer arietinum [garbanzo]
sp|Q9LFP5.1|PLY19_ARATH  RecName: Full=Probable pectate lyase 19;...  72.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011085780.1|  PREDICTED: probable pectate lyase P59            72.0    1e-11   Sesamum indicum [beniseed]
gb|ABK28696.1|  unknown                                               72.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197015.4|  putative pectate lyase 19                           72.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KJB84350.1|  hypothetical protein B456_N020100                     71.6    1e-11   Gossypium raimondii
ref|XP_011085777.1|  PREDICTED: probable pectate lyase P59            71.6    1e-11   Sesamum indicum [beniseed]
gb|KJB60998.1|  hypothetical protein B456_009G334800                  71.6    1e-11   Gossypium raimondii
gb|KJB60997.1|  hypothetical protein B456_009G334700                  71.6    1e-11   Gossypium raimondii
ref|XP_006361835.1|  PREDICTED: probable pectate lyase P59-like       71.2    2e-11   Solanum tuberosum [potatoes]
ref|XP_010322971.1|  PREDICTED: probable pectate lyase P59            70.1    2e-11   
gb|KHN08855.1|  Putative pectate lyase P59                            71.2    2e-11   Glycine soja [wild soybean]
ref|XP_009587689.1|  PREDICTED: probable pectate lyase P59            71.2    2e-11   Nicotiana tomentosiformis
ref|XP_009789921.1|  PREDICTED: probable pectate lyase P59            71.2    2e-11   Nicotiana sylvestris
ref|XP_007137422.1|  hypothetical protein PHAVU_009G125800g           70.9    2e-11   Phaseolus vulgaris [French bean]
ref|XP_004966014.1|  PREDICTED: pectate lyase-like                    70.5    2e-11   
ref|XP_010527872.1|  PREDICTED: probable pectate lyase 3 isoform X2   70.9    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_009131435.1|  PREDICTED: probable pectate lyase 19             70.9    3e-11   Brassica rapa
emb|CDX85564.1|  BnaA02g02490D                                        70.5    4e-11   
gb|KJB84348.1|  hypothetical protein B456_N020300                     70.1    4e-11   Gossypium raimondii
ref|NP_178375.1|  putative pectate lyase 6                            70.1    4e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KJB33662.1|  hypothetical protein B456_006G024800                  70.1    5e-11   Gossypium raimondii
ref|XP_003530685.1|  PREDICTED: probable pectate lyase 3-like         70.1    5e-11   Glycine max [soybeans]
emb|CDY53552.1|  BnaA09g57110D                                        70.1    5e-11   Brassica napus [oilseed rape]
ref|XP_010683249.1|  PREDICTED: pectate lyase-like                    70.1    5e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011009454.1|  PREDICTED: pectate lyase-like                    70.1    5e-11   Populus euphratica
gb|KHN08706.1|  Putative pectate lyase 3                              69.7    6e-11   Glycine soja [wild soybean]
ref|XP_003519771.2|  PREDICTED: probable pectate lyase 3-like         69.7    6e-11   Glycine max [soybeans]
ref|XP_006482669.1|  PREDICTED: probable pectate lyase 9-like         67.8    6e-11   
ref|XP_009788285.1|  PREDICTED: pectate lyase-like                    69.7    7e-11   Nicotiana sylvestris
ref|XP_011097774.1|  PREDICTED: pectate lyase-like                    69.3    7e-11   Sesamum indicum [beniseed]
ref|XP_004489374.1|  PREDICTED: pectate lyase-like                    69.3    8e-11   Cicer arietinum [garbanzo]
ref|XP_009117903.1|  PREDICTED: probable pectate lyase 3              69.3    8e-11   Brassica rapa
gb|AFW87059.1|  pectate lyase                                         67.8    1e-10   
ref|XP_004298448.1|  PREDICTED: probable pectate lyase 3              68.9    1e-10   Fragaria vesca subsp. vesca
ref|XP_008679844.1|  PREDICTED: pectate lyase                         65.9    1e-10   
ref|XP_010420164.1|  PREDICTED: probable pectate lyase 19 isoform X2  68.9    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002437204.1|  hypothetical protein SORBIDRAFT_10g022830        67.8    1e-10   Sorghum bicolor [broomcorn]
ref|NP_001150723.1|  pectate lyase precursor                          67.4    2e-10   Zea mays [maize]
ref|XP_004232242.1|  PREDICTED: probable pectate lyase P59            68.6    2e-10   Solanum lycopersicum
ref|XP_006344502.1|  PREDICTED: probable pectate lyase P59-like       68.2    2e-10   Solanum tuberosum [potatoes]
ref|XP_004490003.1|  PREDICTED: probable pectate lyase 3-like iso...  68.2    2e-10   Cicer arietinum [garbanzo]
gb|ACF87417.1|  unknown                                               65.1    2e-10   Zea mays [maize]
gb|AAA86241.1|  pectate lyase homolog                                 68.2    2e-10   Medicago sativa [alfalfa]
gb|KFK33456.1|  hypothetical protein AALP_AA5G015800                  67.8    3e-10   Arabis alpina [alpine rockcress]
ref|XP_009110541.1|  PREDICTED: probable pectate lyase 3              67.8    3e-10   Brassica rapa
ref|XP_003613596.1|  Pectate lyase                                    67.4    3e-10   
ref|XP_006292606.1|  hypothetical protein CARUB_v10018855mg           67.4    4e-10   Capsella rubella
ref|XP_006354795.1|  PREDICTED: pectate lyase-like                    67.4    4e-10   Solanum tuberosum [potatoes]
ref|XP_007153840.1|  hypothetical protein PHAVU_003G069100g           67.0    5e-10   Phaseolus vulgaris [French bean]
ref|XP_009129128.1|  PREDICTED: probable pectate lyase 6              66.6    6e-10   Brassica rapa
emb|CDY09356.1|  BnaA02g26540D                                        66.6    7e-10   Brassica napus [oilseed rape]
ref|XP_009617495.1|  PREDICTED: probable pectate lyase P59            66.6    7e-10   Nicotiana tomentosiformis
ref|NP_001057945.1|  Os06g0583900                                     65.5    7e-10   
ref|XP_004236194.1|  PREDICTED: probable pectate lyase P59            66.6    8e-10   Solanum lycopersicum
ref|XP_010528323.1|  PREDICTED: probable pectate lyase 19             65.1    8e-10   Tarenaya hassleriana [spider flower]
ref|XP_010485518.1|  PREDICTED: probable pectate lyase 7              66.2    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_004508770.1|  PREDICTED: probable pectate lyase P59-like       65.9    9e-10   Cicer arietinum [garbanzo]
ref|XP_009598230.1|  PREDICTED: pectate lyase-like                    66.2    9e-10   Nicotiana tomentosiformis
ref|XP_009148818.1|  PREDICTED: probable pectate lyase 3              66.2    1e-09   Brassica rapa
sp|P40973.1|PLY_LILLO  RecName: Full=Pectate lyase; Flags: Precursor  66.2    1e-09   Lilium longiflorum [Easter lily]
ref|XP_006357122.1|  PREDICTED: probable pectate lyase P59-like       66.2    1e-09   Solanum tuberosum [potatoes]
ref|XP_004135462.1|  PREDICTED: probable pectate lyase P59-like       65.9    1e-09   Cucumis sativus [cucumbers]
ref|XP_004155392.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  65.9    1e-09   
emb|CDX96854.1|  BnaA08g23970D                                        66.2    1e-09   
ref|XP_002892805.1|  hypothetical protein ARALYDRAFT_471616           65.9    1e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_010496063.1|  PREDICTED: probable pectate lyase 3              65.9    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009802165.1|  PREDICTED: probable pectate lyase P59            65.9    1e-09   Nicotiana sylvestris
ref|XP_010476496.1|  PREDICTED: probable pectate lyase 3              65.9    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_004234779.1|  PREDICTED: probable pectate lyase P59            65.5    2e-09   
dbj|BAK06965.1|  predicted protein                                    65.1    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010463548.1|  PREDICTED: probable pectate lyase 7              65.5    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_003621115.1|  Pectate lyase                                    65.1    2e-09   Medicago truncatula
ref|XP_002875142.1|  pectate lyase family protein                     65.1    2e-09   Arabidopsis lyrata subsp. lyrata
emb|CDY39314.1|  BnaC05g10650D                                        65.1    2e-09   Brassica napus [oilseed rape]
ref|XP_011087217.1|  PREDICTED: pectate lyase-like                    65.1    2e-09   Sesamum indicum [beniseed]
emb|CDY68729.1|  BnaCnng60280D                                        65.1    2e-09   Brassica napus [oilseed rape]
ref|XP_010513594.1|  PREDICTED: probable pectate lyase 7              65.1    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006656188.1|  PREDICTED: pectate lyase-like                    63.5    3e-09   Oryza brachyantha
gb|KFK43687.1|  hypothetical protein AALP_AA1G160000                  64.7    3e-09   Arabis alpina [alpine rockcress]
ref|XP_002453531.1|  hypothetical protein SORBIDRAFT_04g007450        60.8    3e-09   Sorghum bicolor [broomcorn]
ref|XP_010523445.1|  PREDICTED: probable pectate lyase 3              64.7    3e-09   Tarenaya hassleriana [spider flower]
sp|P15722.1|PLY59_SOLLC  RecName: Full=Probable pectate lyase P59...  64.7    3e-09   Solanum lycopersicum
ref|XP_010453638.1|  PREDICTED: probable pectate lyase 19             64.7    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006338480.1|  PREDICTED: probable pectate lyase P59-like       64.7    4e-09   Solanum tuberosum [potatoes]
gb|KEH24975.1|  pectate lyase P59-like protein                        63.9    4e-09   Medicago truncatula
emb|CDY45254.1|  BnaA06g09240D                                        64.3    4e-09   Brassica napus [oilseed rape]
ref|XP_009761969.1|  PREDICTED: probable pectate lyase P59            64.3    4e-09   Nicotiana sylvestris
gb|AJR10088.1|  pectate lyase                                         64.3    4e-09   Eruca vesicaria subsp. sativa [arugula]
ref|XP_006299938.1|  hypothetical protein CARUB_v10016149mg           64.3    5e-09   Capsella rubella
ref|XP_006431087.1|  hypothetical protein CICLE_v10011762mg           63.9    5e-09   Citrus clementina [clementine]
ref|XP_010514040.1|  PREDICTED: probable pectate lyase 6              63.9    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006482544.1|  PREDICTED: probable pectate lyase 19-like        63.9    5e-09   Citrus sinensis [apfelsine]
gb|KEH19822.1|  pectate lyase-like protein                            63.9    5e-09   Medicago truncatula
emb|CDY41679.1|  BnaC02g34750D                                        63.9    7e-09   Brassica napus [oilseed rape]
ref|XP_010502279.1|  PREDICTED: probable pectate lyase 6              63.9    7e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006480843.1|  PREDICTED: probable pectate lyase 19-like        63.5    7e-09   
ref|XP_003563707.1|  PREDICTED: pectate lyase-like                    63.5    7e-09   Brachypodium distachyon [annual false brome]
ref|XP_006428983.1|  hypothetical protein CICLE_v10013750mg           63.5    7e-09   Citrus clementina [clementine]
gb|KJB62835.1|  hypothetical protein B456_009G439500                  62.8    7e-09   Gossypium raimondii
ref|XP_006437462.1|  hypothetical protein CICLE_v10031653mg           63.2    1e-08   
gb|EPS66620.1|  hypothetical protein M569_08154                       63.2    1e-08   Genlisea aurea
ref|XP_010425041.1|  PREDICTED: probable pectate lyase 6              63.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008446067.1|  PREDICTED: pectate lyase-like                    62.4    1e-08   
ref|XP_006306515.1|  hypothetical protein CARUB_v10012514mg           62.4    2e-08   Capsella rubella
gb|AAM60924.1|  putative pectate lyase                                62.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186776.1|  putative pectate lyase 7                            62.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDY63769.1|  BnaCnng42620D                                        62.4    2e-08   Brassica napus [oilseed rape]
ref|XP_003613595.1|  Pectate lyase                                    62.4    2e-08   
ref|XP_009126031.1|  PREDICTED: probable pectate lyase 19             62.4    2e-08   Brassica rapa
emb|CDY28691.1|  BnaCnng05770D                                        61.6    3e-08   Brassica napus [oilseed rape]
gb|EMT25421.1|  Pectate lyase                                         61.2    3e-08   
ref|XP_006484673.1|  PREDICTED: probable pectate lyase 19-like        61.2    4e-08   Citrus sinensis [apfelsine]
ref|XP_009125036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  61.2    5e-08   Brassica rapa
ref|XP_011098576.1|  PREDICTED: probable pectate lyase P56            61.2    5e-08   Sesamum indicum [beniseed]
gb|KDO49230.1|  hypothetical protein CISIN_1g036607mg                 60.8    5e-08   Citrus sinensis [apfelsine]
ref|XP_011098575.1|  PREDICTED: probable pectate lyase P59            60.8    6e-08   Sesamum indicum [beniseed]
ref|XP_006573090.1|  PREDICTED: probable pectate lyase 3-like         60.8    7e-08   Glycine max [soybeans]
ref|XP_010492335.1|  PREDICTED: probable pectate lyase 19             60.5    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002517472.1|  pectate lyase, putative                          60.5    9e-08   Ricinus communis
ref|NP_172894.1|  putative pectate lyase 3                            60.1    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAB69759.1|  putative pectate lyase                                60.1    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003571658.1|  PREDICTED: pectate lyase-like                    57.0    1e-07   Brachypodium distachyon [annual false brome]
gb|KHN01171.1|  Putative pectate lyase 3                              60.1    1e-07   Glycine soja [wild soybean]
dbj|BAK05605.1|  predicted protein                                    60.1    1e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP02198.1|  unnamed protein product                              60.1    1e-07   Coffea canephora [robusta coffee]
gb|EYU34111.1|  hypothetical protein MIMGU_mgv1a006386mg              59.7    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_009134622.1|  PREDICTED: probable pectate lyase 7              59.7    2e-07   Brassica rapa
emb|CDX74293.1|  BnaA03g27540D                                        59.7    2e-07   
gb|ACN96322.1|  hypothetical protein                                  58.5    2e-07   Zea mays subsp. mays [corn]
gb|ACN96320.1|  hypothetical protein                                  58.5    2e-07   Zea mays subsp. mays [corn]
emb|CDX91953.1|  BnaC03g32550D                                        58.9    2e-07   
ref|XP_007157384.1|  hypothetical protein PHAVU_002G065800g           58.9    3e-07   Phaseolus vulgaris [French bean]
gb|AAA16476.1|  pectate lyase homolog                                 58.5    3e-07   Zea mays [maize]
ref|XP_002882189.1|  pectate lyase family protein                     58.5    3e-07   Arabidopsis lyrata subsp. lyrata
ref|NP_001046281.1|  Os02g0214400                                     58.5    3e-07   
ref|XP_008385269.1|  PREDICTED: probable pectate lyase P59 isofor...  55.8    3e-07   
ref|XP_010678579.1|  PREDICTED: pectate lyase-like                    58.5    3e-07   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU36839.1|  hypothetical protein MIMGU_mgv1a006379mg              58.5    4e-07   Erythranthe guttata [common monkey flower]
ref|XP_010550068.1|  PREDICTED: probable pectate lyase 19             57.8    4e-07   Tarenaya hassleriana [spider flower]
ref|XP_002436463.1|  hypothetical protein SORBIDRAFT_10g003080        58.5    4e-07   Sorghum bicolor [broomcorn]
gb|ACN96319.1|  hypothetical protein                                  57.4    4e-07   Zea mays subsp. mays [corn]
ref|XP_010420163.1|  PREDICTED: probable pectate lyase 19 isoform X1  57.8    4e-07   
dbj|BAD68402.1|  putative pectate lyase homolog                       57.8    5e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99626.1|  hypothetical protein OsI_21605                        57.8    6e-07   
ref|XP_009121613.1|  PREDICTED: probable pectate lyase 19             55.1    6e-07   
emb|CDY66593.1|  BnaCnng51570D                                        55.1    6e-07   
ref|XP_004951474.1|  PREDICTED: pectate lyase-like                    55.5    6e-07   
ref|XP_004964534.1|  PREDICTED: pectate lyase-like                    55.8    6e-07   
ref|NP_001056781.1|  Os06g0144200                                     57.8    6e-07   
ref|XP_010551866.1|  PREDICTED: probable pectate lyase 19             57.8    7e-07   
ref|XP_009101245.1|  PREDICTED: probable pectate lyase 6              57.8    7e-07   
ref|XP_002437815.1|  hypothetical protein SORBIDRAFT_10g003090        55.5    8e-07   
gb|KDP45476.1|  hypothetical protein JCGZ_09725                       57.4    8e-07   
gb|ACN96379.1|  hypothetical protein                                  56.6    8e-07   
gb|ACN96380.1|  hypothetical protein                                  56.2    9e-07   
gb|KHG05193.1|  hypothetical protein F383_30875                       57.0    9e-07   
emb|CDY03043.1|  BnaC07g21840D                                        57.0    1e-06   
gb|ACN96360.1|  hypothetical protein                                  56.2    1e-06   
emb|CDY45202.1|  BnaA06g34060D                                        57.0    1e-06   
gb|ACN96355.1|  hypothetical protein                                  56.2    1e-06   
gb|ACN96354.1|  hypothetical protein                                  56.2    1e-06   
gb|ACN96358.1|  hypothetical protein                                  55.8    1e-06   
gb|ACN96342.1|  hypothetical protein                                  55.5    1e-06   
gb|ACN96359.1|  hypothetical protein                                  55.8    1e-06   
gb|ACN96364.1|  hypothetical protein                                  55.8    1e-06   
gb|ACN96372.1|  hypothetical protein                                  55.8    1e-06   
gb|ACN96353.1|  hypothetical protein                                  55.8    1e-06   
gb|ACN96362.1|  hypothetical protein                                  55.5    2e-06   
emb|CDY17432.1|  BnaC09g21050D                                        56.2    2e-06   
gb|ACN96356.1|  hypothetical protein                                  55.5    2e-06   
gb|KHG23093.1|  hypothetical protein F383_29772                       56.2    2e-06   
gb|ACN96341.1|  hypothetical protein                                  55.5    2e-06   
gb|ACN96346.1|  hypothetical protein                                  55.5    2e-06   
ref|XP_008385270.1|  PREDICTED: probable pectate lyase P59 isofor...  53.1    3e-06   
ref|XP_009114192.1|  PREDICTED: probable pectate lyase 6              55.1    4e-06   
emb|CDY04133.1|  BnaA09g19110D                                        55.1    4e-06   
gb|AGT16687.1|  pectate lyase                                         54.3    4e-06   
gb|EEE65934.1|  hypothetical protein OsJ_21803                        52.0    5e-06   
gb|AAN60248.1|  unknown                                               53.5    5e-06   
gb|EMS45831.1|  Pectate lyase                                         54.7    5e-06   
ref|NP_001150425.1|  LOC100284055 precursor                           53.9    5e-06   
gb|EAY85003.1|  hypothetical protein OsI_06363                        54.3    8e-06   
gb|AFW76465.1|  hypothetical protein ZEAMMB73_776134                  50.8    9e-06   
dbj|BAK06133.1|  predicted protein                                    51.6    9e-06   
emb|CAN77957.1|  hypothetical protein VITISV_021245                   54.3    9e-06   
ref|XP_010527871.1|  PREDICTED: probable pectate lyase 3 isoform X1   54.3    1e-05   
gb|EEE56553.1|  hypothetical protein OsJ_05879                        53.9    1e-05   
ref|XP_006579282.1|  PREDICTED: probable pectate lyase P59-like       52.4    1e-05   
ref|XP_008365507.1|  PREDICTED: pectate lyase-like                    53.5    1e-05   
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like         53.5    2e-05   
ref|XP_010420165.1|  PREDICTED: probable pectate lyase 19 isoform X3  52.0    2e-05   
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8              53.1    2e-05   
emb|CDY65626.1|  BnaC03g74840D                                        53.1    2e-05   
dbj|BAB10560.1|  pectate lyase                                        52.8    2e-05   
ref|NP_568967.1|  putative pectate lyase 22                           52.8    2e-05   
gb|KFK37588.1|  hypothetical protein AALP_AA3G002600                  52.0    3e-05   
ref|XP_006826355.1|  hypothetical protein AMTR_s00004p00123190        52.8    3e-05   
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg              52.8    3e-05   
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like         52.4    3e-05   
emb|CAC80136.1|  pectate lyase II enzyme                              52.4    4e-05   
ref|XP_011464385.1|  PREDICTED: pectate lyase-like                    52.4    4e-05   
ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5              52.4    4e-05   
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g           52.0    5e-05   
ref|XP_006830637.1|  hypothetical protein AMTR_s00120p00111300        52.0    5e-05   
ref|NP_189376.1|  putative pectate lyase 11                           52.0    5e-05   
gb|AGC94753.1|  putative pectate lyase                                51.6    6e-05   
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg              51.6    6e-05   
gb|KFK25747.1|  hypothetical protein AALP_AA8G154300                  50.4    6e-05   
gb|KHG22755.1|  hypothetical protein F383_29653                       51.6    7e-05   
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2   51.6    7e-05   
gb|AAF19196.1|AF206320_1  pectate lyase 2                             51.6    7e-05   
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...  51.6    7e-05   
ref|XP_008366366.1|  PREDICTED: pectate lyase-like                    50.1    8e-05   
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1   51.6    8e-05   
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22             51.2    9e-05   
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                  51.2    9e-05   
gb|KDP30495.1|  hypothetical protein JCGZ_16174                       51.2    1e-04   
ref|XP_010683248.1|  PREDICTED: pectate lyase-like                    50.8    1e-04   
ref|XP_002875382.1|  predicted protein                                50.8    1e-04   
ref|XP_002297822.1|  pectate lyase family protein                     50.8    1e-04   
ref|XP_004490004.1|  PREDICTED: probable pectate lyase 3-like iso...  50.8    1e-04   
ref|XP_006286712.1|  hypothetical protein CARUB_v10002862mg           49.3    1e-04   
gb|KDP26417.1|  hypothetical protein JCGZ_17575                       50.8    1e-04   
gb|KJB15669.1|  hypothetical protein B456_002G189900                  50.8    1e-04   
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...  50.4    1e-04   
ref|XP_010481247.1|  PREDICTED: uncharacterized protein LOC104760096  49.3    2e-04   
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg           50.1    2e-04   
ref|XP_010425491.1|  PREDICTED: putative pectate lyase 11             50.1    2e-04   
gb|KJB50293.1|  hypothetical protein B456_008G162500                  50.1    2e-04   
ref|XP_006280553.1|  hypothetical protein CARUB_v10026494mg           50.1    2e-04   
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...  50.1    2e-04   
gb|KJB50292.1|  hypothetical protein B456_008G162500                  50.1    2e-04   
emb|CDY41506.1|  BnaA06g22590D                                        50.1    2e-04   
ref|XP_008382653.1|  PREDICTED: probable pectate lyase 10             50.1    2e-04   
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8              50.1    2e-04   
gb|ADP09680.1|  pectate lyase                                         50.1    2e-04   
gb|ABR17791.1|  unknown                                               50.1    2e-04   
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22             49.7    2e-04   
gb|KJB33634.1|  hypothetical protein B456_006G037300                  49.7    2e-04   
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5              49.7    3e-04   
gb|KFK42808.1|  hypothetical protein AALP_AA1G041400                  49.7    3e-04   
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like         49.7    3e-04   
gb|EAY99627.1|  hypothetical protein OsI_21606                        49.3    3e-04   
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22             49.7    3e-04   
ref|XP_004143054.1|  PREDICTED: probable pectate lyase 5-like         49.3    3e-04   
emb|CDY16732.1|  BnaA09g06500D                                        49.3    3e-04   
ref|XP_006854397.1|  hypothetical protein AMTR_s00039p00186640        49.3    3e-04   
gb|ABR26682.1|  pectate lyase                                         49.3    3e-04   
ref|XP_010033351.1|  PREDICTED: pectate lyase-like                    49.3    3e-04   
ref|XP_003638494.1|  Pectate lyase                                    48.5    4e-04   
emb|CDP13269.1|  unnamed protein product                              49.3    4e-04   
ref|XP_008444399.1|  PREDICTED: probable pectate lyase 5              49.3    4e-04   
gb|KFK33662.1|  hypothetical protein AALP_AA5G043100                  49.3    4e-04   
emb|CDY34149.1|  BnaA02g28910D                                        49.3    4e-04   
emb|CDY12666.1|  BnaA02g13340D                                        49.3    4e-04   
ref|XP_009127577.1|  PREDICTED: probable pectate lyase 5              49.3    4e-04   
emb|CDY32557.1|  BnaC02g17500D                                        49.3    4e-04   
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1   49.3    4e-04   
ref|XP_009151964.1|  PREDICTED: putative pectate lyase 11 isoform X1  48.9    4e-04   
emb|CDY48132.1|  BnaCnng15740D                                        48.9    5e-04   
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like        48.9    5e-04   
emb|CBI31413.3|  unnamed protein product                              48.9    5e-04   
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1              48.9    5e-04   
gb|AAM12784.1|  putative pectate-lyase                                48.9    5e-04   
ref|XP_009129418.1|  PREDICTED: putative pectate lyase 11             48.9    5e-04   
ref|NP_001268017.1|  probable pectate lyase 12-like precursor         48.9    5e-04   
gb|EPS62426.1|  hypothetical protein M569_12361                       48.9    5e-04   
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...  48.9    6e-04   
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like        48.9    6e-04   
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22             48.5    6e-04   
emb|CDY28857.1|  BnaC06g26450D                                        48.5    6e-04   
ref|XP_004306262.1|  PREDICTED: probable pectate lyase 12             48.5    6e-04   
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8              48.5    6e-04   
gb|KJB30978.1|  hypothetical protein B456_005G174600                  48.5    6e-04   
emb|CDX83690.1|  BnaC07g24300D                                        48.5    6e-04   
gb|KHN05801.1|  Putative pectate lyase 22                             48.5    6e-04   
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8              48.5    6e-04   
ref|XP_009631254.1|  PREDICTED: probable pectate lyase 18             48.5    7e-04   
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like        48.5    7e-04   
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1              48.5    7e-04   
gb|KJB30976.1|  hypothetical protein B456_005G174600                  48.5    7e-04   
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg           48.5    7e-04   
gb|KEH35002.1|  pectate lyase family protein                          48.1    7e-04   
ref|XP_009111570.1|  PREDICTED: putative pectate lyase 11             48.5    7e-04   
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5              48.5    7e-04   
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8              48.5    7e-04   
emb|CDY20049.1|  BnaA09g02020D                                        48.5    7e-04   
emb|CDY00156.1|  BnaC09g01450D                                        48.5    7e-04   
gb|KJB30977.1|  hypothetical protein B456_005G174600                  48.5    7e-04   
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1              48.5    7e-04   
ref|XP_003552152.2|  PREDICTED: probable pectate lyase 20-like        48.5    7e-04   
ref|XP_002316399.2|  hypothetical protein POPTR_0010s23570g           48.5    7e-04   
gb|ACJ83349.1|  unknown                                               47.8    7e-04   
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18             48.5    7e-04   
ref|XP_011024356.1|  PREDICTED: probable pectate lyase 13 isoform X1  48.5    7e-04   
ref|XP_006351443.1|  PREDICTED: probable pectate lyase 18-like        48.1    8e-04   
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8              48.5    8e-04   
gb|AAL06861.1|  At1g04680/T1G11_6                                     48.1    8e-04   
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22             48.1    8e-04   
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5              48.1    8e-04   
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18             48.1    8e-04   
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like        48.1    9e-04   
ref|XP_009788173.1|  PREDICTED: probable pectate lyase 18             48.1    9e-04   
ref|NP_563715.1|  putative pectate lyase 1                            48.1    9e-04   
ref|XP_009614672.1|  PREDICTED: probable pectate lyase 13 isoform X1  48.1    9e-04   
ref|XP_003526981.1|  PREDICTED: probable pectate lyase 18-like        48.1    9e-04   
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2   48.1    0.001   
ref|XP_003638513.1|  Pectate lyase                                    48.1    0.001   
ref|XP_002304700.1|  pectate lyase family protein                     48.1    0.001   
gb|ABK25017.1|  unknown                                               48.1    0.001   
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like        48.1    0.001   
gb|EPS69872.1|  hypothetical protein M569_04891                       48.1    0.001   
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                  48.1    0.001   
gb|EEC76710.1|  hypothetical protein OsI_14719                        48.1    0.001   
gb|AFZ78654.1|  pectate lyase                                         48.1    0.001   
gb|EEE60442.1|  hypothetical protein OsJ_13660                        48.1    0.001   
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5              48.1    0.001   
gb|KEH41255.1|  pectate lyase family protein                          48.1    0.001   



>ref|XP_009797403.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=439

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 2/85 (2%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR-GSH  366
            A IAE+DAYL+K+A EAL SSL AY  +PEE+TD FN EVGDT++N T + RRHL+  S 
Sbjct  26   AGIAEFDAYLEKQAKEALNSSLAAYNEHPEEITDTFNREVGDTLLNIT-SLRRHLKEKSS  84

Query  367  CKATNSIDRCWRCDQDWAKHRKRLA  441
            C  TN IDRCWRCD++WAK+RK+LA
Sbjct  85   CMTTNPIDRCWRCDENWAKNRKKLA  109



>ref|XP_009627245.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=440

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 2/85 (2%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR-GSH  366
            A IAE+DAYL+ KA EAL SSL AY  +PE+VT+ FN EVGDT++N T + RRHL+  S 
Sbjct  26   AQIAEFDAYLENKAKEALNSSLAAYNEHPEQVTNTFNREVGDTLLNIT-SLRRHLKEKSS  84

Query  367  CKATNSIDRCWRCDQDWAKHRKRLA  441
            C ATN IDRCWRCD++WAK+RK+LA
Sbjct  85   CMATNPIDRCWRCDENWAKNRKKLA  109



>ref|XP_011071024.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=441

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHC  369
            A IA +D  L+K+A E+ Q SLQ Y  NP+++TD FNE VG T+MN  N TRR+L    C
Sbjct  28   AKIATFDEDLQKRAAESYQESLQEYNPNPQDLTDEFNELVGKTLMN-ENVTRRNLGEDDC  86

Query  370  KATNSIDRCWRCDQDWAKHRKRLA  441
            KATN IDRCWRCD+DWAKHRKRLA
Sbjct  87   KATNPIDRCWRCDRDWAKHRKRLA  110



>ref|XP_009599232.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=445

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 67/94 (71%), Gaps = 12/94 (13%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
             A+IAE+D YL+KKA+EAL+SSL AY  NPEE+TD FN+EVG+TI N    TRRHL+   
Sbjct  26   HANIAEFDPYLEKKAEEALKSSLAAYNENPEELTDTFNKEVGETIFNG---TRRHLKEED  82

Query  367  ---------CKATNSIDRCWRCDQDWAKHRKRLA  441
                     CKA N ID+CWRCD++WA +RK LA
Sbjct  83   KDDKDDNDGCKAYNPIDKCWRCDKNWANNRKALA  116



>ref|XP_009758350.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=445

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 67/93 (72%), Gaps = 12/93 (13%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  366
            A+IAE+D YL+KKA+EAL+SSL AY  NPEE+TD FN+EVG+TI N    TRRHL+    
Sbjct  27   ANIAEFDPYLEKKAEEALKSSLAAYNENPEELTDTFNKEVGETIFNG---TRRHLKEEDK  83

Query  367  --------CKATNSIDRCWRCDQDWAKHRKRLA  441
                    CKA N ID+CWRCD++WA +RK LA
Sbjct  84   DDKDDNDGCKAYNPIDKCWRCDKNWANNRKALA  116



>emb|CDP00293.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHC  369
            A I E+D +L+K+A++ALQ+SL+AY  +PE VTDNF  +VG  ++   N TRR L+   C
Sbjct  34   AHIGEFDDFLRKRAEDALQASLRAYNPDPEAVTDNFTRQVG-KMLEGGNETRRQLKAGGC  92

Query  370  KATNSIDRCWRCDQDWAKHRKRLA  441
             ATN IDRCWRCD +WAK+RKRLA
Sbjct  93   VATNPIDRCWRCDPNWAKNRKRLA  116



>gb|EYU28712.1| hypothetical protein MIMGU_mgv1a006498mg [Erythranthe guttata]
Length=442

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  366
            A IA+YD YL+KKA+E+   SL+A+  NPE+V D  NE+VG+T+++  N +RRHL+  + 
Sbjct  29   AAIAKYDDYLRKKANESFAESLKAFDPNPEKVADELNEQVGETLVH-ENLSRRHLKEEND  87

Query  367  CKATNSIDRCWRCDQDWAKHRKRLA  441
            CKATN IDRCWRCD DW+K+RK+LA
Sbjct  88   CKATNPIDRCWRCDGDWSKNRKKLA  112



>ref|XP_002311599.2| pectate lyase family protein [Populus trichocarpa]
 gb|EEE88966.2| pectate lyase family protein [Populus trichocarpa]
Length=441

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---R  357
            Q  I E+D Y KKKADEAL+++ +A+Y +P  VT+ FN +V + +M  TN+TRR L   R
Sbjct  25   QGHIGEFDEYWKKKADEALKAAQEAFYPDPMNVTNQFNFQV-NKVMTETNSTRRSLVSKR  83

Query  358  GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
            G  C ATN IDRCWRCD +WA HR++LA
Sbjct  84   GGRCMATNPIDRCWRCDPNWASHRQKLA  111



>ref|XP_006363934.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=439

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHC  369
            A IAE+DAYL+K+A E L SSL+AY HNPEEVT+ FN+EVG+ ++ + +  R     + C
Sbjct  26   ARIAEFDAYLEKQALEDLNSSLEAYTHNPEEVTNAFNKEVGNALLKYKSLRRNLKEKNKC  85

Query  370  KATNSIDRCWRCDQDWAKHRKRL  438
             ATN IDRCWRCD++WA++R  L
Sbjct  86   MATNPIDRCWRCDKNWAENRMDL  108



>ref|XP_004228388.1| PREDICTED: pectate lyase [Solanum lycopersicum]
Length=439

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR-GSH  366
            A IAE+D YL+K+A EAL SSL+AY +NPEE+T+ FN+EVG+ ++ +  + RRHL+    
Sbjct  26   ARIAEFDPYLEKQALEALNSSLEAYTNNPEEITNAFNKEVGNALLKY-KSLRRHLKEKDK  84

Query  367  CKATNSIDRCWRCDQDWAKHRKRL  438
            C ATN IDRCWRCD++WA++R  L
Sbjct  85   CMATNPIDRCWRCDKNWAENRMDL  108



>gb|EYU22437.1| hypothetical protein MIMGU_mgv1a006496mg [Erythranthe guttata]
Length=442

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +1

Query  199  AEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGS-HCKA  375
            A  D YL+KKA+EA Q SLQAY  +PEE+T+ FNE VG+T++   N TRR L+ +  C A
Sbjct  31   ATMDEYLQKKAEEAYQESLQAYNPHPEELTEEFNELVGETLIG-QNATRRQLKQTGECMA  89

Query  376  TNSIDRCWRCDQDWAKHRKRLA  441
            TN IDRCWRCD++WAK+RK+LA
Sbjct  90   TNPIDRCWRCDRNWAKNRKKLA  111



>ref|XP_010320663.1| PREDICTED: probable pectate lyase 3 [Solanum lycopersicum]
Length=386

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 22/103 (21%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  366
            A+IA++D YL+K+A+EALQSSL AY  NPE VT  FN+EVG+T++N    TRRHL+    
Sbjct  28   ANIADFDPYLEKRAEEALQSSLAAYNENPEGVTQIFNKEVGETLLNG---TRRHLKEKDK  84

Query  367  ------------------CKATNSIDRCWRCDQDWAKHRKRLA  441
                              CKA N ID+CWRCD++WA +RK LA
Sbjct  85   EDKNDKDDKEGDEKSVDGCKAYNPIDKCWRCDKNWANNRKALA  127



>gb|EPS73633.1| hypothetical protein M569_01123, partial [Genlisea aurea]
Length=455

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 3/83 (4%)
 Frame = +1

Query  199  AEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--SHCK  372
            A+ D Y+K +A+EA + SL+AY  NPE+V + FN+ V D+++   N+TRR LRG    C+
Sbjct  20   AQLDEYMKSRAEEARRESLKAYKDNPEDVAEQFNQLVSDSLIG-ANSTRRDLRGVGGGCR  78

Query  373  ATNSIDRCWRCDQDWAKHRKRLA  441
            ATN IDRCWRCD DWAK+RK+LA
Sbjct  79   ATNPIDRCWRCDNDWAKNRKKLA  101



>emb|CAN79927.1| hypothetical protein VITISV_042447 [Vitis vinifera]
Length=439

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A I E+D   +K+A+EA +++L+AY  NPEEVT+ FN+ V  + M  TNTTRR+LR ++
Sbjct  25   RAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKS-MQGTNTTRRNLRSNN  83

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRC QDWAK+RK+LA
Sbjct  84   GPCMATNPIDRCWRCKQDWAKNRKKLA  110



>ref|XP_002282500.3| PREDICTED: pectate lyase [Vitis vinifera]
Length=443

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A I E+D   +K+A+EA +++L+AY  NPEEVT+ FN+ V  + M  TNTTRR+LR ++
Sbjct  29   RAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKS-MQGTNTTRRNLRSNN  87

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRC QDWAK+RK+LA
Sbjct  88   GPCMATNPIDRCWRCKQDWAKNRKKLA  114



>emb|CBI22159.3| unnamed protein product [Vitis vinifera]
Length=468

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A I E+D   +K+A+EA +++L+AY  NPEEVT+ FN+ V  + M  TNTTRR+LR ++
Sbjct  54   RAHIGEFDEVWQKRAEEAQKAALEAYQPNPEEVTNQFNKNVRKS-MQGTNTTRRNLRSNN  112

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRC QDWAK+RK+LA
Sbjct  113  GPCMATNPIDRCWRCKQDWAKNRKKLA  139



>ref|XP_006357289.1| PREDICTED: probable pectate lyase 3-like [Solanum tuberosum]
Length=459

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 66/106 (62%), Gaps = 25/106 (24%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  366
            A+IA++D YL+K+A+EALQSSL AY  NPE VT  FN+EVG+TI+N    TRRHL+    
Sbjct  28   ANIADFDPYLEKRAEEALQSSLAAYNENPEAVTQIFNKEVGETILNG---TRRHLKEEDK  84

Query  367  ---------------------CKATNSIDRCWRCDQDWAKHRKRLA  441
                                 CKA N ID+CWRCD++WA +RK LA
Sbjct  85   EDKNEKVEKDDKEGDEKSVDICKAYNPIDKCWRCDKNWANNRKALA  130



>ref|XP_010112093.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXC32626.1| putative pectate lyase 7 [Morus notabilis]
Length=437

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  360
            QA+I ++D   +++A+EA +++L+AY  NPEEVTD+FNEEV D +++ +N+TRR LR   
Sbjct  23   QANIGDFDESWQQRAEEAHKAALEAYDPNPEEVTDSFNEEV-DKVIDGSNSTRRELRRYS  81

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRC  +WA +RKRLA
Sbjct  82   GPCAATNPIDRCWRCRSNWASNRKRLA  108



>ref|XP_011025954.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=441

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 4/88 (5%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---R  357
            Q  I E+D Y KKKADEA +++ +A+Y +P  VT  FN +V + ++  TN+TRR L   R
Sbjct  25   QGHIGEFDEYWKKKADEARKAAQEAFYPDPLNVTSQFNFQV-NKVLTETNSTRRSLVRKR  83

Query  358  GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
            G  C ATN IDRCWRCD +WA HR++LA
Sbjct  84   GGRCIATNPIDRCWRCDPNWASHRQKLA  111



>ref|XP_008443432.1| PREDICTED: probable pectate lyase 19 [Cucumis melo]
Length=441

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 6/90 (7%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  354
            +A IAE+D YL +KA+EA Q+SL+A++ +P  VTD+FN+ V   +  +  +N+TRR L  
Sbjct  24   RAGIAEFDDYLLQKAEEAKQASLEAFHPDPMNVTDHFNQHVHLALEGIEGSNSTRRSLAK  83

Query  355  -RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
             +G  C ATN IDRCWRCD +WAK+RK+LA
Sbjct  84   YKGP-CLATNPIDRCWRCDPNWAKNRKKLA  112



>ref|XP_011086389.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=442

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSHC  369
            A IA+YD YLKK+A  +L+ S +A+  NPEE+ D+ N++V +T+       +R+LR   C
Sbjct  30   AAIAKYDEYLKKRAQASLEESRKAFNPNPEELADDLNDQVSETLTR--EGGKRNLRQGGC  87

Query  370  KATNSIDRCWRCDQDWAKHRKRLA  441
            KATN IDRCWRCD +W K+RK+LA
Sbjct  88   KATNPIDRCWRCDPNWDKNRKQLA  111



>ref|XP_009342871.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=454

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 65/95 (68%), Gaps = 12/95 (13%)
 Frame = +1

Query  193  DIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM--------NWTNTTRR  348
            +IA +DA  +++  +A +++L+AY  NPE+VT++FNE V  T++        +  N+TRR
Sbjct  31   NIANFDAVWQERGMKAQKAALKAYQPNPEQVTEDFNESVEQTVVEEDLEDDQSAGNSTRR  90

Query  349  HLRGSH----CKATNSIDRCWRCDQDWAKHRKRLA  441
            HLRG H    CKATN IDRCWRC  +WA +RK+LA
Sbjct  91   HLRGKHNKGPCKATNPIDRCWRCRANWANNRKKLA  125



>ref|XP_007037229.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY21730.1| Pectate lyase family protein [Theobroma cacao]
Length=434

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 65/88 (74%), Gaps = 5/88 (6%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---R  357
            +A+I E+D   +K+A+EA +++L+AY  NPE+VTDN N+E G   +  +N+TRR+L   R
Sbjct  22   KANIGEFDEVWQKRAEEAKKAALRAYEPNPEKVTDNLNKETGKA-LKGSNSTRRNLGRYR  80

Query  358  GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
            G  C ATN IDRCWRCD  WA++RK+LA
Sbjct  81   GP-CLATNPIDRCWRCDPHWAENRKKLA  107



>gb|KGN59593.1| hypothetical protein Csa_3G827350 [Cucumis sativus]
Length=441

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 4/89 (4%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLR-  357
            +A IAE+D +L +K++EA Q+SL+A++ +P  VTD+FN+ V   +  +  +N+TRR L  
Sbjct  24   RAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLALEGIEGSNSTRRSLSK  83

Query  358  -GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                C ATN IDRCWRCD +WAK+RK+LA
Sbjct  84   YNGPCLATNPIDRCWRCDPNWAKNRKKLA  112



>ref|XP_004147462.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
 ref|XP_004163529.1| PREDICTED: probable pectate lyase 7-like [Cucumis sativus]
Length=431

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 4/89 (4%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLR-  357
            +A IAE+D +L +K++EA Q+SL+A++ +P  VTD+FN+ V   +  +  +N+TRR L  
Sbjct  14   RAGIAEFDDFLLQKSEEAKQASLEAFHPDPMNVTDHFNQHVHLALEGIEGSNSTRRSLSK  73

Query  358  -GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                C ATN IDRCWRCD +WAK+RK+LA
Sbjct  74   YNGPCLATNPIDRCWRCDPNWAKNRKKLA  102



>ref|XP_007227702.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
 gb|EMJ28901.1| hypothetical protein PRUPE_ppa005744mg [Prunus persica]
Length=446

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 61/86 (71%), Gaps = 6/86 (7%)
 Frame = +1

Query  199  AEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH----  366
             + D Y K++A+EA + ++Q++  +PE+VT+ FN  VG+ +M   N TRRHLRG+     
Sbjct  34   VQLDIYWKQRAEEAKKEAMQSFETDPEQVTEEFNSNVGELLMK-QNGTRRHLRGNKKYNG  92

Query  367  -CKATNSIDRCWRCDQDWAKHRKRLA  441
             C ATN +D CWRCD++WAK+RKRLA
Sbjct  93   PCMATNPMDACWRCDKNWAKNRKRLA  118



>emb|CAN69905.1| hypothetical protein VITISV_001007 [Vitis vinifera]
Length=358

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  360
            +A+IAEYD Y K++ +EA +++L+A++  P+EV D+FN  V D +   +N TRR LR   
Sbjct  25   RANIAEYDDYWKEREEEAKKAALEAFHPTPQEVNDHFNLHVEDELTG-SNGTRRSLRVNK  83

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              CKATN IDRCWRC  +WA  RKRLA
Sbjct  84   GPCKATNPIDRCWRCRPNWASQRKRLA  110



>ref|XP_010105747.1| putative pectate lyase P59 [Morus notabilis]
 gb|EXC05967.1| putative pectate lyase P59 [Morus notabilis]
Length=421

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 61/90 (68%), Gaps = 7/90 (8%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---  360
            A IAE+D Y K +A++A + +LQAY+ +PEEVT+  N +V +  +   N+TRR LRG   
Sbjct  4    AHIAEFDDYWKSRAEQAQKDALQAYHPHPEEVTNQLNYDV-EEALTVKNSTRRVLRGKKN  62

Query  361  ---SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                 C ATN IDRCWRCD +WA +RKRLA
Sbjct  63   KKGGPCMATNPIDRCWRCDPNWASNRKRLA  92



>ref|XP_008221660.1| PREDICTED: probable pectate lyase 3 [Prunus mume]
Length=443

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 6/86 (7%)
 Frame = +1

Query  199  AEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG-----S  363
             + DAY K++A+EA + ++Q++  +PE VT+ FN  VG+ +M   N TRR+LRG      
Sbjct  31   VQLDAYWKQRAEEAEKVAMQSFQTDPELVTEEFNSNVGELLMKL-NGTRRNLRGVKKYNG  89

Query  364  HCKATNSIDRCWRCDQDWAKHRKRLA  441
             C ATN ID CWRCD++WAK+RKRLA
Sbjct  90   PCMATNPIDACWRCDKNWAKNRKRLA  115



>gb|KJB80030.1| hypothetical protein B456_013G077600 [Gossypium raimondii]
Length=376

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 4/89 (4%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-TNTTRRHLR--  357
            +A IAEYD Y +++  +A ++  +AY  NPEEVT +FN+ V  T+M + TN+TRR L+  
Sbjct  26   EAHIAEYDDYWRERELQAKENLEKAYNPNPEEVTQHFNDHVARTLMGFRTNSTRRMLKKQ  85

Query  358  -GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
             G  C ATN ID+CWRCD++W ++RK+LA
Sbjct  86   KGGPCGATNPIDQCWRCDRNWERNRKKLA  114



>ref|XP_004165454.1| PREDICTED: pectate lyase-like [Cucumis sativus]
 gb|KGN64253.1| hypothetical protein Csa_1G045510 [Cucumis sativus]
Length=439

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 65/87 (75%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  360
            +A+IA++D   +K+A EA ++S +AY  +PEE T+NFN++V  + ++  N TRRHLR   
Sbjct  27   KANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRS-LDGGNNTRRHLRKYT  85

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRCD++WA++RK+LA
Sbjct  86   GPCLATNPIDRCWRCDRNWARNRKKLA  112



>ref|XP_004152537.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=434

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 65/87 (75%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  360
            +A+IA++D   +K+A EA ++S +AY  +PEE T+NFN++V  + ++  N TRRHLR   
Sbjct  27   KANIADFDEVWQKRAIEAQKASFEAYEPHPEEETNNFNKQVHRS-LDGGNNTRRHLRKYT  85

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRCD++WA++RK+LA
Sbjct  86   GPCLATNPIDRCWRCDRNWARNRKKLA  112



>ref|XP_010096345.1| putative pectate lyase 7 [Morus notabilis]
 gb|EXB63820.1| putative pectate lyase 7 [Morus notabilis]
Length=399

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 7/88 (8%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG-----  360
            IAE+D Y K +A+EA + +LQAY  +P EVTD  N +V +  +   N TRR LRG     
Sbjct  6    IAEFDDYWKSRAEEARKDALQAYSPHPHEVTDQLNYDVQEA-LTAKNNTRRQLRGRKNKK  64

Query  361  -SHCKATNSIDRCWRCDQDWAKHRKRLA  441
               C ATN IDRCWRCD +WA +RKRLA
Sbjct  65   GGPCMATNPIDRCWRCDPNWANNRKRLA  92



>gb|KJB80029.1| hypothetical protein B456_013G077600 [Gossypium raimondii]
Length=442

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 4/89 (4%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-TNTTRRHLR--  357
            +A IAEYD Y +++  +A ++  +AY  NPEEVT +FN+ V  T+M + TN+TRR L+  
Sbjct  26   EAHIAEYDDYWRERELQAKENLEKAYNPNPEEVTQHFNDHVARTLMGFRTNSTRRMLKKQ  85

Query  358  -GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
             G  C ATN ID+CWRCD++W ++RK+LA
Sbjct  86   KGGPCGATNPIDQCWRCDRNWERNRKKLA  114



>ref|XP_007046218.1| Pectate lyase family protein, putative [Theobroma cacao]
 gb|EOY02050.1| Pectate lyase family protein, putative [Theobroma cacao]
Length=441

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---  360
            A IAEYD Y +++  EA +   +AY  NPEEVT +FN  V  T+M + N+TRR LRG   
Sbjct  26   AHIAEYDDYWRQREAEAKEHFNKAYNPNPEEVTQHFNHHVARTLMGF-NSTRRSLRGKRR  84

Query  361  -SHCKATNSIDRCWRCDQDWAKHRKRLA  441
               C+ATN ID+CWRCD +W ++RKRLA
Sbjct  85   TGPCQATNPIDQCWRCDPNWHRNRKRLA  112



>gb|KHG07401.1| putative pectate lyase P59 [Gossypium arboreum]
Length=442

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 4/89 (4%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-TNTTRRHLR--  357
            +A IAEYD Y +++  +A ++  +AY  NPEEVT +FN+ V   +M + TN+TRR L+  
Sbjct  26   EAHIAEYDDYWRERELQAKENLEKAYNPNPEEVTQHFNDHVARILMGFRTNSTRRMLKKR  85

Query  358  -GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
             G  C+ATN ID+CWRCD++W K+RK+LA
Sbjct  86   KGGPCEATNPIDQCWRCDRNWEKNRKKLA  114



>ref|XP_008339935.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 62/87 (71%), Gaps = 6/87 (7%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---  366
            + + DAY K++A+EA + ++++Y  NPE+VT+ FN EVG  +M+  NTTRR+LRG+    
Sbjct  39   VLDLDAYWKERAEEAEKVAMESYNKNPEKVTEEFNTEVGK-LMSKENTTRRNLRGNKAYT  97

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN +D CWRCD +WA +RK++ 
Sbjct  98   GPCMATNPMDACWRCDPNWANNRKKIV  124



>ref|XP_002270089.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32015.3| unnamed protein product [Vitis vinifera]
Length=443

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  360
            +A IAEYD Y K++ +EA +++L+A++  P+EV D+FN  V D +   +N TRR LR   
Sbjct  25   RAHIAEYDDYWKEREEEAKKAALEAFHPTPQEVNDHFNLHVEDELTG-SNGTRRSLRVNK  83

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              CKATN IDRCWRC  +WA  RKRLA
Sbjct  84   GPCKATNPIDRCWRCRPNWASQRKRLA  110



>ref|XP_008389523.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 3 [Malus 
domestica]
Length=452

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 62/87 (71%), Gaps = 6/87 (7%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---  366
            + + DAY K++A EAL+ ++++Y+ NPE+VT+ FN  V + +++  NTTRR+LRG+    
Sbjct  39   VLDLDAYWKERAQEALKEAMESYHKNPEQVTEEFNTGVAE-LLSKENTTRRNLRGNKGYN  97

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN ID CWRCD +WA +RK++ 
Sbjct  98   GPCMATNPIDACWRCDPNWADNRKKIV  124



>ref|XP_011013803.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=419

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 62/87 (71%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  360
            +A IA +D Y KK+A+EA ++S +AY  NPE+V  +FN+EV  + +   N+TRR+L    
Sbjct  7    KAGIANFDEYWKKRAEEAKEASREAYEPNPEKVAKHFNDEVHKS-LEGGNSTRRNLGKYK  65

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRCD++WAK+RK+L 
Sbjct  66   GPCLATNPIDRCWRCDKNWAKNRKKLG  92



>ref|XP_006374492.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
 gb|ERP52289.1| hypothetical protein POPTR_0015s07590g [Populus trichocarpa]
Length=435

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 62/87 (71%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL--RG  360
            +A IA +D Y KK+A+EA ++S +AY  NP +VT +FN+EV  + +   N+TRR+L    
Sbjct  23   KAGIANFDEYWKKRAEEAKEASREAYEPNPAKVTKHFNDEVHKS-LEGGNSTRRNLGKNK  81

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRCD++WAK+RK+L 
Sbjct  82   GPCLATNPIDRCWRCDKNWAKNRKKLG  108



>gb|AAQ62997.1| oil palm polygalacturonase allergen PEST411 [Elaeis guineensis]
Length=447

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 7/91 (8%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---  360
            ADI E D + +KKA+EAL  S  AY+ +PE VT++FN+ V   +    N+TRR LR    
Sbjct  26   ADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLALAEARNSTRRSLRAVGV  85

Query  361  ----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                  C ATN IDRCWRC ++W KHRK+LA
Sbjct  86   KKFKGKCVATNPIDRCWRCQKNWIKHRKKLA  116



>ref|XP_008357758.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=459

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 65/95 (68%), Gaps = 12/95 (13%)
 Frame = +1

Query  193  DIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM--------NWTNTTRR  348
            +IA +DA  +++A +A +++L+AY  NPE+VT++FNE V  T++        +  N+TRR
Sbjct  36   NIANFDAVWQERAMKAQKAALKAYQPNPEQVTEDFNESVEQTVVEEDLEDDQSAGNSTRR  95

Query  349  HLRG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            +LRG      CKATN IDRCWRC  +WA +RK+LA
Sbjct  96   NLRGKXYKGPCKATNPIDRCWRCRANWANNRKKLA  130



>ref|XP_010925369.1| PREDICTED: pectate lyase [Elaeis guineensis]
Length=444

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 7/91 (8%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---  360
            ADI E D + +KKA+EAL  S  AY+ +PE VT++FN+ V   +    N+TRR LR    
Sbjct  26   ADIPELDDHWQKKAEEALARSRAAYHPDPEAVTNHFNKAVHLALAEARNSTRRSLRAVGV  85

Query  361  ----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                  C ATN IDRCWRC ++W KHRK+LA
Sbjct  86   KKFKGKCVATNPIDRCWRCQKNWIKHRKKLA  116



>gb|KJB44678.1| hypothetical protein B456_007G265100 [Gossypium raimondii]
Length=439

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            QA IAEYD Y K +  EA+++  +AY+ NPEEV  ++N++   T++   N+TRR L+G+ 
Sbjct  24   QAHIAEYDDYWKARKLEAIENLNKAYHPNPEEVVHHYNDQFAKTMIKL-NSTRRELKGTK  82

Query  367  ----CKATNSIDRCWRCDQDWAKHRKRLAFVCPWLREWHNWG  480
                C+ TN +D CWRCD +W K+RKRLA   P        G
Sbjct  83   ENGPCEITNPVDSCWRCDPNWEKNRKRLADCAPGFARGTTGG  124



>ref|XP_006477525.1| PREDICTED: pectate lyase-like [Citrus sinensis]
Length=437

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (70%), Gaps = 5/89 (6%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  360
            +A+I ++D   +K+A+ A + +L+AY+ NPEEV  +FN+ V     N  N+TRR+LRG  
Sbjct  23   KANIHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFENG-NSTRRYLRGRP  81

Query  361  --SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                C ATN ID+CWRCD++WA +RKRLA
Sbjct  82   YTGRCAATNPIDQCWRCDRNWANNRKRLA  110



>ref|XP_010066949.1| PREDICTED: pectate lyase [Eucalyptus grandis]
 gb|KCW65002.1| hypothetical protein EUGRSUZ_G02541 [Eucalyptus grandis]
Length=436

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  360
            QA+I E+D Y  K+A+EA + +L+AY  +PE VT  FN +V D  +   N+TRR L+   
Sbjct  22   QANIEEFDEYWAKRAEEAQKDALKAYDPHPETVTSLFNAKV-DKAVRGNNSTRRQLKKYK  80

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRC+++WA++RKRLA
Sbjct  81   GPCLATNPIDRCWRCNRNWARNRKRLA  107



>gb|KJB78284.1| hypothetical protein B456_012G187800 [Gossypium raimondii]
Length=440

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            Q  I EYD Y K++  EA +++ QAY  NPEEVT + N  V  ++M   N+TRRHLR   
Sbjct  24   QGHIGEYDEYWKQRELEAKENTEQAYNPNPEEVTQHVNHLVSRSLMRL-NSTRRHLRARK  82

Query  358  -GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
             G  C  T+ ID+CWRCD++W K+R+RLA
Sbjct  83   KGGPCDPTSPIDQCWRCDRNWEKNRQRLA  111



>gb|KHN13652.1| Pectate lyase [Glycine soja]
Length=440

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A IAE+D +LK +ADEA + +L++Y  +P  VT  FN  V   +M  +N TRR L+  +
Sbjct  24   EAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRALMEESNDTRRELKQKY  83

Query  367  ---CKATNSIDRCWRCDQDWAKHRKRLA  441
               C ATN IDRCWRC +DWA+ R RLA
Sbjct  84   RGPCLATNPIDRCWRCRKDWAQDRYRLA  111



>ref|XP_003552513.1| PREDICTED: pectate lyase-like [Glycine max]
Length=440

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A IAE+D +LK +ADEA + +L++Y  +P  VT  FN  V   +M  +N TRR L+  +
Sbjct  24   EAGIAEFDDFLKAQADEAHEIALRSYEPDPINVTAEFNIHVHRALMEESNDTRRELKQKY  83

Query  367  ---CKATNSIDRCWRCDQDWAKHRKRLA  441
               C ATN IDRCWRC +DWA+ R RLA
Sbjct  84   RGPCLATNPIDRCWRCRKDWAQDRYRLA  111



>ref|XP_007032453.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY03379.1| Pectate lyase family protein [Theobroma cacao]
Length=454

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (63%), Gaps = 18/102 (18%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW------------T  333
            ADIAE+D   K++A++A +++L+AY   PE VT N N  V   ++              T
Sbjct  23   ADIAEFDEVWKQRAEQAWKNALEAYEPMPENVTSNLNYNVNKALLKGRANKTRAFEGVTT  82

Query  334  NTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLA  441
            N+TRR+LRG+H      C ATN IDRCWRC ++WA++RK+LA
Sbjct  83   NSTRRNLRGNHKKYIGPCMATNPIDRCWRCRKNWARNRKQLA  124



>ref|XP_010033216.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
Length=435

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            +A I E+D Y +K+A+EA Q++L+A+   PE VT  FN  V + +++  N+TRR L    
Sbjct  20   EAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANV-NKVLDGNNSTRRQLHMHK  78

Query  358  -GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                C ATN IDRCWRC ++WAK RKRLA
Sbjct  79   YSGPCLATNPIDRCWRCRKNWAKDRKRLA  107



>gb|KCW52797.1| hypothetical protein EUGRSUZ_J02132 [Eucalyptus grandis]
Length=451

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            +A I E+D Y +K+A+EA Q++L+A+   PE VT  FN  V + +++  N+TRR L    
Sbjct  23   EAHIKEFDEYWQKRAEEASQAALEAFNPEPENVTAQFNANV-NKVLDGNNSTRRQLHMHK  81

Query  358  -GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                C ATN IDRCWRC ++WAK RKRLA
Sbjct  82   YSGPCLATNPIDRCWRCRKNWAKDRKRLA  110



>gb|KJB80047.1| hypothetical protein B456_013G078300 [Gossypium raimondii]
Length=437

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  360
            +A IAEYD Y K +  EA ++  +AY+ NPEEV  ++N+    T++ + N+TRR L+G  
Sbjct  23   EAHIAEYDEYWKARELEATENLNKAYFPNPEEVVQHYNDHFARTMLEF-NSTRRALKGKK  81

Query  361  -SHCKATNSIDRCWRCDQDWAKHRKRLAFVCP  453
               C+ TN +D CWRCD +W K+RKRLA   P
Sbjct  82   KGPCEITNPVDSCWRCDPNWEKNRKRLADCAP  113



>gb|AAQ62996.1| oil palm polygalacturonase allergen PEST361 [Elaeis guineensis]
Length=447

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 57/91 (63%), Gaps = 7/91 (8%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  366
            A+I E+D + +KKA+EAL  S  AY  +PE VT +FN+ V   +    N+TRR LR  H 
Sbjct  26   ANIVEFDDHWQKKAEEALARSRAAYNPDPEAVTHDFNKAVHLALSEARNSTRRTLRSVHR  85

Query  367  ------CKATNSIDRCWRCDQDWAKHRKRLA  441
                  C ATN IDRCWRC ++W  HRK+LA
Sbjct  86   NKFKGPCVATNPIDRCWRCQKNWINHRKKLA  116



>ref|XP_010915114.1| PREDICTED: LOW QUALITY PROTEIN: pectate lyase-like [Elaeis guineensis]
Length=444

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 57/91 (63%), Gaps = 7/91 (8%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  366
            A+I E+D + +KKA+EAL  S  AY  +PE VT +FN+ V   +    N+TRR LR  H 
Sbjct  26   ANIVEFDDHWQKKAEEALARSRAAYNPDPEGVTHDFNKAVHLALSEARNSTRRTLRSVHR  85

Query  367  ------CKATNSIDRCWRCDQDWAKHRKRLA  441
                  C ATN IDRCWRC ++W  HRK+LA
Sbjct  86   NKFKGPCVATNPIDRCWRCQKNWINHRKKLA  116



>gb|KHG08055.1| putative pectate lyase P59 [Gossypium arboreum]
 gb|KHG08558.1| putative pectate lyase P59 [Gossypium arboreum]
Length=440

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 5/89 (6%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            Q  I EYD   K++  EA +++ QAY  NPEEVT + N  V  ++M   N+TRRHLR   
Sbjct  24   QGHIGEYDENWKQRELEAKENTEQAYNPNPEEVTQHVNHLVSRSLMGL-NSTRRHLRARK  82

Query  358  -GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
             G  C  TN ID+CWRCD++W K+R+RLA
Sbjct  83   KGGPCDPTNPIDQCWRCDRNWEKNRQRLA  111



>ref|XP_011005067.1| PREDICTED: probable pectate lyase P59 [Populus euphratica]
Length=452

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 65/102 (64%), Gaps = 18/102 (18%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW------------T  333
            ADIA +D   +K+A+EA + +L +Y  NPE+ TD+FN EV +T++++             
Sbjct  23   ADIAFFDEVWQKRAEEAKKVTLNSYVPNPEDATDDFNFEVNNTLVDFDDDGNDAGFELLA  82

Query  334  NTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLA  441
            N+TRR+L+         CK TN ID+CWRC ++WA++RKRLA
Sbjct  83   NSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLA  124



>gb|KHN45481.1| Putative pectate lyase 3 [Glycine soja]
Length=379

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 9/91 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            +A IAE+D +LK +ADEA + +L+AY   PE+VTD  N  V    ++  N+TRR LR   
Sbjct  24   EAGIAEFDDFLKAQADEAQKIALEAYVPVPEDVTDELNFHVH---LSLENSTRRELRQRK  80

Query  358  ---GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               G  C A+N ID CWRC+++WA  R RLA
Sbjct  81   GRSGKKCVASNPIDTCWRCNKNWANDRYRLA  111



>ref|XP_008341537.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=454

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 62/95 (65%), Gaps = 12/95 (13%)
 Frame = +1

Query  193  DIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT--------NTTRR  348
            +IAE+D+  +++A +A +++L+AY  NPE+VT++FNE V  TI+           N+T R
Sbjct  31   NIAEFDSVWQQRALKAQKAALKAYQPNPEQVTEDFNESVEMTIIEDDHDDDHAAGNSTGR  90

Query  349  HLRG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            HL G      CKATN IDRCWRC  +WA +RK LA
Sbjct  91   HLLGKRYTGPCKATNPIDRCWRCQANWADNRKHLA  125



>gb|KJB80049.1| hypothetical protein B456_013G078500 [Gossypium raimondii]
Length=437

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  360
            +A IAEYD Y K +  EA+++  +AY+ NPEEV  ++N+   +T++ + N TRR L+G  
Sbjct  23   RAHIAEYDKYWKARELEAIENLNKAYHPNPEEVVRHYNDHFVNTMLEY-NNTRRVLKGKK  81

Query  361  -SHCKATNSIDRCWRCDQDWAKHRKRLAFVCP  453
               C+ TN +D CWRCD +W K+RKRLA   P
Sbjct  82   NGPCEITNPVDSCWRCDPNWVKNRKRLADCAP  113



>ref|XP_002323835.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
 gb|EEF03968.1| hypothetical protein POPTR_0017s11450g [Populus trichocarpa]
Length=452

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 65/102 (64%), Gaps = 18/102 (18%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW------------T  333
            ADIA +D   +K+A+EA + +L +Y  NPE+ TD+FN EV +T++++             
Sbjct  23   ADIAFFDEVWQKRAEEAKKVTLNSYIPNPEDATDDFNFEVNNTLVDFDDDRNDAGFELHA  82

Query  334  NTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLA  441
            N+TRR+L+         CK TN ID+CWRC ++WA++RKRLA
Sbjct  83   NSTRRNLKQGKKKYLGPCKVTNPIDKCWRCRRNWARNRKRLA  124



>gb|KJB13233.1| hypothetical protein B456_002G064100 [Gossypium raimondii]
Length=454

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (59%), Gaps = 18/102 (18%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM------------NWT  333
            A+IAE+D + K++ +EA   +L  Y  NPE VT++FN  V   +               T
Sbjct  23   ANIAEFDDFWKQREEEAWNITLATYEPNPENVTNHFNYNVNKFLKETSANQTIDFEDGIT  82

Query  334  NTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLA  441
            N TRR+LRG H      C ATN IDRCWRC ++WAK+RKRLA
Sbjct  83   NNTRRYLRGKHKKYTGPCMATNPIDRCWRCKKNWAKNRKRLA  124



>gb|KJB80041.1| hypothetical protein B456_013G078000 [Gossypium raimondii]
Length=437

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  360
            +A IAEYD Y K +  EA+++  +AY+ NPEEV  ++N+   +T++ + N TRR L+G  
Sbjct  23   RAHIAEYDEYWKARELEAIENLNKAYHPNPEEVVRHYNDHFVNTMLEY-NNTRRVLKGKK  81

Query  361  -SHCKATNSIDRCWRCDQDWAKHRKRLAFVCP  453
               C+ TN +D CWRCD +W K+RKRLA   P
Sbjct  82   NGPCEITNPVDSCWRCDPNWVKNRKRLADCAP  113



>ref|XP_002511525.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF52127.1| Pectate lyase precursor, putative [Ricinus communis]
Length=433

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 64/88 (73%), Gaps = 5/88 (6%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR---HLR  357
            +A+IA +D   +++A EA  ++LQAY+ NPE++ ++FN+EV  ++ ++++T+ +   H R
Sbjct  22   KANIAHFDKVWQQRAKEASHAALQAYHPNPEDIVNHFNKEVAKSLNDFSSTSSQLSQHKR  81

Query  358  GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               C ATN IDRCWRCD +WA +RK+LA
Sbjct  82   --PCHATNPIDRCWRCDANWASNRKKLA  107



>ref|XP_008221658.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=443

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +1

Query  202  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG-----SH  366
            E D Y KK+AD+A   ++++Y  NPE VTD FN +VG+ IM   N TRR+L+G       
Sbjct  32   ELDEYWKKRADQAENYTMESYEPNPERVTDEFNAQVGELIMG-KNETRRNLKGQKKYVGP  90

Query  367  CKATNSIDRCWRCDQDWAKHRKRLA  441
            C  TN ID CWRCD +WA +R ++ 
Sbjct  91   CTVTNPIDACWRCDPNWANNRMKIV  115



>ref|XP_003554335.1| PREDICTED: pectate lyase-like [Glycine max]
Length=443

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 9/91 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            +A IAE+D +LK +ADEA + +L+AY   PE+VTD  N  V    ++  N+TRR LR   
Sbjct  28   EAGIAEFDDFLKAQADEAQKIALEAYVPVPEDVTDELNFHVH---LSLENSTRRELRQRK  84

Query  358  ---GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               G  C A+N ID CWRC+++WA  R RLA
Sbjct  85   GRSGKKCVASNPIDTCWRCNKNWANDRYRLA  115



>ref|XP_007224275.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
 gb|EMJ25474.1| hypothetical protein PRUPE_ppa019055mg [Prunus persica]
Length=443

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +1

Query  202  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG-----SH  366
            + D Y KK+A++A   ++++Y  NP+ VTD FN EVG+ IM   N TRR+L+G       
Sbjct  32   QLDEYWKKRAEQAENYTMESYEPNPQRVTDEFNAEVGELIMG-KNETRRNLKGQKKYVGP  90

Query  367  CKATNSIDRCWRCDQDWAKHRKRLA  441
            CK TN ID CWRCD +WA +R ++ 
Sbjct  91   CKVTNPIDSCWRCDPNWANNRMKIV  115



>emb|CBI15265.3| unnamed protein product [Vitis vinifera]
Length=398

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--GS  363
            A+I ++D   + +A+EA +++LQAY  +PE+VTDNFN++V  +  + TN TRR+L     
Sbjct  23   ANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVHKS-FDSTNHTRRNLSKFSG  81

Query  364  HCKATNSIDRCWRCDQDWAKHRKRLA  441
             C ATN IDRCWRC  DWA +R +LA
Sbjct  82   LCMATNPIDRCWRCRSDWASNRMKLA  107



>ref|XP_002272638.2| PREDICTED: pectate lyase-like [Vitis vinifera]
Length=434

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--GS  363
            A+I ++D   + +A+EA +++LQAY  +PE+VTDNFN++V  +  + TN TRR+L     
Sbjct  23   ANIGDFDEVWQTRAEEARKAALQAYNPHPEKVTDNFNKKVHKS-FDSTNHTRRNLSKFSG  81

Query  364  HCKATNSIDRCWRCDQDWAKHRKRLA  441
             C ATN IDRCWRC  DWA +R +LA
Sbjct  82   LCMATNPIDRCWRCRSDWASNRMKLA  107



>ref|XP_010068708.1| PREDICTED: pectate lyase-like [Eucalyptus grandis]
 gb|KCW64557.1| hypothetical protein EUGRSUZ_G02162 [Eucalyptus grandis]
Length=435

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 62/87 (71%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A+IA++D   +K+A+EA +++++AY  +P +V ++FN  V +  M  +N TRR L+ + 
Sbjct  23   RANIADFDEVWQKRAEEAKKATIKAYEPDPAKVAEDFNHRVHED-MQRSNNTRRSLKRTK  81

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRC +DWA HRKRLA
Sbjct  82   GGCLATNPIDRCWRCRKDWASHRKRLA  108



>ref|XP_008230729.1| PREDICTED: pectate lyase [Prunus mume]
Length=452

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 63/95 (66%), Gaps = 11/95 (12%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI-MNW------TNTTRR  348
            +++ ++DA  K++  +A +++L+AY  NPE+VTD+FNE V +   +N+      +N T R
Sbjct  29   SNVGQFDAVWKERELKAEKTALKAYQRNPEKVTDDFNESVQEVDDLNFEDDDQVSNITGR  88

Query  349  HLRG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            HL G      CKATN IDRCWRC +DWA  RK+LA
Sbjct  89   HLLGKKYKGPCKATNPIDRCWRCRKDWANDRKKLA  123



>ref|XP_009403112.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=437

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 55/89 (62%), Gaps = 7/89 (8%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  366
            A I ++D Y +KKA+ A   +  +Y  +PE VT +FNE V   +    N TRR LRG H 
Sbjct  23   AHIGDFDEYWQKKAEAARDRAQGSYNPDPESVTQSFNEAVSKDLEG--NVTRRSLRGKHK  80

Query  367  ----CKATNSIDRCWRCDQDWAKHRKRLA  441
                C ATN IDRCWRC +DW ++RKRLA
Sbjct  81   FNGPCVATNPIDRCWRCKKDWMQNRKRLA  109



>gb|KDO76053.1| hypothetical protein CISIN_1g013757mg [Citrus sinensis]
Length=437

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  360
            +A+  ++D   +K+A+ A + +L+AY+ NPEEV  +FN+ V     N + +TRR+LRG  
Sbjct  23   KANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFENGS-STRRYLRGRP  81

Query  361  --SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                C ATN ID+CWRCD++WA +RKRLA
Sbjct  82   YTGRCAATNPIDQCWRCDRNWANNRKRLA  110



>ref|XP_006439649.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
 gb|ESR52889.1| hypothetical protein CICLE_v10020193mg [Citrus clementina]
Length=437

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  360
            +A+  ++D   +K+A+ A + +L+AY+ NPEEV  +FN+ V     N + +TRR+LRG  
Sbjct  23   KANTHDFDEVWQKRAENARRHALEAYHPNPEEVVSSFNKHVHMMFENGS-STRRYLRGRP  81

Query  361  --SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                C ATN ID+CWRCD++WA +RKRLA
Sbjct  82   YTGRCAATNPIDQCWRCDRNWANNRKRLA  110



>ref|XP_002520133.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF42188.1| Pectate lyase precursor, putative [Ricinus communis]
Length=440

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 58/88 (66%), Gaps = 5/88 (6%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR----  357
            A+I ++D Y K+KAD A +++ ++Y  NP  V++  N +V   + + TN+TRR+L     
Sbjct  26   ANIGDFDEYWKQKADIAREAAYRSYNPNPFNVSNQLNYQVNKAV-SGTNSTRRNLMRRKG  84

Query  358  GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
            G  CKATN IDRCWRCD  WA +RKRL 
Sbjct  85   GGPCKATNPIDRCWRCDPKWALNRKRLV  112



>ref|XP_004489168.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=444

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 60/93 (65%), Gaps = 8/93 (9%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN-WTNTTRRHLR--  357
            +A IAE+D YLK++AD A Q +L++Y  NPE +T   N  V   +   ++N+TRR LR  
Sbjct  23   EAGIAEFDDYLKEQADLARQIALKSYVPNPENITTELNLHVNMAMEEAYSNSTRRELRQR  82

Query  358  -----GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                  S C ++N ID CWRC +DWA++R++LA
Sbjct  83   QKHGGSSACMSSNPIDNCWRCKKDWAQNRQQLA  115



>ref|XP_010256490.1| PREDICTED: pectate lyase-like [Nelumbo nucifera]
Length=441

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            +A IAE+D   +K+A+EA ++++ AY+ NP+EV ++ N  V    M  +N TRR L+   
Sbjct  25   RAHIAEFDEVWQKRAEEAKKNAMDAYHPNPDEVINHLNMNV-HLAMQESNGTRRSLKTKP  83

Query  358  -GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
             G  C ATN IDRCWRC ++W+++RK+LA
Sbjct  84   YGGPCLATNPIDRCWRCQKNWSRNRKKLA  112



>ref|XP_009360393.1| PREDICTED: probable pectate lyase 3 [Pyrus x bretschneideri]
Length=452

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 60/87 (69%), Gaps = 6/87 (7%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---  366
            + + DAY K++A EAL+ ++++Y+ NPE+  + F+  V + +++  NTTRR+LRG+    
Sbjct  39   VLDLDAYWKERAQEALKEAMESYHKNPEQAAEEFHTGVAE-LLSKENTTRRNLRGNKGYN  97

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN ID CWRCD +WA +RK++ 
Sbjct  98   GPCMATNPIDACWRCDANWANNRKKIV  124



>ref|XP_009794547.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=82

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 47/56 (84%), Gaps = 3/56 (5%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR  357
            A+IAE+D YL+KKA+EAL+SSL AY  NPEE+T+ FN+EVG+TI+N    TRR+L+
Sbjct  27   ANIAEFDPYLEKKAEEALKSSLAAYNENPEELTETFNKEVGETILNG---TRRYLK  79



>ref|XP_007215366.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
 gb|EMJ16565.1| hypothetical protein PRUPE_ppa005602mg [Prunus persica]
Length=452

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 63/95 (66%), Gaps = 11/95 (12%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI-MNW------TNTTRR  348
            +++ ++DA  K++  +A +++L+AY  NPE+VTD+FNE V +   +N+      +N T R
Sbjct  29   SNVGQFDAVWKERELKAEKAALKAYQPNPEKVTDDFNESVQEFDDLNFEDDDQVSNITGR  88

Query  349  HLRG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            HL G      CKATN IDRCWRC +DWA  RK+LA
Sbjct  89   HLLGKKYKGPCKATNPIDRCWRCRKDWANDRKKLA  123



>ref|XP_008793504.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=446

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  366
            A++AE+D + +KKA+EA   S  AY+ +PE VT+ FN+ V   +    N+TRR LR +  
Sbjct  28   ANMAEFDDHWQKKAEEAFARSRAAYHPDPEAVTNKFNKAVHLAVSQARNSTRRALRSAGV  87

Query  367  ------CKATNSIDRCWRCDQDWAKHRKRLA  441
                  C ATN IDRCWRC ++W ++RK+LA
Sbjct  88   NKFKGPCVATNPIDRCWRCRENWMENRKKLA  118



>ref|XP_008786760.1| PREDICTED: pectate lyase-like [Phoenix dactylifera]
Length=467

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL-----  354
            A++AE D + +KKA+EA   S  AY+ +PE VT++FN+ V   +    N+TRR L     
Sbjct  48   ANVAELDDHWQKKAEEAFARSRAAYHPDPEGVTNHFNQAVHLALAQARNSTRRGLKAVRA  107

Query  355  ---RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               R   C A+N IDRCWRC +DW K RK+LA
Sbjct  108  DKFRQGQCVASNPIDRCWRCQKDWIKDRKKLA  139



>ref|XP_004302354.1| PREDICTED: pectate lyase-like [Fragaria vesca subsp. vesca]
Length=447

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---SH  366
            IA +D  L+++   A  ++L+AY  +PE VTD   ++V +T +  +NTTRRHL     + 
Sbjct  33   IAVFDPVLQEREKRAEIAALKAYQPDPESVTDELIKDV-ETSIERSNTTRRHLAKKIKAE  91

Query  367  CKATNSIDRCWRCDQDWAKHRKRLA  441
            C ATN IDRCWRC+ DWAK+RK+LA
Sbjct  92   CTATNPIDRCWRCNPDWAKNRKQLA  116



>gb|KJB62823.1| hypothetical protein B456_009G438700 [Gossypium raimondii]
Length=454

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 59/102 (58%), Gaps = 18/102 (18%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN------------WT  333
            A+IAE+D + K++ DEA + +L AY  +PE VT + N  V   +               T
Sbjct  23   ANIAEFDDFWKQREDEAWKIALTAYEPSPENVTSHLNYHVNKVLEKPMSNQPLEFKDVIT  82

Query  334  NTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLA  441
            N+TRR LRG H      C A N IDRCWRC ++WAK+RKRLA
Sbjct  83   NSTRRSLRGKHRKYTGPCLAINPIDRCWRCKKNWAKNRKRLA  124



>ref|XP_008374522.1| PREDICTED: pectate lyase-like [Malus domestica]
Length=441

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (69%), Gaps = 4/87 (5%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  366
            A+IA +D + + +A EA Q++ +AY  NP EVT +FN+EV +T  +  N TRR+L+  + 
Sbjct  29   ANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSFNKEVHNT-FDSMNNTRRNLKEKYK  87

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRCD +W  +RK+LA
Sbjct  88   GPCVATNPIDRCWRCDPNWETNRKKLA  114



>ref|XP_009369346.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=441

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (69%), Gaps = 4/87 (5%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  366
            A+IA +D + + +A EA Q++ +AY  NP EVT +FN+EV +T  +  N TRR+L+  + 
Sbjct  29   ANIAVFDEHWQGRAKEAKQAANKAYNKNPAEVTGSFNKEVHNT-FDSMNNTRRNLKEKYK  87

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRCD +W  +RK+LA
Sbjct  88   GPCLATNPIDRCWRCDPNWETNRKKLA  114



>gb|KHG16093.1| hypothetical protein F383_07683 [Gossypium arboreum]
Length=454

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 15/98 (15%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM-NWTNTT--------  342
             +IA++D   K++AD+A +++L AY  +PE VT  FNE V   ++ N +N T        
Sbjct  26   GNIADFDDVWKRRADQAWKNTLAAYEPSPENVTSKFNENVHKALVANKSNKTKDLEGSED  85

Query  343  RRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRL  438
            RR+LRG H      C ATN IDRCWRC  DWA++RKRL
Sbjct  86   RRNLRGKHKKYTGPCMATNPIDRCWRCRPDWAENRKRL  123



>ref|XP_002306040.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
 gb|EEE86551.1| hypothetical protein POPTR_0004s12300g [Populus trichocarpa]
Length=432

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 56/90 (62%), Gaps = 14/90 (16%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR----  357
            ADI  +D   +K+A +A + +L+AY  +PEE TD FN EV        N TRR+LR    
Sbjct  23   ADIGIFDDVWQKRAQDAKKMTLEAYVPDPEEATDAFNVEV--------NNTRRNLRQGRK  74

Query  358  --GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                 C+ TN IDRCWRC ++WAK+RK+LA
Sbjct  75   KYAGPCQVTNPIDRCWRCQRNWAKNRKQLA  104



>emb|CDP14850.1| unnamed protein product [Coffea canephora]
Length=435

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  360
            +A IAE+D   +K+A+EA +++ QAY+ NPE VT +FNEEV  +I +  N+ RR  H   
Sbjct  22   EAHIAEFDEVWQKRAEEAKKAARQAYHPNPENVTSHFNEEVHRSI-DGHNSRRRDLHKYN  80

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN ID+CWRC ++W K+R +LA
Sbjct  81   GPCTATNPIDQCWRCQKNWRKNRMKLA  107



>ref|XP_002270112.1| PREDICTED: pectate lyase [Vitis vinifera]
 emb|CBI32014.3| unnamed protein product [Vitis vinifera]
Length=443

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  360
            +A IAEYD Y K +  EA   ++ A+  +PE+V D+FN+ V  +I    N TRR+L+   
Sbjct  25   RAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSIFG-KNGTRRNLKVNK  83

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              CKATN IDRCWRC ++WA  R+RLA
Sbjct  84   GPCKATNPIDRCWRCRRNWAMDRRRLA  110



>ref|XP_009389712.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=438

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 58/89 (65%), Gaps = 7/89 (8%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---  360
            A IA++D Y +KKA+ A   +  +Y  +PE VT +FNE V +     TN TRR LRG   
Sbjct  23   AHIADFDEYWQKKAEVAQSKARNSYNPDPESVTRHFNEAVYEDAQ--TNVTRRGLRGQKR  80

Query  361  SH--CKATNSIDRCWRCDQDWAKHRKRLA  441
            SH  C ATN IDRCWRC+++W  HRK+LA
Sbjct  81   SHGPCLATNPIDRCWRCNENWIHHRKQLA  109



>gb|KJB40824.1| hypothetical protein B456_007G078600 [Gossypium raimondii]
Length=454

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 15/98 (15%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM-NWTNTT--------  342
             +IA++D   K++AD+A +++L AY  +PE VT  FNE V   ++ N +N T        
Sbjct  26   GNIADFDDVWKRRADQAWKNTLAAYEPSPENVTTKFNENVHKALVANKSNKTKDLEGGDD  85

Query  343  RRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRL  438
            RR+LRG H      C ATN IDRCWRC  DWA++RKRL
Sbjct  86   RRNLRGKHKKYTGPCMATNPIDRCWRCRPDWAENRKRL  123



>ref|XP_009381244.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=423

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 53/89 (60%), Gaps = 7/89 (8%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---  360
            A IAE+D Y +KK   A  +   AY  NPE VT +FN+ V   +    N TRR LRG   
Sbjct  9    AHIAEFDEYWQKKEAMARANVQNAYNPNPESVTKHFNDAVLKDLEK--NNTRRGLRGKRR  66

Query  361  --SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                C ATN IDRCWRC ++WA HRKRLA
Sbjct  67   YDGPCMATNPIDRCWRCQENWAHHRKRLA  95



>emb|CAN69904.1| hypothetical protein VITISV_001006 [Vitis vinifera]
Length=443

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  360
            +A IAEYD Y K +  EA   ++ A+  +PE+V D+FN+ V  +I    N TRR+L+   
Sbjct  25   RAHIAEYDDYWKAREKEAKTVAIDAFDPSPEDVNDDFNKNVEKSIFG-KNGTRRNLKVNK  83

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              CKATN IDRCWRC ++WA  R+RLA
Sbjct  84   GPCKATNPIDRCWRCRRNWAMDRRRLA  110



>gb|KJB62833.1| hypothetical protein B456_009G439300 [Gossypium raimondii]
Length=454

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 60/102 (59%), Gaps = 18/102 (18%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN------------WT  333
            A+IAE+D + K++ +EA + +L AY  +PE VT + N  V   +               T
Sbjct  23   ANIAEFDDFWKQREEEAWKIALAAYEPSPENVTCHLNYHVNKVLEKPMSNQVLEFKDVIT  82

Query  334  NTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLA  441
            N+TRR+LRG H      C A N IDRCWRC ++WAK+RKRLA
Sbjct  83   NSTRRYLRGKHKKYTGPCMAVNPIDRCWRCKKNWAKNRKRLA  124



>ref|XP_009408830.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 55/91 (60%), Gaps = 8/91 (9%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  360
             A IA+YD Y +KKA  A   +  AY  NPE VT +FNE V   +   +N+TRR LRG  
Sbjct  22   SAHIADYDEYWQKKAALARSHANNAYNPNPESVTHHFNEAVMRDLA--SNSTRRGLRGKM  79

Query  361  ----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                  C+ATN IDRC+RC  +W  HRK+LA
Sbjct  80   RNEDGACQATNPIDRCFRCQSNWVHHRKKLA  110



>ref|XP_003609009.1| Pectate lyase [Medicago truncatula]
Length=445

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  360
            +A+I  +D Y + ++D+A +++ QAY  NP+E+T N N  V    ++ +N+TRR L    
Sbjct  23   EANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHV-HKALSGSNSTRRELAKYK  81

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN ID CWRCD +W K+RK+LA
Sbjct  82   GPCSATNPIDSCWRCDPNWEKNRKKLA  108



>gb|AES91206.2| pectate lyase P59-like protein [Medicago truncatula]
Length=434

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  360
            +A+I  +D Y + ++D+A +++ QAY  NP+E+T N N  V    ++ +N+TRR L    
Sbjct  23   EANIVHFDQYWQNRSDDAKKAAQQAYKPNPQEITSNLNMHV-HKALSGSNSTRRELAKYK  81

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN ID CWRCD +W K+RK+LA
Sbjct  82   GPCSATNPIDSCWRCDPNWEKNRKKLA  108



>gb|KJB19290.1| hypothetical protein B456_003G094800 [Gossypium raimondii]
Length=434

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            + +I  +D   +++A+ A + + +AY  NPE VT +FN E  + ++   N TRR L   H
Sbjct  22   KGNIGHFDEVWQERAENAKKGAFKAYNPNPENVTSDFNRET-EKVLEGQNNTRRGLYKHH  80

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRCD +WAK RK+L 
Sbjct  81   GPCLATNPIDRCWRCDPNWAKDRKKLV  107



>ref|XP_009380431.1| PREDICTED: pectate lyase-like [Musa acuminata subsp. malaccensis]
Length=436

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 51/88 (58%), Gaps = 8/88 (9%)
 Frame = +1

Query  193  DIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR-----  357
            +I +YD Y  K+  EAL + +QAY   PE V ++FN      I    N+TRR LR     
Sbjct  24   NITDYDEYWVKREAEALSNIMQAYVSEPESVVNHFNTP---DIFQVFNSTRRSLRHGKGK  80

Query  358  GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
            G  C ATN IDRCWRC  DWA +RK LA
Sbjct  81   GRKCVATNPIDRCWRCRSDWASNRKLLA  108



>ref|XP_007151201.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
 gb|ESW23195.1| hypothetical protein PHAVU_004G026400g [Phaseolus vulgaris]
Length=441

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 59/91 (65%), Gaps = 9/91 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            +A IAE+D +L+ ++++A + +LQ+Y   PE VT++ N  V    ++  N TRR L+   
Sbjct  26   EAGIAEFDEFLRAQSEKAHEIALQSYVPTPEFVTNDLNYHVH---LSMQNVTRRGLKEGN  82

Query  358  ---GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               G  C+++N ID CWRC++DWAK R RLA
Sbjct  83   NAIGKPCESSNPIDNCWRCNKDWAKDRYRLA  113



>gb|AAB69758.1| putative pectate lyase Nt59 [Nicotiana tabacum]
Length=274

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT---NTTRRHLR  357
             A I ++D   +++A+EA + + Q Y  NPE VT  FN++V D++   T   N+TRR L 
Sbjct  25   MAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDSMKEVTVSNNSTRRGLG  84

Query  358  G----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   C  TN IDRCWRCD +WA +RKRLA
Sbjct  85   TKKYKGPCMVTNPIDRCWRCDPNWADNRKRLA  116



>gb|KHN13240.1| Putative pectate lyase 3 [Glycine soja]
Length=446

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 9/91 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            +A IAE+D +LK +ADEA + +L +Y   P +V    N  V    M   N+TRR LR   
Sbjct  24   EAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVH---MALENSTRRELRQRK  80

Query  358  ---GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               G  C+A+N ID CWRC++DWA  R RLA
Sbjct  81   LRGGGKCQASNPIDACWRCNKDWANDRFRLA  111



>gb|ACU23277.1| unknown [Glycine max]
Length=443

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 9/91 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            +A IAE+D +LK +ADEA + +L +Y   P +V    N  V    M   N+TRR LR   
Sbjct  28   EAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVH---MALENSTRRELRQRK  84

Query  358  ---GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               G  C+A+N ID CWRC++DWA  R RLA
Sbjct  85   LRGGGKCQASNPIDACWRCNKDWANDRFRLA  115



>ref|XP_003543726.1| PREDICTED: pectate lyase [Glycine max]
Length=443

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 9/91 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            +A IAE+D +LK +ADEA + +L +Y   P +V    N  V    M   N+TRR LR   
Sbjct  28   EAGIAEFDDFLKAQADEAHKIALDSYVPEPHDVAHELNFHVH---MALENSTRRELRQRK  84

Query  358  ---GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               G  C+A+N ID CWRC++DWA  R RLA
Sbjct  85   LRGGGKCQASNPIDACWRCNKDWANDRFRLA  115



>gb|KJB32164.1| hypothetical protein B456_005G227000 [Gossypium raimondii]
Length=454

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 63/103 (61%), Gaps = 18/103 (17%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV--------GDTIMNW----T  333
            A+I E+D + K++ +EA + +L +Y  NPE VT++ N +V         + I+ +    T
Sbjct  23   ANIVEFDDFWKQREEEAWKIALASYEPNPENVTNHLNYKVNKALNKRSSNKIIEFKGVIT  82

Query  334  NTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLAF  444
            N T R+LRG H      C ATN IDRCWRC ++WA++RKRLA 
Sbjct  83   NDTIRYLRGKHKKYTGPCMATNPIDRCWRCRENWAENRKRLAL  125



>ref|XP_008339934.1| PREDICTED: probable pectate lyase 3 [Malus domestica]
Length=452

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (69%), Gaps = 6/87 (7%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---  366
            + + DAY K++A+EA + +L++Y  NPE+VT+ FN EVG  ++   NTTRR+LRG+    
Sbjct  39   VLDLDAYWKQRAEEAEKEALESYNKNPEQVTEEFNNEVGKLMLK-ENTTRRNLRGNKAYK  97

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN ID CWRCD  WA +RK++ 
Sbjct  98   GPCMATNPIDACWRCDPYWANNRKKIV  124



>ref|XP_009779191.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 57/94 (61%), Gaps = 9/94 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI-----MNWTNTTRRH  351
             A I ++D   +++A+EA + + Q Y  NPE VT  FN++V DT+     +  +N+TRR 
Sbjct  25   MAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDTMKELRQVTVSNSTRRG  84

Query  352  LRG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            L        C  TN IDRCWRCD +WA +RKRLA
Sbjct  85   LGTKKYKGPCMVTNPIDRCWRCDPNWADNRKRLA  118



>ref|XP_008446316.1| PREDICTED: probable pectate lyase P59 [Cucumis melo]
Length=432

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--GS  363
            ADI ++D Y K +A EA Q++  AY  NPE + D+ N EVG   ++ +N+TRR+L+    
Sbjct  19   ADIGDFDDYWKARAAEAEQAAADAYEPNPETIADSLNAEVGQA-LSGSNSTRRNLKKYTG  77

Query  364  HCKATNSIDRCWRCDQDWAKHRKRLA  441
             C+ATN IDRCWRCD +WA++RK+LA
Sbjct  78   PCRATNPIDRCWRCDPNWAQNRKKLA  103



>ref|XP_007138209.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
 gb|ESW10203.1| hypothetical protein PHAVU_009G189800g [Phaseolus vulgaris]
Length=434

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL--RG  360
            QA+I ++D    ++  EA +++ QAY  NP +VT  FN  V    M  +N+TRR L  + 
Sbjct  23   QANIGQFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHVMRA-MKGSNSTRRGLGKKN  81

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C+A N ID+CWRCD DW K+RK+LA
Sbjct  82   DECEAANPIDKCWRCDPDWEKNRKKLA  108



>ref|XP_004231596.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=83

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 44/56 (79%), Gaps = 3/56 (5%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR  357
            A+I ++D YL+KKA+EALQSSL AY  NPE++T  FN+EVG+T+ N    TRR+LR
Sbjct  28   ANIGDFDPYLEKKAEEALQSSLAAYNENPEQLTQTFNKEVGETLFNG---TRRYLR  80



>ref|XP_009599825.1| PREDICTED: probable pectate lyase P59 isoform X1 [Nicotiana tomentosiformis]
Length=445

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT---NTTRRHLR  357
             A I ++D   +++A+EA + + Q Y  NPE VT  FN++V D++   T   N+TRR L 
Sbjct  25   MAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDSMKEVTVSNNSTRRGLG  84

Query  358  G----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   C  TN IDRCWRCD +WA +RKRLA
Sbjct  85   TKKYKGPCMVTNPIDRCWRCDPNWADNRKRLA  116



>emb|CDX70590.1| BnaC03g06740D [Brassica napus]
Length=475

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 38/123 (31%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN---------------------E  303
            QAD++E D Y  ++ADEA + +LQAY+ +P E+ D+F+                     E
Sbjct  23   QADMSELDEYWSQRADEAREFTLQAYHSDPYEIIDHFHERHYDNSTDITPTEEASNAKPE  82

Query  304  EVGDTIM-------NWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRK  432
            EV + ++       N TN+TRR LRG            C A+N ID+CWRC ++WAK RK
Sbjct  83   EVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRKNWAKRRK  142

Query  433  RLA  441
            +L 
Sbjct  143  KLV  145



>ref|XP_010670318.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = +1

Query  202  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--SHCKA  375
            E+D + ++K  EA  +SL AY+H+P EV ++FN  V    +  TN+TRR L      CKA
Sbjct  42   EHDEWFQRKLAEAYNASLLAYHHDPIEVMNHFNYHV-HRALEGTNSTRRGLNKYQGECKA  100

Query  376  TNSIDRCWRCDQDWAKHRKRLA  441
             N IDRCWRC  DWA  RK+LA
Sbjct  101  QNPIDRCWRCKADWAVDRKKLA  122



>gb|KHN11586.1| Putative pectate lyase 3 [Glycine soja]
Length=214

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A IAE+D +LK +A EA   +L++Y  +P  VT  FN  V   +M   N TRR L+  +
Sbjct  24   EAGIAEFDDFLKAQASEAQVIALKSYQPDPINVTAEFNIHVHRALMEEENDTRRELKQKY  83

Query  367  ---CKATNSIDRCWRCDQDWAKHRKR  435
               C ATN ID CWRC + WA+ R R
Sbjct  84   HGPCMATNPIDSCWRCRKHWAQDRFR  109



>ref|XP_006588322.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=196

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A IAE+D +LK +A EA   +L++Y  +P  VT  FN  V   +M   N TRR L+  +
Sbjct  24   EAGIAEFDDFLKAQASEAQVIALKSYQPDPINVTAEFNIHVHRALMEEENDTRRELKQKY  83

Query  367  ---CKATNSIDRCWRCDQDWAKHRKR  435
               C ATN ID CWRC + WA+ R R
Sbjct  84   HGPCMATNPIDSCWRCRKHWAQDRFR  109



>ref|XP_006842121.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
 gb|ERN03796.1| hypothetical protein AMTR_s00078p00106380 [Amborella trichopoda]
Length=438

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  360
            +A IA++D   + ++  A Q +L+AY H P  VTD+ N  V   +    N+TRRHL    
Sbjct  26   EAHIADFDETWQNRSAIARQVALEAYVHEPHNVTDHVNHMVHKALEG--NSTRRHLGKYT  83

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRC ++WA+ RKRLA
Sbjct  84   GACMATNPIDRCWRCQRNWARDRKRLA  110



>ref|XP_009615547.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=434

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  360
            +A I E+D   +K+A +A +++  AY+ NP+ V D+ N +V D  +  +N+ RR  H   
Sbjct  21   EAHIGEFDEVWRKRAQQAKKAARHAYHPNPKIVADHLNNQV-DKAVRGSNSRRRDLHRYN  79

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              CKATN ID+CWRCD +WA++R +LA
Sbjct  80   GQCKATNPIDQCWRCDPNWARNRMKLA  106



>gb|KGN47799.1| hypothetical protein Csa_6G404140 [Cucumis sativus]
Length=415

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +1

Query  208  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---CKAT  378
            D Y + +A EA + +  A+  NPE VTD  N  V  T++   N+TRR LR  +   C AT
Sbjct  25   DEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTMLGH-NSTRRSLRKKYRGPCLAT  83

Query  379  NSIDRCWRCDQDWAKHRKRLAFVCP  453
            N IDRCWRCD++WAK+R++LA  CP
Sbjct  84   NPIDRCWRCDRNWAKNRRKLA-ECP  107



>ref|XP_004146792.1| PREDICTED: probable pectate lyase P59-like, partial [Cucumis 
sativus]
Length=442

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +1

Query  208  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---CKAT  378
            D Y + +A EA + +  A+  NPE VTD  N  V  T++   N+TRR LR  +   C AT
Sbjct  32   DEYWQTRATEAKKVAQGAFNANPEIVTDTLNAAVSRTMLGH-NSTRRSLRKKYRGPCLAT  90

Query  379  NSIDRCWRCDQDWAKHRKRLAFVCP  453
            N IDRCWRCD++WAK+R++LA  CP
Sbjct  91   NPIDRCWRCDRNWAKNRRKLA-ECP  114



>ref|XP_011087066.1| PREDICTED: pectate lyase [Sesamum indicum]
Length=431

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 58/85 (68%), Gaps = 13/85 (15%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A IA+YD YL+KKA+ A + +L+A+  NPE++ D+ N +V +T  ++            
Sbjct  29   RAAIAKYDEYLQKKAEVASEEALKAFDPNPEKLADDLNYQVSETEDDF------------  76

Query  367  CKATNSIDRCWRCDQDWAKHRKRLA  441
             KATN IDRCWRCD++WA++R++LA
Sbjct  77   -KATNPIDRCWRCDRNWAQNRQKLA  100



>ref|XP_004162547.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
Length=435

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +1

Query  208  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---CKAT  378
            D Y + +A EA + +  A+  NPE VTD  N  V  T++   N+TRR LR  +   C AT
Sbjct  25   DEYWETRATEAKKVAQGAFNANPEIVTDTLNAAVSRTMLGH-NSTRRSLRKKYRGPCLAT  83

Query  379  NSIDRCWRCDQDWAKHRKRLAFVCP  453
            N IDRCWRCD++WAK+R++LA  CP
Sbjct  84   NPIDRCWRCDRNWAKNRRKLA-ECP  107



>gb|KJB60995.1| hypothetical protein B456_009G334500 [Gossypium raimondii]
Length=436

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 2/100 (2%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW--TNTTRRHLRG  360
            +A I EYD Y K +  EA+++  QAY+ NPEEV  ++N+    T++ +  T       + 
Sbjct  23   KAHITEYDEYWKARELEAIENLDQAYHSNPEEVVRHYNDHFSRTMLEFYITKKVLAESKK  82

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLAFVCPWLREWHNWG  480
              C+ TN +D CWRCD DW K+RK+LA   P        G
Sbjct  83   GACEVTNHVDSCWRCDPDWEKNRKKLADCAPGFARGTTGG  122



>ref|XP_002871648.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47907.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 62/119 (52%), Gaps = 35/119 (29%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE-------------EVGDT---  318
            + +I+E D Y  ++ADEA + +LQAY+ +P E+ D+F+E             E GD    
Sbjct  23   RGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDVTTTEEEGDAKPE  82

Query  319  ---------IMNWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRKRL  438
                     + + TN+TRR LRG            C A+N ID+CWRC  DWAK RKRL
Sbjct  83   EEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSDWAKRRKRL  141



>ref|XP_006363498.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=83

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 3/56 (5%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR  357
            A+I ++D YL+K+A+EALQSSL AY  NPE++T  FN+EVG+T+ N    TRR+LR
Sbjct  28   ANIGDFDPYLEKRAEEALQSSLAAYNENPEQLTQTFNKEVGETLFNG---TRRYLR  80



>ref|XP_007139601.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
 gb|ESW11595.1| hypothetical protein PHAVU_008G043600g [Phaseolus vulgaris]
Length=444

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = +1

Query  130  SHQISIfvfflllvfaatlQADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV  309
            S ++SI +     +    L+  I E+D +LK +A EA + +L++Y  +P  +TD+ N  V
Sbjct  5    SSKVSIIILVAFAITIPCLEGGIGEFDDFLKGQALEAHEIALESYVPDPVNMTDDLNINV  64

Query  310  GDTIMNW----TNTTRRHLR---GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               +       +N TRR L+   G  C A N IDRCWRC + WAK+R +LA
Sbjct  65   HGALTEVFKEESNHTRRELKQKYGGPCLALNPIDRCWRCKKGWAKNRFKLA  115



>ref|XP_008456459.1| PREDICTED: pectate lyase-like [Cucumis melo]
Length=434

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 53/84 (63%), Gaps = 4/84 (5%)
 Frame = +1

Query  208  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--SHCKATN  381
            D Y   +A EA + +  A+  NPE VTDN N  V   ++   N+TRR L+     C ATN
Sbjct  25   DEYWNTRATEAKKVAKSAFNPNPEIVTDNLNAAVSRAMVG-RNSTRRSLKKYRGPCLATN  83

Query  382  SIDRCWRCDQDWAKHRKRLAFVCP  453
             IDRCWRCD++WAK+RK+LA  CP
Sbjct  84   PIDRCWRCDRNWAKNRKKLA-ECP  106



>ref|XP_010242445.1| PREDICTED: pectate lyase [Nelumbo nucifera]
Length=443

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 58/92 (63%), Gaps = 7/92 (8%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV---GDTIMNWTNTTRRHLR  357
            +A I ++D   +K+A+EA  ++L+AY+ +P+EV ++FN  V      + +  ++TRR LR
Sbjct  27   RAHIGDFDEVWQKRAEEAKSNALEAYHPDPDEVINHFNHHVHLATAEVRSGNSSTRRSLR  86

Query  358  G----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   C ATN IDRCWRC   W K+RK+LA
Sbjct  87   NKEYKGPCMATNPIDRCWRCRSKWGKNRKKLA  118



>emb|CDX81636.1| BnaC08g39650D [Brassica napus]
Length=484

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 9/93 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLRG  360
            QA++A +D Y K++  +AL+ ++ +Y  NP  VTD+ N  V   +     TN TRR L G
Sbjct  25   QANVAIFDNYWKQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDATESTNNTRRELIG  84

Query  361  SH-------CKATNSIDRCWRCDQDWAKHRKRL  438
                     C A N ID+CWRCD +W K+RK+L
Sbjct  85   RETQEGSGKCIAYNPIDKCWRCDPNWEKNRKKL  117



>gb|KJB84349.1| hypothetical protein B456_N020200 [Gossypium raimondii]
Length=434

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTR--RHLRG  360
            +A IAEYD Y   +  EA+++  +AY+ NPEEV  ++N+    T++ +  T R     + 
Sbjct  21   EAHIAEYDEYWTARELEAIENLDKAYHSNPEEVVRHYNDHFSRTMLEFYITKRVLAESKK  80

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLAFVCPWL  459
              C+ TN +D CWRCD DW K+RK+LA   P  
Sbjct  81   GPCEVTNHVDSCWRCDPDWEKNRKKLADCAPGF  113



>ref|XP_009599826.1| PREDICTED: probable pectate lyase P59 isoform X2 [Nicotiana tomentosiformis]
Length=444

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 54/91 (59%), Gaps = 6/91 (7%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDT--IMNWTNTTRRHLRG  360
             A I ++D   +++A+EA + + Q Y  NPE VT  FN++V D   +    N+TRR L  
Sbjct  25   MAHIGDFDEVWRRRAEEAREYARQIYEPNPENVTLAFNQKVRDMKEVTVSNNSTRRGLGT  84

Query  361  ----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                  C  TN IDRCWRCD +WA +RKRLA
Sbjct  85   KKYKGPCMVTNPIDRCWRCDPNWADNRKRLA  115



>ref|XP_008239834.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=438

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 65/88 (74%), Gaps = 4/88 (5%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A+IA++D + +++A EA +++ +AY+ +P  VT++FN++V DT  ++ N TRR+L   +
Sbjct  25   RANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQVLDT-FDYANNTRRNLNQKY  83

Query  367  ---CKATNSIDRCWRCDQDWAKHRKRLA  441
               C ATN IDRCWRCD +W K+RKRLA
Sbjct  84   KGPCMATNPIDRCWRCDPNWEKNRKRLA  111



>ref|XP_007209148.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
 gb|EMJ10347.1| hypothetical protein PRUPE_ppa005859mg [Prunus persica]
Length=440

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 65/88 (74%), Gaps = 4/88 (5%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A+IA++D + +++A EA +++ +AY+ +P  VT++FN++V DT  ++ N TRR+L   +
Sbjct  27   RANIADFDEHWQQRAAEAKKAAHEAYHDDPIAVTEHFNKQVLDT-FDYANNTRRNLNQKY  85

Query  367  ---CKATNSIDRCWRCDQDWAKHRKRLA  441
               C ATN IDRCWRCD +W K+RKRLA
Sbjct  86   KGPCMATNPIDRCWRCDPNWEKNRKRLA  113



>gb|KJB62844.1| hypothetical protein B456_009G4398001, partial [Gossypium raimondii]
Length=195

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 58/101 (57%), Gaps = 18/101 (18%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN------------WT  333
            A+IAE+D + K++ +EA + +L AY  +PE VT + N  V   +               T
Sbjct  23   ANIAEFDDFWKQREEEAWKIALTAYERSPENVTSHLNYHVNKVLEKTMSNQPLEFKDVIT  82

Query  334  NTTRRHLRGSH-----CKATNSIDRCWRCDQDWAKHRKRLA  441
            N+TRR LRG H     C A N IDRCWRC ++ +K+RKRLA
Sbjct  83   NSTRRSLRGKHKNNSPCMAINPIDRCWRCKKN-SKNRKRLA  122



>ref|XP_004514773.1| PREDICTED: probable pectate lyase 3-like [Cicer arietinum]
Length=454

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---  366
            + E+D+Y +++A  A +++  AY+ +P  V+ NF   V + I     + RR LRG++   
Sbjct  36   VPEFDSYWQERAKVAKEANQAAYFVDPYAVSGNFTATVSEIIA--AKSARRSLRGNNNGT  93

Query  367  CKATNSIDRCWRCDQDWAKHRKRLA  441
            C ATN IDRCWRCD +WA +R++LA
Sbjct  94   CMATNPIDRCWRCDPNWANNRQKLA  118



>sp|Q9LFP5.1|PLY19_ARATH RecName: Full=Probable pectate lyase 19; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAC01830.1| pectate lyase-like protein [Arabidopsis thaliana]
Length=472

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 62/119 (52%), Gaps = 35/119 (29%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE-------------EVGDT---  318
            + +I+E D Y  ++ADEA + +LQAY+ +P E+ D+F+E             E GD    
Sbjct  23   RGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDVTTPEEDGDAKPE  82

Query  319  ---------IMNWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRKRL  438
                     + + TN+TRR LRG            C A+N ID+CWRC  DWAK RK+L
Sbjct  83   EEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSDWAKRRKKL  141



>ref|XP_011085780.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=447

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 58/97 (60%), Gaps = 13/97 (13%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVG---------DTIMNWTNT  339
            +ADIAEYD   +++A EA   ++QAY+ +P +V  +FN+ V          D +M   NT
Sbjct  24   RADIAEYDEVWRRRAAEAYNRTVQAYHPDPLKVVMHFNKHVNKHVEESGGLDDVM-MLNT  82

Query  340  TRRHLRGSH---CKATNSIDRCWRCDQDWAKHRKRLA  441
            TRRHL  ++   CK TN ID CWRC+  W  +R RLA
Sbjct  83   TRRHLGKAYKGPCKVTNPIDACWRCNPKWHLNRFRLA  119



>gb|ABK28696.1| unknown [Arabidopsis thaliana]
Length=473

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 62/119 (52%), Gaps = 35/119 (29%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE-------------EVGDT---  318
            + +I+E D Y  ++ADEA + +LQAY+ +P E+ D+F+E             E GD    
Sbjct  23   RGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDVTTPEEDGDAKPE  82

Query  319  ---------IMNWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRKRL  438
                     + + TN+TRR LRG            C A+N ID+CWRC  DWAK RK+L
Sbjct  83   EEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSDWAKRRKKL  141



>ref|NP_197015.4| putative pectate lyase 19 [Arabidopsis thaliana]
 gb|AED92118.1| putative pectate lyase 19 [Arabidopsis thaliana]
Length=472

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 62/119 (52%), Gaps = 35/119 (29%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE-------------EVGDT---  318
            + +I+E D Y  ++ADEA + +LQAY+ +P E+ D+F+E             E GD    
Sbjct  23   RGNISELDEYWSQRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDVTTPEEDGDAKPE  82

Query  319  ---------IMNWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRKRL  438
                     + + TN+TRR LRG            C A+N ID+CWRC  DWAK RK+L
Sbjct  83   EEEKEFIEMLGSSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRSDWAKRRKKL  141



>gb|KJB84350.1| hypothetical protein B456_N020100 [Gossypium raimondii]
Length=434

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 2/100 (2%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTR--RHLRG  360
            ++ IAEYD Y   +  EA+++  +AY+ NPEEV  ++N+    T++ +  T R     + 
Sbjct  21   ESHIAEYDEYWTARELEAIENLDKAYHSNPEEVVRHYNDHFSRTMLEFYITKRVLAESKK  80

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLAFVCPWLREWHNWG  480
              C+ TN +D CWRCD DW K+RK+LA   P        G
Sbjct  81   GPCEVTNHVDSCWRCDPDWEKNRKKLANCAPGFARGTTGG  120



>ref|XP_011085777.1| PREDICTED: probable pectate lyase P59 [Sesamum indicum]
Length=446

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 56/96 (58%), Gaps = 12/96 (13%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV-------GDTIMNWTNTTR  345
            +A+IAEYD   +++A EA   +LQAY  +P +V  +FNE V       G   M   N+TR
Sbjct  24   RANIAEYDEVWRRRAAEAYNRTLQAYEPDPLKVVMHFNENVHRHIKESGGVDMMMLNSTR  83

Query  346  RHL----RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
            R L    RG  CK TN ID CWRCD +W  +R +LA
Sbjct  84   RRLGKKYRGP-CKVTNPIDACWRCDPNWHLNRFKLA  118



>gb|KJB60998.1| hypothetical protein B456_009G334800 [Gossypium raimondii]
Length=434

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 2/100 (2%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTR--RHLRG  360
            ++ IAEYD Y   +  EA+++  +AY+ NPEEV  ++N+    T++ +  T R     + 
Sbjct  21   ESHIAEYDEYWTARELEAIENLDKAYHSNPEEVVRHYNDHFSRTMLEFYITKRVLAESKK  80

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLAFVCPWLREWHNWG  480
              C+ TN +D CWRCD DW K+RK+LA   P        G
Sbjct  81   GPCEVTNHVDSCWRCDPDWEKNRKKLANCAPGFARGTTGG  120



>gb|KJB60997.1| hypothetical protein B456_009G334700 [Gossypium raimondii]
Length=434

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 2/100 (2%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTR--RHLRG  360
            ++ IAEYD Y   +  EA+++  +AY+ NPEEV  ++N+    T++ +  T R     + 
Sbjct  21   ESHIAEYDEYWTARELEAIENLDKAYHSNPEEVVRHYNDHFSRTMLEFYITKRVLAESKQ  80

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLAFVCPWLREWHNWG  480
              C+ TN +D CWRCD DW K+RK+LA   P        G
Sbjct  81   GPCEVTNHVDSCWRCDPDWEKNRKKLANCAPGFARGTTGG  120



>ref|XP_006361835.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=447

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 56/94 (60%), Gaps = 9/94 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI-----MNWTNTTRRH  351
             A I  YD   +++A+EA + + Q Y  +PE VT  FN+++ +T+     +  TN+TRR 
Sbjct  25   MAHIGHYDEVWRRRAEEAKEYARQIYERHPENVTLAFNQKLRNTMKELKEVKGTNSTRRG  84

Query  352  LRG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            L        C  TN IDRCWRCD +WA +RKRLA
Sbjct  85   LGTKKYCGPCIVTNPIDRCWRCDPNWADNRKRLA  118



>ref|XP_010322971.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=302

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 20/105 (19%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW------------  330
            +A+I E+D   + +A +A +++ ++Y  NPE+V  NFN+ V   + +W            
Sbjct  22   EANIGEFDEVWRTRATQANKNAKESYNPNPEKVAANFNKHVHRQVFSWYSQPSHFHLILI  81

Query  331  ------TNTTRR--HLRGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                  +N+TRR  H     C ATN IDRCWRCD  WAK+R++LA
Sbjct  82   CRSEEGSNSTRRDLHKYNGPCVATNPIDRCWRCDPHWAKNRQKLA  126



>gb|KHN08855.1| Putative pectate lyase P59 [Glycine soja]
Length=435

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 53/87 (61%), Gaps = 4/87 (5%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH-  366
            A+I  +D    ++  EA +++ QAY  NP +VT  FN  V    M  +N +RR L   + 
Sbjct  24   ANIGHFDHVWHRRLKEAREAAKQAYKPNPMKVTAEFNTHVIRA-MRGSNNSRRGLSNQYD  82

Query  367  --CKATNSIDRCWRCDQDWAKHRKRLA  441
              CKATN ID+CWRCD +W K+RKRLA
Sbjct  83   GPCKATNPIDKCWRCDPNWEKNRKRLA  109



>ref|XP_009587689.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=447

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 9/93 (10%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT-----NTTRRHL  354
            A I E+D   +++A+EA + +LQ Y   PE VT  FN++V D +   +     N TRR L
Sbjct  26   AHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQVRDAMKELSEVIPKNDTRREL  85

Query  355  RG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                    C  TN ID+CWRCD +WA +RK+LA
Sbjct  86   GTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLA  118



>ref|XP_009789921.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=447

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 9/93 (10%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT-----NTTRRHL  354
            A I E+D   +++A+EA + +LQ Y   PE VT  FN++V D +   +     N TRR L
Sbjct  26   AHIGEFDEVWRRRAEEARKVALQTYESEPENVTLAFNKQVRDAMKELSEVIPKNDTRREL  85

Query  355  RG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                    C  TN ID+CWRCD +WA +RK+LA
Sbjct  86   GTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLA  118



>ref|XP_007137422.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
 gb|ESW09416.1| hypothetical protein PHAVU_009G125800g [Phaseolus vulgaris]
Length=439

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 9/91 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            +A IAE+D +LK ++++A + +L++Y   PE V    N  V    ++  N+TRR L+   
Sbjct  24   EAGIAEFDDFLKAQSEKAHKIALESYVPTPEFVASELNYHVH---LSMLNSTRRGLKAGN  80

Query  358  ---GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               G+ C ++N ID CWRC++DWA  R RLA
Sbjct  81   NDAGAPCDSSNPIDNCWRCNKDWANDRYRLA  111



>ref|XP_004966014.1| PREDICTED: pectate lyase-like [Setaria italica]
Length=486

 Score = 70.5 bits (171),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 7/92 (8%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--  360
            +A+I E+D Y +++   A  ++   Y H+P EV +  N  V  +I     +TRR + G  
Sbjct  65   EANIGEFDDYWRQRKLMADAAAEATYQHDPIEVPNQLNRAVHRSIKKEDISTRREMLGQK  124

Query  361  -----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   CKATN IDRCWRC +DWA  RKRLA
Sbjct  125  KGKMNGPCKATNPIDRCWRCRKDWATDRKRLA  156


 Score = 24.3 bits (51),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +2

Query  446  CARGFGSGTTGGL  484
            CA+GFG  TTGGL
Sbjct  158  CAQGFGRNTTGGL  170



>ref|XP_010527872.1| PREDICTED: probable pectate lyase 3 isoform X2 [Tarenaya hassleriana]
Length=461

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 56/101 (55%), Gaps = 19/101 (19%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVG----DTIMNWTNTTRRHL---  354
            +A +D Y  ++ D+AL+ +L+ Y  NP  VTD+FN  V     +T+    N TRR L   
Sbjct  27   VAVFDEYWTQRQDKALRQTLRFYDPNPFNVTDHFNYHVNLAVEETMKTGNNGTRRELLQV  86

Query  355  ---RGSH---------CKATNSIDRCWRCDQDWAKHRKRLA  441
               RG H         C A N IDRCWRCD  W+K+RK+LA
Sbjct  87   GQSRGQHPKRRNLGGKCVAYNPIDRCWRCDPGWSKNRKKLA  127



>ref|XP_009131435.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
 emb|CDX78607.1| BnaA03g05190D [Brassica napus]
Length=475

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 38/123 (31%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN---------------------E  303
            +AD++E D Y   +ADEA + +LQAY+ +P E+ D+F+                     E
Sbjct  23   RADMSELDEYWSGRADEAREFTLQAYHSDPYEIIDHFHERHYDNSTDVTPTEEDNNTKPE  82

Query  304  EVGDTIM-------NWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRK  432
            EV + ++       N TN+TRR LRG            C A+N ID+CWRC ++W+K RK
Sbjct  83   EVENEVIEMVGSGDNSTNSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRKNWSKRRK  142

Query  433  RLA  441
            +L 
Sbjct  143  KLV  145



>emb|CDX85564.1| BnaA02g02490D [Brassica napus]
Length=473

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 61/121 (50%), Gaps = 36/121 (30%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN----------------------  300
            +A+++E D Y  K+A EA + +LQAY+ NP EV D+F+                      
Sbjct  23   RANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHYDNSTDVKETEEDSDDEKP  82

Query  301  EEVGDTIM----NWTNTTRRHLRGSH----------CKATNSIDRCWRCDQDWAKHRKRL  438
            EEV D ++    N  N+TRR LRG            C A+N ID+CWRC  +WAK RK L
Sbjct  83   EEVEDDVIEMVGNEMNSTRRILRGKRKGKWSKLKGPCTASNPIDKCWRCRSNWAKRRKNL  142

Query  439  A  441
             
Sbjct  143  V  143



>gb|KJB84348.1| hypothetical protein B456_N020300, partial [Gossypium raimondii]
Length=393

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 2/100 (2%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTR--RHLRG  360
            +A IAEYD Y   +  EA+++  +AY+ NPEEV  ++N+    T++ +  T R     + 
Sbjct  14   EAHIAEYDEYWTARELEAIENLDKAYHSNPEEVVRHYNDHFSRTMLEFYITKRVLAESKK  73

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLAFVCPWLREWHNWG  480
              C+ TN +D CWRCD DW K+ K+LA   P        G
Sbjct  74   GPCEVTNHVDSCWRCDPDWEKNGKKLADCAPGFARGTTGG  113



>ref|NP_178375.1| putative pectate lyase 6 [Arabidopsis thaliana]
 sp|O64510.1|PLY6_ARATH RecName: Full=Probable pectate lyase 6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC05350.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAO64162.1| putative pectate lyase [Arabidopsis thaliana]
 gb|AAV34776.1| At2g02720 [Arabidopsis thaliana]
 gb|AEC05615.1| putative pectate lyase 6 [Arabidopsis thaliana]
Length=455

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN--EEVGDTIMNWTNTTRRHL--  354
            QA IAEYD Y  ++   AL+ +L++Y  NPE VTD+FN    +        N TRR L  
Sbjct  24   QAHIAEYDEYWTQRQTNALRETLESYDPNPENVTDHFNYHAALAMETTGIVNETRRDLRQ  83

Query  355  ---------RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                     RG   ++ N+ID+CWR D++W K+RK+LA
Sbjct  84   VGRGKKTTRRGGRFESLNAIDKCWRGDKNWDKNRKKLA  121



>gb|KJB33662.1| hypothetical protein B456_006G024800 [Gossypium raimondii]
Length=454

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 55/102 (54%), Gaps = 18/102 (18%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM------------NWT  333
            A+I E D + K++  EA   +L AY  +PE + ++ N  V   I             + T
Sbjct  23   ANIIEIDDFWKQREQEAWNITLAAYESSPENIINHLNYNVDKVIRKISANQTIEFEDDLT  82

Query  334  NTTRRHLRGSH------CKATNSIDRCWRCDQDWAKHRKRLA  441
            N TRR+LRG H      C ATN ID CWRC ++WAK+RK LA
Sbjct  83   NNTRRYLRGKHKKYTGPCMATNPIDSCWRCKKNWAKNRKILA  124



>ref|XP_003530685.1| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=451

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            Q+ + E+D+Y +++A  A   S  AY+ +P  V+ NF   V +  +   +  RR+L+G +
Sbjct  33   QSHVYEFDSYWQERAKAAKVDSQAAYFEDPYSVSSNFTSSVSELTIGKKDL-RRNLKGKY  91

Query  367  -----CKATNSIDRCWRCDQDWAKHRKRLA  441
                 C ATN IDRCWRCD +WA +R++LA
Sbjct  92   RGDGPCIATNPIDRCWRCDPNWANNRQKLA  121



>emb|CDY53552.1| BnaA09g57110D [Brassica napus]
Length=495

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 9/94 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLRG  360
            QA++A +D Y  ++  +AL+ ++ +Y  NP  VTD+ N  V   +     TN TRR L G
Sbjct  25   QANVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDATESTNNTRRELIG  84

Query  361  -------SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                     C A N ID+CWRCD +W K+RK+LA
Sbjct  85   RKTQEGSGKCIAHNPIDKCWRCDPNWEKNRKKLA  118



>ref|XP_010683249.1| PREDICTED: pectate lyase-like [Beta vulgaris subsp. vulgaris]
Length=444

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW--TNTTRRHLRG-  360
            A+IAE+D Y  K+  EA++   +AY+  P  VT++FN +V     N    N+TRR L G 
Sbjct  27   ANIAEFDEYWHKRRLEAVKYFEEAYHPEPYNVTNHFNHQVHLHARNMKKLNSTRRGLLGK  86

Query  361  ---SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                 C ATN ID CWRC  +WA++RKRLA
Sbjct  87   GHIGPCVATNPIDACWRCQPNWAENRKRLA  116



>ref|XP_011009454.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=474

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 62/124 (50%), Gaps = 40/124 (32%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV----------------GDTI  321
            AD+  +D   +K+A+EA + +L+AY  +PEE TD FN EV                G T 
Sbjct  23   ADLGIFDDVWRKRAEEAKKMTLEAYVPDPEEATDAFNVEVNKYSLAKNSSSLYGAFGSTN  82

Query  322  MN------------------WTNTTRRHLR------GSHCKATNSIDRCWRCDQDWAKHR  429
            +                   + N+TRR+LR         C+ TN IDRCWRC ++WAK+R
Sbjct  83   ITNLDLDDIDDNDNDADFEQFANSTRRNLRQGRKKYAGPCQVTNPIDRCWRCQRNWAKNR  142

Query  430  KRLA  441
            K+LA
Sbjct  143  KQLA  146



>gb|KHN08706.1| Putative pectate lyase 3 [Glycine soja]
Length=444

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = +1

Query  208  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--SHCKATN  381
            D+Y K+KA  A + + QAY  +P  +T N    V + I+   N  RR+L+G   +C ATN
Sbjct  37   DSYWKQKASVAEKENKQAYTSDPYSLTKNLTYSVSEIIVGEQNG-RRNLKGKGGNCMATN  95

Query  382  SIDRCWRCDQDWAKHRKRLA  441
             IDRCWRCD +WA +RK+LA
Sbjct  96   PIDRCWRCDPNWANNRKKLA  115



>ref|XP_003519771.2| PREDICTED: probable pectate lyase 3-like [Glycine max]
Length=447

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = +1

Query  208  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG--SHCKATN  381
            D+Y K+KA  A + + QAY  +P  +T N    V + I+   N  RR+L+G   +C ATN
Sbjct  40   DSYWKQKASVAEKENKQAYTSDPYSLTKNLTYSVSEIIVGEQNG-RRNLKGKGGNCMATN  98

Query  382  SIDRCWRCDQDWAKHRKRLA  441
             IDRCWRCD +WA +RK+LA
Sbjct  99   PIDRCWRCDPNWANNRKKLA  118



>ref|XP_006482669.1| PREDICTED: probable pectate lyase 9-like [Citrus sinensis]
Length=255

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH---  366
            IAE D   +++A+EA+Q++ Q Y  +P  V  N N +V + + N TNT  ++  G +   
Sbjct  24   IAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQEYVNNNTNT--KNPSGKYWGP  81

Query  367  CKATNSIDRCWRCDQDWAKHRKRLAFVCP  453
            C+ATN +DRCWRC +DWA +R +LA   P
Sbjct  82   CQATNPVDRCWRCWKDWANYRPKLADFVP  110



>ref|XP_009788285.1| PREDICTED: pectate lyase-like [Nicotiana sylvestris]
Length=434

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  360
            +A+I+E+D   + +A +A +++  +Y  +PE V DN N+ V  T    +N+TRR  H   
Sbjct  21   EANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHV-HTSEEGSNSTRRDLHKYN  79

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C +TN IDRCWRCD +WAK R +LA
Sbjct  80   GPCMSTNPIDRCWRCDPNWAKTRMKLA  106



>ref|XP_011097774.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=435

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 51/87 (59%), Gaps = 15/87 (17%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDN---FNEEVGDTIMNWTNTTRRHLRG  360
            A IAE+D  L+++A E+ Q SL+AY  NP  +T     F E+            RR ++ 
Sbjct  29   AKIAEFDEDLRRRAAESYQESLKAYNPNPLNLTGESYLFAEQ------------RRDMKE  76

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              CKA N IDRCWRCD DW K+RK+LA
Sbjct  77   DDCKAENPIDRCWRCDPDWDKNRKKLA  103



>ref|XP_004489374.1| PREDICTED: pectate lyase-like [Cicer arietinum]
Length=447

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 53/90 (59%), Gaps = 6/90 (7%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR---  357
            +A IAE+D +L+ +A+EA + +L +Y   P +V  + N  V    +   N TRR L+   
Sbjct  30   EAGIAEFDDFLRAQAEEAHKLALASYVPIPGDVAHDLNFHV-HLALEGANDTRRELKQKH  88

Query  358  --GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
              G  C+ATN ID CWRC +DWA  R +LA
Sbjct  89   AAGEACEATNPIDSCWRCQKDWANDRFKLA  118



>ref|XP_009117903.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=452

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 9/94 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLRG  360
            Q+++A +D Y  ++  +AL+ ++ +Y  NP  VTD+ N  V   +     TN TRR L G
Sbjct  25   QSNVAVFDNYWTQRQGDALKQTIASYDPNPLNVTDHLNYHVALAVDATESTNNTRRELIG  84

Query  361  -------SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                     C A N ID+CWRCD +W K+RK+LA
Sbjct  85   RKTQEGSGKCIAYNPIDKCWRCDPNWEKNRKKLA  118



>gb|AFW87059.1| pectate lyase [Zea mays]
Length=451

 Score = 67.8 bits (164),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 9/94 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGS-  363
            +A+I ++D Y +++   A  ++   Y H+P EV +  N  V  ++      TRR + G+ 
Sbjct  28   EANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHRSVEKEDIGTRREMMGTT  87

Query  364  --------HCKATNSIDRCWRCDQDWAKHRKRLA  441
                     C+ATN IDRCWRC QDWA  RKRLA
Sbjct  88   TRKSKFSGPCRATNPIDRCWRCRQDWATDRKRLA  121


 Score = 24.6 bits (52),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +2

Query  446  CARGFGSGTTGGL  484
            CA+GFG  TTGGL
Sbjct  123  CAKGFGRNTTGGL  135



>ref|XP_004298448.1| PREDICTED: probable pectate lyase 3 [Fragaria vesca subsp. vesca]
Length=443

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = +1

Query  187  QADIAEY-DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG-  360
            Q D  E  D Y K++A +A++ +  + + +PE VT+ FN +V + IM   N TRR LRG 
Sbjct  26   QNDTVELEDEYWKQRAADAMRIANASVHPDPENVTEEFNAKVHEHIMG-QNRTRRTLRGF  84

Query  361  ----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                  C+ATN ID CWRCD +WA +R++L 
Sbjct  85   KRYEGPCRATNPIDACWRCDPEWADNRQKLV  115



>ref|XP_008679844.1| PREDICTED: pectate lyase [Zea mays]
 gb|AFW66064.1| pectate lyase-like protein [Zea mays]
Length=444

 Score = 65.9 bits (159),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN----WTNTTRRHLR  357
             ++ ++D +L+K+ + A  S+ +AY  +P  VT++FN  V   + +         R+H +
Sbjct  31   VNVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSSRREMRERPRKHKK  90

Query  358  GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               C+ATN ID+CWRC +DWA  R+RLA
Sbjct  91   RGPCRATNPIDKCWRCRRDWATDRQRLA  118


 Score = 26.2 bits (56),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +2

Query  446  CARGFGSGTTGGL  484
            CARGFG  TTGGL
Sbjct  120  CARGFGHATTGGL  132



>ref|XP_010420164.1| PREDICTED: probable pectate lyase 19 isoform X2 [Camelina sativa]
Length=472

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 59/119 (50%), Gaps = 35/119 (29%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGD-----------------  315
            + +I+E D Y  ++ADEA + +LQAY+ +P E+ D+F+E   D                 
Sbjct  23   RGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDATETEEDGGAKPE  82

Query  316  --------TIMNWTNTTRRHLRG----------SHCKATNSIDRCWRCDQDWAKHRKRL  438
                     + N T +TRR LRG            C A+N ID+CWRC  +WAK RK+L
Sbjct  83   EEEEEGIKMVGNSTKSTRRSLRGKGKGKWSKLKGPCTASNPIDKCWRCRTNWAKRRKKL  141



>ref|XP_002437204.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
 gb|EER88571.1| hypothetical protein SORBIDRAFT_10g022830 [Sorghum bicolor]
Length=454

 Score = 67.8 bits (164),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 9/94 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A+I ++D Y +++   A  ++   Y H+P EVT+  N  V  ++     +TRR     H
Sbjct  30   EANIGDFDDYWRQRKLMADAAAEATYKHDPLEVTNQLNRAVHRSVEKEDMSTRRRAMMGH  89

Query  367  ---------CKATNSIDRCWRCDQDWAKHRKRLA  441
                     C+ATN IDRCWRC QDWA  RKRLA
Sbjct  90   KKGKLNNGPCEATNPIDRCWRCRQDWATDRKRLA  123


 Score = 24.3 bits (51),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +2

Query  446  CARGFGSGTTGGL  484
            CA+GFG  TTGGL
Sbjct  125  CAQGFGRNTTGGL  137



>ref|NP_001150723.1| pectate lyase precursor [Zea mays]
 gb|ACG40127.1| pectate lyase precursor [Zea mays]
Length=451

 Score = 67.4 bits (163),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 9/94 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGS-  363
            +A+I ++D Y +++   A  ++   Y H+P EV +  N  V  ++      TRR + G+ 
Sbjct  28   EANIGDFDEYWQQRKLMADAAAEATYKHDPVEVANQLNRAVHRSVEKDDIGTRREMMGTT  87

Query  364  --------HCKATNSIDRCWRCDQDWAKHRKRLA  441
                     C+ATN IDRCWRC QDWA  RKRLA
Sbjct  88   TRKSKFSGPCRATNPIDRCWRCRQDWATDRKRLA  121


 Score = 24.6 bits (52),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +2

Query  446  CARGFGSGTTGGL  484
            CA+GFG  TTGGL
Sbjct  123  CAKGFGRNTTGGL  135



>ref|XP_004232242.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=446

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 12/94 (13%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW------TNTTRRHLR  357
            I E+D   +++A EA + +++AY  +P  VT  F +E G  +          N TRR L+
Sbjct  24   IGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKETGQALKEIKEAKLAVNGTRRELK  83

Query  358  GSH------CKATNSIDRCWRCDQDWAKHRKRLA  441
            G        C  TN IDRCWRC  DWA +RKRLA
Sbjct  84   GGGKKYDGPCSVTNPIDRCWRCQPDWADNRKRLA  117



>ref|XP_006344502.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=435

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  360
            +A I E+D   KK+A +A +++  AY  NP+ V D+ N +V D  +  +N+ RR  H   
Sbjct  22   EAHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQV-DKAVRGSNSRRRDLHRYS  80

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRL  438
              C ATN ID+CWRCD +WA++R +L
Sbjct  81   GKCMATNPIDQCWRCDPNWARNRMKL  106



>ref|XP_004490003.1| PREDICTED: probable pectate lyase 3-like isoform X1 [Cicer arietinum]
Length=450

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 5/82 (6%)
 Frame = +1

Query  208  DAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG----SHCKA  375
            D+Y K+KA+ A +++ +AY  +P  V+ N    + + I+      RR+LRG      C A
Sbjct  41   DSYWKEKAEIAAKANEEAYTPDPYAVSGNLTSTISEMIIG-GKKGRRNLRGRKTAGPCMA  99

Query  376  TNSIDRCWRCDQDWAKHRKRLA  441
            TN IDRCWRCD +WA +RK+LA
Sbjct  100  TNPIDRCWRCDPNWANNRKKLA  121



>gb|ACF87417.1| unknown [Zea mays]
Length=444

 Score = 65.1 bits (157),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTT----RRHLR  357
             ++ ++D +L+K+ + A  S+ +AY  +P  VT++FN  V   + +         R+H +
Sbjct  31   VNVGQFDDHLQKRKELAEASAREAYRPDPYNVTNSFNAAVHRAVSSSRREMWERPRKHKK  90

Query  358  GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
               C+ATN ID+CWRC +DWA  R+RLA
Sbjct  91   RGPCRATNPIDKCWRCRRDWATDRQRLA  118


 Score = 26.2 bits (56),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +2

Query  446  CARGFGSGTTGGL  484
            CARGFG  TTGGL
Sbjct  120  CARGFGHATTGGL  132



>gb|AAA86241.1| pectate lyase homolog [Medicago sativa]
Length=450

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 52/99 (53%), Gaps = 14/99 (14%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV----GDTIMNWTNTTRRHL  354
            +  I E+D YLK +AD A Q + ++Y  NPE +T   N  V       +    N TRR L
Sbjct  23   EGRIGEFDDYLKAQADLARQIAFKSYVPNPENITTEINIHVHLAMEAAMKAEANDTRREL  82

Query  355  ----------RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                      R + C ATN ID CWRC +DWA++R+ LA
Sbjct  83   MSQKSRGGKGRRARCMATNPIDSCWRCRKDWAENRQLLA  121



>gb|KFK33456.1| hypothetical protein AALP_AA5G015800 [Arabis alpina]
Length=460

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 14/99 (14%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN--EEVGDTIMNWTNTTRRHLR-  357
            QA IA YD Y  ++  EAL+ +L++Y  +P  VTD+FN    +        N TRR LR 
Sbjct  28   QAHIAVYDEYWTQRQTEALRRTLESYEPDPLNVTDHFNYHSALAMETTEAVNGTRRELRV  87

Query  358  -----------GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                       G   ++ N+ID+CWR D++WAK+RK+LA
Sbjct  88   VGGGRKTIKKRGGRFQSLNAIDKCWRGDKNWAKNRKKLA  126



>ref|XP_009110541.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 54/96 (56%), Gaps = 12/96 (13%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL---  354
            A++A +D Y  ++  +AL+ ++ ++  NP  VTD+ N  V   +     TN+TRR L   
Sbjct  29   ANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALAVDATESTNSTRRELSQV  88

Query  355  -------RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   R   C A N IDRCWRC+ DW K+RK+LA
Sbjct  89   RNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRKKLA  124



>ref|XP_003613596.1| Pectate lyase [Medicago truncatula]
 gb|AES96554.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = +1

Query  214  YLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---SHCKATNS  384
            Y +KKA  A +++ +AY  +P  V+ N +  V + I+   N  RR+L G   S C ATN 
Sbjct  43   YWQKKASIAAKANDKAYTPDPYAVSGNLSSTVSEMIIGGING-RRNLVGLGNSSCMATNP  101

Query  385  IDRCWRCDQDWAKHRKRLA  441
            IDRCWRCD +WA +RK+LA
Sbjct  102  IDRCWRCDPNWANNRKKLA  120



>ref|XP_006292606.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
 gb|EOA25504.1| hypothetical protein CARUB_v10018855mg [Capsella rubella]
Length=455

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM--NWTNTTRRHLR-  357
            QA IA +D Y  ++  EALQ +L+AY   P  VTD+FN +    ++     N TRR LR 
Sbjct  24   QAHIAVHDEYWTQRQTEALQQTLEAYDPEPLNVTDHFNHQAALAMVPTGIVNETRRELRQ  83

Query  358  ----------GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                      G   ++ N+ID+CWR D++W K+RK+LA
Sbjct  84   VGRGNKKPRRGRRYESLNAIDKCWRGDKNWDKNRKKLA  121



>ref|XP_006354795.1| PREDICTED: pectate lyase-like [Solanum tuberosum]
Length=435

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  360
            +A+I E+D   + +A +A +++ ++Y  +PE+V  N N+ V  +    +N+TRR  H   
Sbjct  22   EANIGEFDEVWRTRATQANKNAKESYNPHPEKVAANLNKHVHRS-EEGSNSTRRDLHKYN  80

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRCD  WAK+R++LA
Sbjct  81   GPCVATNPIDRCWRCDPHWAKNRQKLA  107



>ref|XP_007153840.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
 gb|ESW25834.1| hypothetical protein PHAVU_003G069100g [Phaseolus vulgaris]
Length=447

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 50/84 (60%), Gaps = 6/84 (7%)
 Frame = +1

Query  202  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG----SHC  369
            E+D Y K +A+ A   +  AY+ +P  V+ N +  V + I+      RR+L+G      C
Sbjct  37   EFDPYWKGRAETAAVDNNAAYFPDPYSVSGNLSSSVSELIVG--KDKRRNLKGQRYTGPC  94

Query  370  KATNSIDRCWRCDQDWAKHRKRLA  441
             ATN IDRCWRCD +WA +R++LA
Sbjct  95   MATNPIDRCWRCDPNWANNRQKLA  118



>ref|XP_009129128.1| PREDICTED: probable pectate lyase 6 [Brassica rapa]
Length=457

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 55/96 (57%), Gaps = 11/96 (11%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  354
            QA IA +D Y  ++   AL+ ++++Y  NP  VT++FN      +      N TRR L  
Sbjct  28   QAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAMETTGADNGTRRELGQ  87

Query  355  -------RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   RG   K+ N+IDRCWR D++WAK+RK+LA
Sbjct  88   VKAGQKARGGRFKSLNAIDRCWRGDKNWAKNRKKLA  123



>emb|CDY09356.1| BnaA02g26540D [Brassica napus]
Length=457

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 55/96 (57%), Gaps = 11/96 (11%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  354
            QA IA +D Y  ++   AL+ ++++Y  NP  VT++FN      +      N TRR L  
Sbjct  28   QAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAMETTGADNGTRRELGQ  87

Query  355  -------RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   RG   K+ N+IDRCWR D++WAK+RK+LA
Sbjct  88   VKAGQKARGGRFKSLNAIDRCWRGDKNWAKNRKKLA  123



>ref|XP_009617495.1| PREDICTED: probable pectate lyase P59 [Nicotiana tomentosiformis]
Length=451

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 54/95 (57%), Gaps = 13/95 (14%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-------TNTTRRHL  354
            I ++D   +++A EA + +L+AY  +P  VT  F ++  +++          TN TRR L
Sbjct  28   IGDFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTKESMKELKEVKKLATNDTRREL  87

Query  355  RGSH------CKATNSIDRCWRCDQDWAKHRKRLA  441
            RG H      C  TN IDRCWRC  +WA +RKRLA
Sbjct  88   RGFHKNYAGPCLVTNPIDRCWRCQGNWADNRKRLA  122



>ref|NP_001057945.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAD68734.1| putative pectate lyase [Oryza sativa Japonica Group]
 dbj|BAF19859.1| Os06g0583900 [Oryza sativa Japonica Group]
 dbj|BAG93046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80871.1| hypothetical protein OsI_23497 [Oryza sativa Indica Group]
Length=448

 Score = 65.5 bits (158),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV----GDTIMNWTNTTRRHL  354
            +A+I EYD Y +K+   A  ++   Y  +P EVT++FN  V     ++       T+R  
Sbjct  32   EANIGEYDEYWQKRKLMADAAAEATYKRDPFEVTNSFNRAVHRSEEESGRRELAMTKRKK  91

Query  355  RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                CKATN IDRCWRC  DW   RKRLA
Sbjct  92   FAGPCKATNPIDRCWRCRADWVTDRKRLA  120


 Score = 24.3 bits (51),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +2

Query  446  CARGFGSGTTGGL  484
            CA+GFG  TTGGL
Sbjct  122  CAQGFGRNTTGGL  134



>ref|XP_004236194.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=435

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  360
            +A I E+D   KK+A +A +++  AY  NP+ V D+ N +V D  +  + + RR L+   
Sbjct  22   EAHIKEFDEVWKKRAQQAKKAARHAYNPNPKIVADHLNYQV-DKAVRGSKSRRRDLQRYS  80

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRL  438
              C ATN ID+CWRCD +WA++R +L
Sbjct  81   GKCMATNPIDQCWRCDPNWARNRMKL  106



>ref|XP_010528323.1| PREDICTED: probable pectate lyase 19 [Tarenaya hassleriana]
Length=458

 Score = 65.1 bits (157),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 20/105 (19%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAY------------YHNPEEVTDNFNEEVGDTIMNW  330
            +  I EYD YL+K+  EA + +L+AY            +++P       + + G      
Sbjct  24   RGKIGEYDDYLRKQEAEAQEQALRAYDPEFDQTVKKFDHNDPSHQNATISIKGGYRPNKN  83

Query  331  TNTTRRHLRG--------SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            T +TRR LRG          CKATN +D+CWRC  DWA++RKRL 
Sbjct  84   TTSTRRSLRGRGNWKKIAGPCKATNPVDKCWRCQADWAQNRKRLV  128


 Score = 24.6 bits (52),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 10/14 (71%), Gaps = 0/14 (0%)
 Frame = +2

Query  443  SCARGFGSGTTGGL  484
            SC RGFG  TTGG 
Sbjct  129  SCVRGFGHKTTGGF  142



>ref|XP_010485518.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 59/121 (49%), Gaps = 36/121 (30%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNF-----------------------  297
            +A++AE D Y   KA+EA + +L AY+ +P ++ D+F                       
Sbjct  23   RANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGTEEDTAVDSA  82

Query  298  -NEEVGDTIMNWTNTTRRHLRG------------SHCKATNSIDRCWRCDQDWAKHRKRL  438
             +E+V +   + TN+TRR L G              C A+N ID+CWRC  DWAK RKRL
Sbjct  83   EDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRCQPDWAKRRKRL  142

Query  439  A  441
             
Sbjct  143  V  143



>ref|XP_004508770.1| PREDICTED: probable pectate lyase P59-like [Cicer arietinum]
Length=434

 Score = 65.9 bits (159),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--G  360
            +A IA    + + +A EA Q++ +AY  NP ++   FN+ V D     +N TRR L    
Sbjct  23   RASIAHDAQFWQTRAREAKQAAQKAYKPNPHDIALTFNKHV-DKSFKSSNGTRRGLSKYT  81

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN ID+CWRCD +W K+RK+LA
Sbjct  82   GPCLATNPIDKCWRCDPNWEKNRKKLA  108


 Score = 23.5 bits (49),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +2

Query  443  SCARGFGSGTTGG  481
            +CA GFG GTTGG
Sbjct  109  NCALGFGHGTTGG  121



>ref|XP_009598230.1| PREDICTED: pectate lyase-like [Nicotiana tomentosiformis]
Length=434

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 9/90 (10%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW---TNTTRR--H  351
            +A+I+E+D   + +A +A +++  +Y  +PE V DN N+ V      W   +N+TRR  H
Sbjct  21   EANISEFDEVWQTRATQAKKTAQDSYNPHPETVADNLNKHV----HKWEEGSNSTRRDLH  76

Query  352  LRGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                 C +TN IDRCWRCD +W K+R +LA
Sbjct  77   KYDGPCMSTNPIDRCWRCDPNWVKNRMKLA  106



>ref|XP_009148818.1| PREDICTED: probable pectate lyase 3 [Brassica rapa]
Length=458

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 13/100 (13%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  354
            QA+IA +D Y  ++  +AL+ +L ++   P  VT++ N  V   +     TN+TRR L  
Sbjct  28   QANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVALALDTTESTNSTRRELSQ  87

Query  355  --RG------SHCKATNSIDRCWRCDQDWAKHRKRLAFVC  450
              RG        C A N ID+CWRCD+DW K+RK+LA VC
Sbjct  88   ARRGRKMQNRGKCVAHNPIDKCWRCDRDWEKNRKKLA-VC  126



>sp|P40973.1|PLY_LILLO RecName: Full=Pectate lyase; Flags: Precursor [Lilium longiflorum]
 emb|CAA78976.1| pectate lyase [Lilium longiflorum]
 gb|AAA33398.1| pectate lyase [Lilium longiflorum]
Length=434

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG---  360
            A+IAE+D Y +KK+  A   + +AY  +PEEVT++FN+ V  +     N+TRR+LR    
Sbjct  22   ANIAEFDEYWQKKSKVAQAKAKKAYTPHPEEVTNHFNKAVHSSFEG--NSTRRNLRTNKL  79

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C ATN IDRCWRC ++W+ +RK L 
Sbjct  80   GQCLATNPIDRCWRCKKNWSANRKDLV  106



>ref|XP_006357122.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=448

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 9/93 (10%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT-----NTTRRHL  354
            A I ++D   +++A+EA++ ++Q Y   P  +T  FN++  D++   +     N TRR L
Sbjct  27   AHIGDFDEVWRRRAEEAMKFTIQTYESEPANITLAFNQKTRDSVKELSAVVSKNETRREL  86

Query  355  RG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                    C  TN ID+CWRCD +WA +RK+L 
Sbjct  87   GTKKYEGPCTVTNPIDKCWRCDPNWADNRKKLV  119



>ref|XP_004135462.1| PREDICTED: probable pectate lyase P59-like [Cucumis sativus]
 gb|KGN51889.1| hypothetical protein Csa_5G604340 [Cucumis sativus]
Length=432

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--GS  363
            ADI ++D Y K +A  A +++  AY  +PE V ++ N E+     +  N+TRR+L+    
Sbjct  19   ADIGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHA-SSGRNSTRRNLKKYAG  77

Query  364  HCKATNSIDRCWRCDQDWAKHRKRLA  441
             C ATN IDRCWRCD +WA++RK+LA
Sbjct  78   PCLATNPIDRCWRCDPNWAQNRKKLA  103



>ref|XP_004155392.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase P59-like 
[Cucumis sativus]
Length=432

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR--GS  363
            ADI ++D Y K +A  A +++  AY  +PE V ++ N E+     +  N+TRR+L+    
Sbjct  19   ADIGDFDDYWKARAAAAEKAAADAYDPDPETVANSVNAEIAHA-SSGRNSTRRNLKKYAG  77

Query  364  HCKATNSIDRCWRCDQDWAKHRKRLA  441
             C ATN IDRCWRCD +WA++RK+LA
Sbjct  78   PCLATNPIDRCWRCDPNWAQNRKKLA  103



>emb|CDX96854.1| BnaA08g23970D [Brassica napus]
Length=458

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 53/96 (55%), Gaps = 12/96 (13%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL---  354
            A++A +D Y  ++  +AL+ ++ ++  NP  VTD+ N  V   +      N+TRR L   
Sbjct  29   ANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALAVDATESINSTRRELSQV  88

Query  355  -------RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   R   C A N IDRCWRC+ DW K+RK+LA
Sbjct  89   RNGRKLKRSGKCVAYNPIDRCWRCNGDWEKNRKKLA  124



>ref|XP_002892805.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69064.1| hypothetical protein ARALYDRAFT_471616 [Arabidopsis lyrata subsp. 
lyrata]
Length=459

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 56/98 (57%), Gaps = 13/98 (13%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  354
            +A++A +D+Y  ++  +AL+ ++ +Y  NP  VT++FN  V   +      N TRR L  
Sbjct  28   RANVAVFDSYWTQRQSDALKQTMGSYDPNPINVTNHFNYHVNIAVDVSESNNDTRRELTQ  87

Query  355  ---------RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                         C A N ID+CWRCD++WAK+RK+LA
Sbjct  88   VRSGRKTKKHSGKCLAYNPIDKCWRCDRNWAKNRKKLA  125



>ref|XP_010496063.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 13/97 (13%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN----------EEVGDTIMNWTNT  339
            A +A +D+Y  ++  +AL+ +  +Y  NP  VT++FN          E + DT    T  
Sbjct  25   AHVAVFDSYWMQRKSDALKQTFGSYDPNPLNVTNHFNYHVNLAVDATESINDTRRELTQV  84

Query  340  -TRRHLR--GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
             +RR L+  G  C A N ID+CWRCD++WA +RK+LA
Sbjct  85   RSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLA  121



>ref|XP_009802165.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=451

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 53/95 (56%), Gaps = 13/95 (14%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-------TNTTRRHL  354
            I  +D   +++A EA + +L+AY  +P  VT  F ++  +++          TN TRR L
Sbjct  28   IGNFDEVWRRRAQEAEEWALKAYEPDPVNVTLAFAKQTRESMKELKEVNKLSTNETRREL  87

Query  355  RGSH------CKATNSIDRCWRCDQDWAKHRKRLA  441
            RG H      C  TN IDRCWRC  +WA +RKRLA
Sbjct  88   RGFHKIYAGPCLVTNPIDRCWRCQGNWADNRKRLA  122



>ref|XP_010476496.1| PREDICTED: probable pectate lyase 3 [Camelina sativa]
Length=455

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 13/97 (13%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN----------EEVGDTIMNWTNT  339
            A +A +D+Y  ++  +AL+ +  +Y  NP  VT++FN          E + DT    T  
Sbjct  25   AHVAVFDSYWMQRKTDALKQTFGSYDPNPLNVTNHFNYHVNLAVDATESINDTRRELTQV  84

Query  340  -TRRHLR--GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
             +RR L+  G  C A N ID+CWRCD++WA +RK+LA
Sbjct  85   RSRRKLQKHGGKCVAYNPIDKCWRCDRNWANNRKKLA  121



>ref|XP_004234779.1| PREDICTED: probable pectate lyase P59 [Solanum lycopersicum]
Length=449

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 54/96 (56%), Gaps = 11/96 (11%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-------TNTTR  345
             A I  YD   +++A+EA + + + Y  +PE VT  FN+++ DT+           N+TR
Sbjct  25   MAHIGHYDEVWRRRAEEAKEYARKIYEPHPENVTLAFNQKLRDTMKELKKVKGTHNNSTR  84

Query  346  RHLRG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            R L        C  TN ID+CWRCD +WA +RK+LA
Sbjct  85   RGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLA  120



>dbj|BAK06965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 53/91 (58%), Gaps = 7/91 (8%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A+I E+D + +++  EA   +   Y+ NP EV ++ N  V  ++ + + + RR L G H
Sbjct  27   EANIGEFDEHWQRRKLEARARAEATYHPNPIEVANSLNRAVHRSLRDESGS-RRKLLGLH  85

Query  367  ------CKATNSIDRCWRCDQDWAKHRKRLA  441
                  C ATN IDRCWRC +DWA  R RLA
Sbjct  86   KKFAGPCTATNPIDRCWRCRKDWATDRMRLA  116



>ref|XP_010463548.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (49%), Gaps = 36/121 (30%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNF-----------------------  297
            +A++AE D Y   KA+EA + +L AY+ +P ++ D+F                       
Sbjct  23   RANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGTEEDKAVDSA  82

Query  298  -NEEVGDTIMNWTNTTRRHLRG------------SHCKATNSIDRCWRCDQDWAKHRKRL  438
             +E+V +   + TN+TRR L G              C A+N ID+CWRC  DWA+ RKRL
Sbjct  83   EDEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRCQPDWARRRKRL  142

Query  439  A  441
             
Sbjct  143  V  143



>ref|XP_003621115.1| Pectate lyase [Medicago truncatula]
 gb|AES77333.1| pectate lyase P59-like protein [Medicago truncatula]
Length=451

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 49/100 (49%), Gaps = 15/100 (15%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV----GDTIMNWTNTTRRHL  354
            +  I E+D YLK +A+ A Q + ++Y  NPE +T   N  V       +    N TRR L
Sbjct  23   EGRIGEFDDYLKAQAEMARQIAFKSYVPNPENITTEINIHVHLAMEAAMKAEANDTRREL  82

Query  355  RGSH-----------CKATNSIDRCWRCDQDWAKHRKRLA  441
                           C ATN ID CWRC  DWAK+R+ LA
Sbjct  83   MSQKSRGGKGRRRARCMATNPIDSCWRCRNDWAKNRQLLA  122



>ref|XP_002875142.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51401.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 13/98 (13%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLR-  357
            QA IA YD Y  ++   AL+ +L++Y  NP+ VTD+FN      +      N TRR LR 
Sbjct  24   QAHIAVYDDYWTQRQTIALRQTLESYDPNPDNVTDHFNYHAALAMETTGIVNETRRDLRQ  83

Query  358  ----------GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                      G   ++ N+ID+CWR D++W K+RK+LA
Sbjct  84   VRSGKKKPRRGGRFESLNAIDKCWRGDKNWDKNRKKLA  121



>emb|CDY39314.1| BnaC05g10650D [Brassica napus]
Length=459

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 56/101 (55%), Gaps = 14/101 (14%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  354
            QA+IA +D Y  ++  +AL+ +L ++   P  VT++ N  V   +      N+TRR L  
Sbjct  28   QANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVALALDTTGSINSTRRELSQ  87

Query  355  ---------RGSHCKATNSIDRCWRCDQDWAKHRKRLAFVC  450
                     R   C A N ID+CWRCD+DW K+RK+LA VC
Sbjct  88   ARRGRKMQNRRGKCVAHNPIDKCWRCDRDWEKNRKKLA-VC  127



>ref|XP_011087217.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=436

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---RG  360
             +I  +DA  +++ + A +++ QAY  NP EV D+ NE V  ++   +N  RR L   +G
Sbjct  23   GNIGVHDAVWQERREAAKKAARQAYQPNPGEVLDHLNENVHKSV-EGSNNQRRGLSKYKG  81

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            S C ATN ID+CWRC  +WA +RK+L 
Sbjct  82   S-CLATNPIDQCWRCQPNWANNRKKLV  107



>emb|CDY68729.1| BnaCnng60280D [Brassica napus]
Length=458

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 52/96 (54%), Gaps = 12/96 (13%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL---  354
            A++A +D Y  ++  +AL+ ++ ++  NP  VTD+ N  V   +      N+TRR L   
Sbjct  29   ANVAVFDNYWLQRQGDALKQTIASFDPNPLNVTDHLNYHVALAVGATESINSTRRELSQV  88

Query  355  -------RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   R   C A N IDRCWRC  DW K+RK+LA
Sbjct  89   RNGRKLKRSGKCVAYNPIDRCWRCHGDWEKNRKKLA  124



>ref|XP_010513594.1| PREDICTED: probable pectate lyase 7 [Camelina sativa]
Length=473

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 58/120 (48%), Gaps = 36/120 (30%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNF------------------------  297
            A++AE D Y   KA+EA + +L AY+ +P ++ D+F                        
Sbjct  24   ANVAETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEGTEEDKAVDSTE  83

Query  298  NEEVGDTIMNWTNTTRRHLRG------------SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            +E+V +   + TN+TRR L G              C A+N ID+CWRC  DWA+ RKRL 
Sbjct  84   DEDVIEMTSSPTNSTRRSLSGKRRGRGKWSKLKGPCTASNPIDKCWRCQPDWARRRKRLV  143



>ref|XP_006656188.1| PREDICTED: pectate lyase-like [Oryza brachyantha]
Length=446

 Score = 63.5 bits (153),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 5/90 (6%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEV-----GDTIMNWTNTTRRH  351
            +A+I +YD + +K+   A  ++   Y  +P EVT++FN  V      +T       ++R 
Sbjct  29   EANIGDYDEHWQKRKLMADAAAEATYKRDPFEVTNDFNRAVHRSEEKETARRSLMLSKRK  88

Query  352  LRGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                 CKATN IDRCWRC  DWA  RKRLA
Sbjct  89   KFAGPCKATNPIDRCWRCRDDWATDRKRLA  118


 Score = 24.3 bits (51),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +2

Query  446  CARGFGSGTTGGL  484
            CA+GFG  TTGGL
Sbjct  120  CAQGFGRNTTGGL  132



>gb|KFK43687.1| hypothetical protein AALP_AA1G160000 [Arabis alpina]
Length=460

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 56/99 (57%), Gaps = 16/99 (16%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT---NTTRR---  348
            +A +A +D Y  ++  +AL+ ++ +Y  NP  VTD+FN  V    M+ T   N TRR   
Sbjct  28   RAHVAVFDNYWTQRQTDALRQTMNSYDPNPLNVTDHFNHHV-SLAMDATESNNGTRRELT  86

Query  349  ---------HLRGSHCKATNSIDRCWRCDQDWAKHRKRL  438
                     H     C A N+ID+CWRCD++WAK+RK+L
Sbjct  87   QVRKSGRKIHKSSGKCLAYNAIDKCWRCDRNWAKNRKKL  125



>ref|XP_002453531.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
 gb|EES06507.1| hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
Length=445

 Score = 60.8 bits (146),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIM---NWTNTTRRHLRG  360
            A+IA++D + +K+ + A  S  + Y  +P  VT++FN  V              R+H + 
Sbjct  32   ANIADFDEHWQKRKELAEASVRETYRPDPYNVTNSFNVAVHRATSLRRTMREMPRKHKKK  91

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C+ATN ID+CWRC  DWA  R RLA
Sbjct  92   GPCRATNPIDKCWRCKNDWATDRFRLA  118


 Score = 26.6 bits (57),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +2

Query  446  CARGFGSGTTGGL  484
            CARGFG  TTGGL
Sbjct  120  CARGFGQATTGGL  132



>ref|XP_010523445.1| PREDICTED: probable pectate lyase 3 [Tarenaya hassleriana]
Length=464

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 53/101 (52%), Gaps = 16/101 (16%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT---NTTRRHL-  354
            +A +A +D Y  ++   AL+ +L+ Y  NP  VTD+FN  V   +   T   N TRR L 
Sbjct  30   KAHVAVFDEYWTQRQAHALRQTLRFYDPNPFNVTDHFNHHVNLAVEEATEASNGTRRELW  89

Query  355  ----RGSH--------CKATNSIDRCWRCDQDWAKHRKRLA  441
                 G H        C A N IDRCWRC  +WAK RK+LA
Sbjct  90   QVGSGGKHLKRRNTGKCVAYNPIDRCWRCQPNWAKDRKKLA  130



>sp|P15722.1|PLY59_SOLLC RecName: Full=Probable pectate lyase P59; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA33523.1| P59 protein [Solanum lycopersicum]
Length=449

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 11/96 (11%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW-------TNTTR  345
             A I  YD   +++A+EA + +   Y  +PE VT  FN+++ DT+           N+TR
Sbjct  25   MAHIGHYDEVWRRRAEEAKEYARNIYEPHPENVTLAFNQKLRDTMKELKKVKGTHNNSTR  84

Query  346  RHLRG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            R L        C  TN ID+CWRCD +WA +RK+LA
Sbjct  85   RGLGTKKYTGPCMVTNPIDKCWRCDPNWADNRKKLA  120



>ref|XP_010453638.1| PREDICTED: probable pectate lyase 19 [Camelina sativa]
Length=490

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 61/137 (45%), Gaps = 53/137 (39%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEE--------------------  306
            + +I+E D Y  ++ADEA + +LQAY+ +P E+ D+F+E                     
Sbjct  23   RGNISELDEYWSRRADEAREFTLQAYHSDPYEIVDHFHERHYDNSTDATETEEDGAVQLE  82

Query  307  ---VG--------------------DTIMNWTNTTRRHLRG----------SHCKATNSI  387
               VG                      + N TN+TRR LRG            C A+N I
Sbjct  83   EEHVGAQVEEEHGGAKPEEEEEEGIKMVGNSTNSTRRSLRGKGKGKWSKLKGPCTASNPI  142

Query  388  DRCWRCDQDWAKHRKRL  438
            D+CWRC  +WAK RK+L
Sbjct  143  DKCWRCRSNWAKRRKKL  159



>ref|XP_006338480.1| PREDICTED: probable pectate lyase P59-like [Solanum tuberosum]
Length=446

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 12/94 (13%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNW------TNTTRRHLR  357
            I E+D   +++A EA + +++AY  +P  VT  F ++ G  +          N TRR L+
Sbjct  24   IGEFDEVWRRRAQEADEWAIKAYKPDPINVTLAFAKQTGQALKEIKEAKLAINGTRRELK  83

Query  358  GSH------CKATNSIDRCWRCDQDWAKHRKRLA  441
            G        C  TN IDRCWRC  +WA +RKRLA
Sbjct  84   GGGKKYNGPCLVTNPIDRCWRCQPNWADNRKRLA  117



>gb|KEH24975.1| pectate lyase P59-like protein [Medicago truncatula]
Length=453

 Score = 63.9 bits (154),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = +1

Query  199  AEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLR------G  360
            AE D ++K +A+EA + +++ Y   PE V  + N  V  ++    N TRR +R       
Sbjct  38   AEIDDFVKARAEEAHKVAVETYVPIPEGVAHDLNVAVHMSMEAEENNTRREMRQKGKKHD  97

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C+ATN ID CWRC  DWA +R +LA
Sbjct  98   GPCEATNPIDSCWRCKADWAANRFQLA  124


 Score = 23.1 bits (48),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = +2

Query  443  SCARGFGSGTTGGL  484
             C++GFG  TTGGL
Sbjct  125  KCSKGFGRKTTGGL  138



>emb|CDY45254.1| BnaA06g09240D [Brassica napus]
Length=458

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 13/100 (13%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  354
            QA+IA +D Y  ++  +AL+ +L ++   P  VT++ N  V   +      N+TRR L  
Sbjct  28   QANIAVFDDYWTQRQGDALKQTLASFDPYPLNVTNHLNYHVALALDTTESINSTRRELSQ  87

Query  355  --RG------SHCKATNSIDRCWRCDQDWAKHRKRLAFVC  450
              RG        C A N ID+CWRCD+DW K+RK+LA VC
Sbjct  88   ARRGRKMQNRGKCVAHNPIDKCWRCDRDWEKNRKKLA-VC  126



>ref|XP_009761969.1| PREDICTED: probable pectate lyase P59 [Nicotiana sylvestris]
Length=434

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRR--HLRG  360
            +A I E+D   +K+A++A +++  AY+ NP+ V D+ N +V D  +  +N+ RR  H   
Sbjct  21   EAHIGEFDEVWRKRAEKAKKAARHAYHPNPKIVADHLNNQV-DKAVRGSNSRRRDLHRYN  79

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              CKATN ID+CWRCD +WA++R +LA
Sbjct  80   GQCKATNPIDQCWRCDPNWARNRMKLA  106



>gb|AJR10088.1| pectate lyase [Eruca vesicaria subsp. sativa]
Length=456

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 55/96 (57%), Gaps = 11/96 (11%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  354
            QA +A +D Y  ++   AL+ ++++Y  NP  VT++FN      +      N TRR L  
Sbjct  27   QAHVAVFDEYWTQRQANALRQTMESYDPNPSNVTNHFNYHAALAMETTGTDNGTRRELGQ  86

Query  355  -------RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   RG   ++ N+ID+CWR D++WAK+RK+LA
Sbjct  87   VRGGQKARGGRFRSLNAIDKCWRGDKNWAKNRKKLA  122



>ref|XP_006299938.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
 gb|EOA32836.1| hypothetical protein CARUB_v10016149mg [Capsella rubella]
Length=472

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 58/120 (48%), Gaps = 35/120 (29%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE---------------------  303
            +A++ E D Y   KA+EA + +L AY+ +P ++ D+F+E                     
Sbjct  23   RANVPETDEYWVNKANEARKHTLMAYHPDPYDIVDHFHERHYDNSTDVEETEEDKAVDSA  82

Query  304  --EVGDTIMNWTNTTRRHLRG------------SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              E  + I + TN+TRR L G              C A+N ID+CWRC  DWAK RK+L 
Sbjct  83   EEEDIEMISSPTNSTRRSLSGKRRGRGKWSKLRGPCTASNPIDKCWRCQPDWAKRRKKLV  142



>ref|XP_006431087.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 ref|XP_006431088.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
 gb|ESR44327.1| hypothetical protein CICLE_v10011762mg [Citrus clementina]
 gb|ESR44328.1| hypothetical protein CICLE_v10011763mg [Citrus clementina]
Length=435

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---RGSH  366
            IAE D   +++A+EA+Q++ Q Y  +P  V  N N +V D  ++     RR L       
Sbjct  24   IAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQD--LSKQTAARRGLLNAESGQ  81

Query  367  CKATNSIDRCWRCDQDWAKHRKRLA  441
            C+ATN ID+CWRC ++WA+ R+ LA
Sbjct  82   CEATNPIDKCWRCKENWAEDRQALA  106



>ref|XP_010514040.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 53/95 (56%), Gaps = 11/95 (12%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLR--  357
            A +AEYD Y  ++  EAL  +L++Y   P  VTD+FN      +      N TRR LR  
Sbjct  25   AHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAMETTGIANETRRDLRQV  84

Query  358  -------GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   G   ++ N+ID+CWR D++W K+RK+LA
Sbjct  85   KSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKLA  119



>ref|XP_006482544.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=435

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +1

Query  196  IAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---RGSH  366
            IAE D   +++A+EA+Q++ Q Y  +P  V  N N +V D  ++     RR L       
Sbjct  24   IAEADEVWRRRAEEAMQTTEQYYDPDPVAVASNLNMKVQD--LSKQTAARRGLLNAESGQ  81

Query  367  CKATNSIDRCWRCDQDWAKHRKRLA  441
            C+ATN ID+CWRC ++WA+ R+ LA
Sbjct  82   CEATNPIDKCWRCKENWAEDRQALA  106



>gb|KEH19822.1| pectate lyase-like protein [Medicago truncatula]
Length=455

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 6/84 (7%)
 Frame = +1

Query  202  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRG----SHC  369
            E+D+Y +++A  A Q +  AY+ +P  ++ NF   + + I        R+L G      C
Sbjct  38   EFDSYWQERAKVAKQENKAAYFKDPYAISGNFTASISEIIA--VKEKGRNLGGLKDDGTC  95

Query  370  KATNSIDRCWRCDQDWAKHRKRLA  441
             ATN IDRCWRCD +WA +R++LA
Sbjct  96   LATNPIDRCWRCDPNWANNRQKLA  119



>emb|CDY41679.1| BnaC02g34750D [Brassica napus]
Length=457

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 54/96 (56%), Gaps = 11/96 (11%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  354
            QA IA +D Y  ++   AL+ ++++Y  NP  VT++FN      +      N  RR L  
Sbjct  28   QAHIAVFDDYWTQRQANALRQTMESYEPNPLNVTNHFNYHAALAMETTGADNGPRRELGQ  87

Query  355  -------RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   RG   ++ N+IDRCWR D++WAK+RK+LA
Sbjct  88   VKAGQKTRGGRFRSLNAIDRCWRGDKNWAKNRKKLA  123



>ref|XP_010502279.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 53/95 (56%), Gaps = 11/95 (12%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLR--  357
            A +AEYD Y  ++  EAL  +L++Y   P  VTD+FN      +      N TRR LR  
Sbjct  25   AHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAMETTGTANETRRDLRQV  84

Query  358  -------GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   G   ++ N+ID+CWR D++W K+RK+LA
Sbjct  85   KSGKKRRGGRYESLNAIDKCWRGDKNWDKNRKKLA  119



>ref|XP_006480843.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---RG  360
            A+I+E D   +++A+EA+Q++ Q Y  NP  +  + N +V D  ++     RR L     
Sbjct  23   ANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQD--LSKQTAARRGLLNAES  80

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C+ATN ID CWRC ++WA++R+ LA
Sbjct  81   GQCEATNPIDNCWRCKENWAENRQALA  107



>ref|XP_003563707.1| PREDICTED: pectate lyase-like [Brachypodium distachyon]
Length=448

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (55%), Gaps = 6/91 (7%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            QA+I ++D + +++   A  ++   Y  +P EV ++ N  V          TRR + G H
Sbjct  30   QANIGDFDEHWQQRKAAARAAAEAIYQSDPLEVANSLNRAVHRATKEDDAGTRRSMLGKH  89

Query  367  ------CKATNSIDRCWRCDQDWAKHRKRLA  441
                  C+ATN IDRCWRC +DWA  RKRLA
Sbjct  90   KKFAGPCRATNPIDRCWRCRKDWATDRKRLA  120



>ref|XP_006428983.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
 gb|ESR42223.1| hypothetical protein CICLE_v10013750mg [Citrus clementina]
Length=438

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---RG  360
            A+I+E D   +++A+EA+Q++ Q Y  NP  +  + N +V D  ++     RR L     
Sbjct  25   ANISEVDEVWRRRAEEAMQTTEQYYDPNPVAIASHLNMKVQD--LSKQTAARRGLLNAES  82

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C+ATN ID CWRC ++WA++R+ LA
Sbjct  83   GQCEATNPIDNCWRCKENWAENRQALA  109



>gb|KJB62835.1| hypothetical protein B456_009G439500 [Gossypium raimondii]
Length=300

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 55/101 (54%), Gaps = 18/101 (18%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMN------------WT  333
            A+IAE+D + K++ +EA + +L AY   PE VT + N  V   +               T
Sbjct  23   ANIAEFDDFWKQREEEAWKIALTAYERCPENVTSHLNYHVNKVLKKTLSNQPFEFKDVIT  82

Query  334  NTTRRHLRGSH-----CKATNSIDRCWRCDQDWAKHRKRLA  441
            N+TRR LR  H     C   N IDRCWRC ++ +K+RKRL+
Sbjct  83   NSTRRSLRDKHKNTSPCMTINPIDRCWRCKKN-SKNRKRLS  122



>ref|XP_006437462.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
 gb|ESR50702.1| hypothetical protein CICLE_v10031653mg [Citrus clementina]
Length=419

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---RG  360
            A IAE D   +++A+EA+Q++ Q Y  NP  V ++ N +V D  ++     +R L     
Sbjct  6    AHIAEVDEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQD--LSKQAIAKRGLLNAES  63

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C+ATN ID+CWRC ++WA+ R+ LA
Sbjct  64   GQCEATNPIDKCWRCKENWAEDRQALA  90



>gb|EPS66620.1| hypothetical protein M569_08154, partial [Genlisea aurea]
Length=451

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 51/97 (53%), Gaps = 13/97 (13%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWT-------NTT  342
            A IAEYD + KK+  EA   +L +Y  NP ++  + N      +  +N T       N T
Sbjct  22   ARIAEYDDFWKKRRAEAWNRTLLSYEPNPAKIVTHLNLHSHRLLHELNATDHFHLVGNHT  81

Query  343  RRHLRG----SHCKATNSIDRCWRCDQDWAKHRKRLA  441
            RR LRG      C  TN IDRCWRC  DWA +R RLA
Sbjct  82   RRSLRGRRYNGPCTVTNPIDRCWRCRSDWATNRFRLA  118



>ref|XP_010425041.1| PREDICTED: probable pectate lyase 6 [Camelina sativa]
Length=453

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 54/95 (57%), Gaps = 11/95 (12%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHLR--  357
            A +AEYD Y  ++  EAL  +L++Y   P  VTD+FN      +     +N TRR LR  
Sbjct  25   AHVAEYDEYWTQRQTEALHQTLESYDPEPLNVTDHFNYHAALAMETTGISNETRRDLRQV  84

Query  358  -------GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                   G   ++ N+ID+CWR +++W K+RK+LA
Sbjct  85   KSGKKRRGGRYESLNAIDKCWRGNKNWDKNRKKLA  119



>ref|XP_008446067.1| PREDICTED: pectate lyase-like, partial [Cucumis melo]
Length=381

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 3/55 (5%)
 Frame = +1

Query  283  VTDNFNEEVGDTIMNWTNTTRRHLR--GSHCKATNSIDRCWRCDQDWAKHRKRLA  441
            VT+NFN++V  + ++  N TRRHLR     C ATN IDRCWRCD++WA++RK+LA
Sbjct  1    VTNNFNKQVHRS-LDGANNTRRHLRKYTGPCLATNPIDRCWRCDRNWARNRKKLA  54



>ref|XP_006306515.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
 gb|EOA39413.1| hypothetical protein CARUB_v10012514mg [Capsella rubella]
Length=455

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 54/98 (55%), Gaps = 13/98 (13%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTI--MNWTNTTRRHL--  354
            +A +A +D+Y  ++  +AL+ ++ +Y  NP  VT++ N  V   +      N TRR L  
Sbjct  24   KAHVAVFDSYWTQRQSDALKRTMGSYDPNPLNVTNHLNYHVNLAVDAAESFNDTRRELTQ  83

Query  355  ---------RGSHCKATNSIDRCWRCDQDWAKHRKRLA  441
                     R   C A N ID+CWRCD++WA +RK+LA
Sbjct  84   VRSGHRKLKRSGKCLAYNPIDKCWRCDRNWANNRKKLA  121



>gb|AAM60924.1| putative pectate lyase [Arabidopsis thaliana]
Length=475

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 60/123 (49%), Gaps = 38/123 (31%)
 Frame = +1

Query  187  QADIAE-YDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE--------------------  303
            +A++AE  D Y   KA+EA + +L AY+ +P E+ D+F+E                    
Sbjct  23   RANVAEETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNSTDVEGTEEEKAIAS  82

Query  304  ---EVGDTIMNWTNTTRRHLRG--------------SHCKATNSIDRCWRCDQDWAKHRK  432
               +V + I + TN+TRR L G                C A+N ID+CWRC  DWA+ RK
Sbjct  83   EEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPIDKCWRCQPDWARRRK  142

Query  433  RLA  441
            +L 
Sbjct  143  KLV  145



>ref|NP_186776.1| putative pectate lyase 7 [Arabidopsis thaliana]
 sp|Q9SRH4.1|PLY7_ARATH RecName: Full=Probable pectate lyase 7; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF03499.1|AC010676_9 putative pectate lyase [Arabidopsis thaliana]
 gb|AAF26147.1|AC008261_4 putative pectate lyase [Arabidopsis thaliana]
 gb|ABI93918.1| At3g01270 [Arabidopsis thaliana]
 gb|AEE73631.1| putative pectate lyase 7 [Arabidopsis thaliana]
Length=475

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 60/123 (49%), Gaps = 38/123 (31%)
 Frame = +1

Query  187  QADIA-EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE--------------------  303
            +A++A E D Y   KA+EA + +L AY+ +P E+ D+F+E                    
Sbjct  23   RANVADETDEYWVNKANEARKHTLMAYHPDPYEIVDHFHERHYDNSTDVEGTEEEKAVAS  82

Query  304  ---EVGDTIMNWTNTTRRHLRG--------------SHCKATNSIDRCWRCDQDWAKHRK  432
               +V + I + TN+TRR L G                C A+N ID+CWRC  DWA+ RK
Sbjct  83   EEEDVIEMISSPTNSTRRSLTGRGKGKGKGKWSKLTGPCTASNPIDKCWRCQPDWARRRK  142

Query  433  RLA  441
            +L 
Sbjct  143  KLV  145



>emb|CDY63769.1| BnaCnng42620D [Brassica napus]
Length=479

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 60/128 (47%), Gaps = 44/128 (34%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFN----------------------  300
            +A+ +E D Y  K+A EA + +LQAY+ NP EV D+F+                      
Sbjct  23   RANFSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHYDNSTDVKETEEDSDDEKP  82

Query  301  EEVGDTIM----NWTNTTRR-----------------HLRGSHCKATNSIDRCWRCDQDW  417
            EEV D ++    N  N+TRR                  L+G  C A+N ID+CWRC  +W
Sbjct  83   EEVEDDVIEMVGNEMNSTRRILRGKSKGKGKRKGKWSKLKGP-CTASNPIDKCWRCRSNW  141

Query  418  AKHRKRLA  441
            AK RK L 
Sbjct  142  AKRRKNLV  149



>ref|XP_003613595.1| Pectate lyase [Medicago truncatula]
 gb|AES96553.1| pectate lyase P59-like protein [Medicago truncatula]
Length=449

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 6/80 (8%)
 Frame = +1

Query  214  YLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH----CKATN  381
            Y ++KA  A   + +AY  +P  V+ N +  V + I+   N  RR+L G      C ATN
Sbjct  43   YWQQKASAAAMKNDKAYTPDPYAVSGNLSHSVSEMIIG--NQGRRNLAGGKARGPCMATN  100

Query  382  SIDRCWRCDQDWAKHRKRLA  441
             IDRCWRCD +WA +R++LA
Sbjct  101  PIDRCWRCDPNWANNRQKLA  120



>ref|XP_009126031.1| PREDICTED: probable pectate lyase 19 [Brassica rapa]
Length=481

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 60/130 (46%), Gaps = 46/130 (35%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNE---------------------  303
            +A+++E D Y  K+A EA + +LQAY+ NP EV D+F+E                     
Sbjct  23   RANLSELDEYWSKRAGEAREFTLQAYHSNPYEVVDHFHERHYDNSTDVKETEEDSDDEKP  82

Query  304  -----EVGDTIMNWTNTTRR-------------------HLRGSHCKATNSIDRCWRCDQ  411
                 +V + + N  N+TRR                    L+G  C A+N ID+CWRC  
Sbjct  83   EEVEDDVIEMVGNEMNSTRRILRGKPKGKGKGKRKGKWSKLKGP-CTASNPIDKCWRCRS  141

Query  412  DWAKHRKRLA  441
            +WAK RK L 
Sbjct  142  NWAKRRKNLV  151



>emb|CDY28691.1| BnaCnng05770D [Brassica napus]
Length=469

 Score = 61.6 bits (148),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 59/119 (50%), Gaps = 34/119 (29%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGD-----------------  315
            +A++AE D Y   KA+EA + +L AY+ +P ++ D+F+E   D                 
Sbjct  21   RANVAETDEYWVTKANEARRRTLMAYHPDPYQIVDHFHERHYDNSTDVEEMEENASEEED  80

Query  316  ---TIMNWTNTTRRHLRG--------------SHCKATNSIDRCWRCDQDWAKHRKRLA  441
                I + TN+TRR LRG                C A+N ID+CWRC  DWA+ RK+L 
Sbjct  81   DIEMISSATNSTRRSLRGRGKGKGRGKWSKLKGPCTASNPIDKCWRCQPDWARRRKKLV  139


 Score = 22.3 bits (46),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 9/13 (69%), Gaps = 0/13 (0%)
 Frame = +2

Query  443  SCARGFGSGTTGG  481
             C RGFG  TTGG
Sbjct  140  KCVRGFGYKTTGG  152



>gb|EMT25421.1| Pectate lyase [Aegilops tauschii]
Length=323

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 7/91 (8%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHLRGSH  366
            +A+I E+D Y +++  EA   +  AY+ NP EV ++    V   +   + + RR L G H
Sbjct  27   EANIGEFDEYWQRRQLEARARAEAAYHPNPIEVANSLTRAVHRAVREESGS-RRKLLGLH  85

Query  367  ------CKATNSIDRCWRCDQDWAKHRKRLA  441
                  C+ATN IDRCWRC  DWA  R RLA
Sbjct  86   KKFAGPCQATNPIDRCWRCRDDWATDRMRLA  116



>ref|XP_006484673.1| PREDICTED: probable pectate lyase 19-like [Citrus sinensis]
Length=436

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = +1

Query  190  ADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWTNTTRRHL---RG  360
            A IAE +   +++A+EA+Q++ Q Y  NP  V ++ N +V D  ++     +R L     
Sbjct  23   AHIAEVNEVWRRRAEEAMQTTEQYYDPNPVAVANHLNMKVQD--LSKQAIAKRGLLNAES  80

Query  361  SHCKATNSIDRCWRCDQDWAKHRKRLA  441
              C+ATN ID+CWRC ++WA+ R+ LA
Sbjct  81   GQCEATNPIDKCWRCKENWAEDRQALA  107



>ref|XP_009125036.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 7 [Brassica 
rapa]
Length=470

 Score = 61.2 bits (147),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (49%), Gaps = 37/121 (31%)
 Frame = +1

Query  187  QADIAEYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGD-----------------  315
            +A++AE D Y   KA+EA + +L AY+ +P ++ D+F+E   D                 
Sbjct  21   RANVAETDEYWVTKANEARRRTLMAYHPDPYQIVDHFHERHYDNSTDVEEMEENASEEED  80

Query  316  ---TIMNWTNTTRRH----------------LRGSHCKATNSIDRCWRCDQDWAKHRKRL  438
                I + TN+TRR                 L+G  C A+N ID+CWRC  DWA+ RK+L
Sbjct  81   DIEMISSATNSTRRSYLRGRGKGKGRGKWSKLKGP-CTASNPIDKCWRCQPDWARRRKKL  139

Query  439  A  441
             
Sbjct  140  V  140


 Score = 22.3 bits (46),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 9/13 (69%), Gaps = 0/13 (0%)
 Frame = +2

Query  443  SCARGFGSGTTGG  481
             C RGFG  TTGG
Sbjct  141  KCVRGFGYKTTGG  153



>ref|XP_011098576.1| PREDICTED: probable pectate lyase P56 [Sesamum indicum]
Length=465

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 9/89 (10%)
 Frame = +1

Query  202  EYDAYLKKKADEALQSSLQAYYHNPEEVTDNFNEEVGDTIMNWT------NTTRRHLRGS  363
             +D Y +++A  A    LQAY  NPE +  +FN++  + + +        N TRR+L   
Sbjct  47   SHDVYWQERAALARARILQAYNPNPEAIVTDFNQKTKEALEHSQVNRAPHNGTRRNLGRK  106

Query  364  H---CKATNSIDRCWRCDQDWAKHRKRLA  441
            +   C ATN IDRCWRC+ +WA +R++LA
Sbjct  107  YMGPCVATNPIDRCWRCNPNWALNRQKLA  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550