BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F17

Length=574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011081031.1|  PREDICTED: lysophospholipid acyltransferase ...    306   4e-99   Sesamum indicum [beniseed]
ref|XP_006358391.1|  PREDICTED: lysophospholipid acyltransferase ...    300   8e-97   Solanum tuberosum [potatoes]
ref|XP_009764156.1|  PREDICTED: lysophospholipid acyltransferase ...    300   8e-97   Nicotiana sylvestris
ref|XP_004244602.1|  PREDICTED: lysophospholipid acyltransferase ...    299   4e-96   Solanum lycopersicum
emb|CDP09808.1|  unnamed protein product                                296   4e-95   Coffea canephora [robusta coffee]
ref|XP_009628905.1|  PREDICTED: lysophospholipid acyltransferase ...    295   1e-94   Nicotiana tomentosiformis
ref|XP_011072149.1|  PREDICTED: lysophospholipid acyltransferase ...    295   2e-94   Sesamum indicum [beniseed]
gb|EYU38990.1|  hypothetical protein MIMGU_mgv1a005877mg                293   8e-94   Erythranthe guttata [common monkey flower]
ref|XP_009609255.1|  PREDICTED: lysophospholipid acyltransferase ...    291   5e-93   Nicotiana tomentosiformis
gb|EYU29840.1|  hypothetical protein MIMGU_mgv1a0059782mg               285   1e-92   Erythranthe guttata [common monkey flower]
ref|XP_009759896.1|  PREDICTED: lysophospholipid acyltransferase ...    284   2e-90   Nicotiana sylvestris
ref|XP_004245650.1|  PREDICTED: lysophospholipid acyltransferase ...    283   3e-90   Solanum lycopersicum
ref|XP_006364125.1|  PREDICTED: lysophospholipid acyltransferase ...    283   7e-90   Solanum tuberosum [potatoes]
ref|XP_006358867.1|  PREDICTED: lysophospholipid acyltransferase ...    283   7e-90   Solanum tuberosum [potatoes]
gb|AER57988.1|  putative lysophosphatidylcholine acyltransferase 1      280   1e-88   Helianthus annuus
ref|XP_011029182.1|  PREDICTED: lysophospholipid acyltransferase ...    277   1e-87   Populus euphratica
gb|AHE80985.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        277   1e-87   Bernardia pulchella
gb|AER57989.2|  putative lysophosphatidylcholine acyltransferase 2      275   6e-87   
ref|XP_011033798.1|  PREDICTED: lysophospholipid acyltransferase ...    275   7e-87   Populus euphratica
ref|XP_002304469.2|  membrane bound O-acyl transferase family pro...    275   9e-87   Populus trichocarpa [western balsam poplar]
gb|AHE80989.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        275   9e-87   Carthamus tinctorius
gb|AGL74879.1|  1-acylglycerophosphocholine O-acyltransferase           274   2e-86   Vernicia fordii [tung oil tree]
gb|EPS74023.1|  hypothetical protein M569_00723                         274   2e-86   Genlisea aurea
ref|XP_002282807.1|  PREDICTED: lysophospholipid acyltransferase 1      274   2e-86   Vitis vinifera
gb|KHG22777.1|  Lysophospholipid acyltransferase 2                      267   4e-86   Gossypium arboreum [tree cotton]
ref|XP_010278548.1|  PREDICTED: lysophospholipid acyltransferase 1      272   9e-86   Nelumbo nucifera [Indian lotus]
ref|XP_002298063.2|  membrane bound O-acyl transferase family pro...    272   1e-85   
ref|XP_004252578.1|  PREDICTED: lysophospholipid acyltransferase ...    271   1e-85   Solanum lycopersicum
ref|XP_002509709.1|  o-acyltransferase (membrane bound) domain co...    268   1e-85   
gb|KJB68443.1|  hypothetical protein B456_010G246400                    266   3e-85   Gossypium raimondii
ref|XP_008364537.1|  PREDICTED: lysophospholipid acyltransferase ...    270   6e-85   
gb|KJB68445.1|  hypothetical protein B456_010G246400                    268   9e-85   Gossypium raimondii
ref|XP_010546005.1|  PREDICTED: lysophospholipid acyltransferase 1      269   1e-84   Tarenaya hassleriana [spider flower]
gb|AGO14581.1|  lysophosphatidylcholine acyltransferase                 269   1e-84   Ricinus communis
gb|KJB68442.1|  hypothetical protein B456_010G246400                    268   3e-84   Gossypium raimondii
gb|AHE80988.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        268   4e-84   Hiptage benghalensis
gb|KJB68447.1|  hypothetical protein B456_010G246400                    266   7e-84   Gossypium raimondii
ref|XP_010112575.1|  hypothetical protein L484_010580                   267   1e-83   Morus notabilis
emb|CBI34747.3|  unnamed protein product                                266   1e-83   Vitis vinifera
ref|XP_007023110.1|  MBOAT (membrane bound O-acyl transferase) fa...    264   1e-83   
gb|AHE80984.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        266   3e-83   Bernardia pulchella
ref|XP_006440537.1|  hypothetical protein CICLE_v10020062mg             262   3e-83   
ref|XP_009364173.1|  PREDICTED: lysophospholipid acyltransferase ...    266   3e-83   Pyrus x bretschneideri [bai li]
gb|AGM15932.1|  lysophosphatidylcholine acyltransferase 2               265   3e-83   Physaria fendleri
ref|XP_009377923.1|  PREDICTED: lysophospholipid acyltransferase ...    265   4e-83   Pyrus x bretschneideri [bai li]
ref|XP_007023106.1|  MBOAT (membrane bound O-acyl transferase) fa...    265   4e-83   Theobroma cacao [chocolate]
gb|AGM15931.1|  lysophosphatidylcholine acyltransferase 1               265   4e-83   Physaria fendleri
gb|KDO63566.1|  hypothetical protein CISIN_1g012501mg                   263   5e-83   Citrus sinensis [apfelsine]
ref|XP_008369472.1|  PREDICTED: lysophospholipid acyltransferase ...    265   6e-83   
ref|XP_009339650.1|  PREDICTED: lysophospholipid acyltransferase ...    265   6e-83   Pyrus x bretschneideri [bai li]
gb|KDP25507.1|  hypothetical protein JCGZ_20663                         265   6e-83   Jatropha curcas
gb|KDO63565.1|  hypothetical protein CISIN_1g012501mg                   263   7e-83   Citrus sinensis [apfelsine]
ref|XP_002886438.1|  membrane bound O-acyl transferase family pro...    265   7e-83   Arabidopsis lyrata subsp. lyrata
ref|XP_010476235.1|  PREDICTED: lysophospholipid acyltransferase 1      265   8e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010933881.1|  PREDICTED: lysophospholipid acyltransferase ...    264   9e-83   Elaeis guineensis
gb|AHE80986.1|  acyl-CoA:lysophosphatidylcholine acyltransferase        264   1e-82   Hiptage benghalensis
ref|XP_008795385.1|  PREDICTED: lysophospholipid acyltransferase ...    263   2e-82   Phoenix dactylifera
gb|KCW72088.1|  hypothetical protein EUGRSUZ_E00532                     261   2e-82   Eucalyptus grandis [rose gum]
ref|XP_010553491.1|  PREDICTED: lysophospholipid acyltransferase ...    263   2e-82   Tarenaya hassleriana [spider flower]
ref|XP_006307436.1|  hypothetical protein CARUB_v10009061mg             263   2e-82   Capsella rubella
ref|XP_006440536.1|  hypothetical protein CICLE_v10020062mg             263   3e-82   Citrus clementina [clementine]
ref|XP_010494443.1|  PREDICTED: lysophospholipid acyltransferase ...    263   3e-82   Camelina sativa [gold-of-pleasure]
gb|KDO63564.1|  hypothetical protein CISIN_1g012501mg                   263   3e-82   Citrus sinensis [apfelsine]
dbj|BAJ34298.1|  unnamed protein product                                259   3e-82   Eutrema halophilum
gb|KCW72087.1|  hypothetical protein EUGRSUZ_E00532                     260   4e-82   Eucalyptus grandis [rose gum]
ref|XP_007209112.1|  hypothetical protein PRUPE_ppa005358mg             262   6e-82   
ref|XP_002892700.1|  membrane bound O-acyl transferase family pro...    262   7e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_008803275.1|  PREDICTED: lysophospholipid acyltransferase ...    262   9e-82   Phoenix dactylifera
ref|XP_004298745.1|  PREDICTED: lysophospholipid acyltransferase 1      262   9e-82   Fragaria vesca subsp. vesca
ref|XP_010458693.1|  PREDICTED: lysophospholipid acyltransferase ...    261   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010055596.1|  PREDICTED: lysophospholipid acyltransferase ...    261   2e-81   Eucalyptus grandis [rose gum]
ref|XP_006477394.1|  PREDICTED: membrane-bound O-acyltransferase ...    261   2e-81   Citrus sinensis [apfelsine]
ref|XP_006417213.1|  hypothetical protein EUTSA_v10007564mg             260   4e-81   Eutrema salsugineum [saltwater cress]
ref|NP_176493.1|  lysophosphatidylcholine acyltransferase               259   6e-81   Arabidopsis thaliana [mouse-ear cress]
emb|CDY63224.1|  BnaCnng41640D                                          259   7e-81   Brassica napus [oilseed rape]
ref|XP_009148576.1|  PREDICTED: lysophospholipid acyltransferase 1      259   9e-81   Brassica rapa
ref|NP_172724.2|  lysophosphatidylcholine acyltransferase 1             258   1e-80   Arabidopsis thaliana [mouse-ear cress]
emb|CDX98051.1|  BnaA06g08020D                                          259   1e-80   
gb|KFK43529.1|  hypothetical protein AALP_AA1G138000                    258   2e-80   Arabis alpina [alpine rockcress]
ref|XP_004515799.1|  PREDICTED: lysophospholipid acyltransferase ...    258   3e-80   Cicer arietinum [garbanzo]
ref|XP_010255524.1|  PREDICTED: lysophospholipid acyltransferase ...    258   3e-80   Nelumbo nucifera [Indian lotus]
ref|XP_008238778.1|  PREDICTED: lysophospholipid acyltransferase 1      258   4e-80   Prunus mume [ume]
ref|XP_010919229.1|  PREDICTED: lysophospholipid acyltransferase ...    257   5e-80   Elaeis guineensis
ref|XP_008448977.1|  PREDICTED: lysophospholipid acyltransferase 1      257   5e-80   Cucumis melo [Oriental melon]
ref|XP_004148282.1|  PREDICTED: lysophospholipid acyltransferase-...    257   6e-80   Cucumis sativus [cucumbers]
gb|AAM13086.1|  unknown protein                                         257   6e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430382.1|  PREDICTED: lysophospholipid acyltransferase ...    257   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_004515798.1|  PREDICTED: lysophospholipid acyltransferase ...    257   8e-80   
ref|XP_010418312.1|  PREDICTED: lysophospholipid acyltransferase ...    256   1e-79   Camelina sativa [gold-of-pleasure]
gb|KHN14121.1|  Membrane-bound O-acyltransferase domain-containin...    256   1e-79   Glycine soja [wild soybean]
ref|XP_009113025.1|  PREDICTED: lysophospholipid acyltransferase 2      256   1e-79   Brassica rapa
gb|KHN34432.1|  Lysophospholipid acyltransferase 2                      256   1e-79   Glycine soja [wild soybean]
emb|CDY45972.1|  BnaA09g12940D                                          256   1e-79   Brassica napus [oilseed rape]
ref|XP_003525728.1|  PREDICTED: lysophospholipid acyltransferase ...    256   1e-79   Glycine max [soybeans]
ref|XP_003549863.1|  PREDICTED: lysophospholipid acyltransferase 2      256   2e-79   Glycine max [soybeans]
emb|CDY57076.1|  BnaCnng31560D                                          255   4e-79   Brassica napus [oilseed rape]
ref|XP_010473534.1|  PREDICTED: lysophospholipid acyltransferase 2      254   6e-79   Camelina sativa [gold-of-pleasure]
gb|KJB29823.1|  hypothetical protein B456_005G120200                    254   7e-79   Gossypium raimondii
gb|KJB29824.1|  hypothetical protein B456_005G120200                    254   8e-79   Gossypium raimondii
ref|XP_010934444.1|  PREDICTED: lysophospholipid acyltransferase ...    253   8e-79   Elaeis guineensis
ref|XP_006857893.1|  hypothetical protein AMTR_s00069p00124460          254   8e-79   
gb|AAF88094.1|AC025417_22  T12C24.17                                    254   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934443.1|  PREDICTED: lysophospholipid acyltransferase ...    254   1e-78   Elaeis guineensis
ref|XP_006300445.1|  hypothetical protein CARUB_v10020125mg             255   1e-78   
gb|KHG06049.1|  Lysophospholipid acyltransferase 2                      253   2e-78   Gossypium arboreum [tree cotton]
ref|XP_006391786.1|  hypothetical protein EUTSA_v10023446mg             253   2e-78   Eutrema salsugineum [saltwater cress]
ref|XP_007155562.1|  hypothetical protein PHAVU_003G212400g             252   4e-78   Phaseolus vulgaris [French bean]
gb|AGL81301.1|  lysophosphatidylcholine acyltransferase                 252   6e-78   Momordica charantia [balsam pear]
ref|XP_002454488.1|  hypothetical protein SORBIDRAFT_04g031990          250   3e-77   Sorghum bicolor [broomcorn]
ref|XP_004953433.1|  PREDICTED: lysophospholipid acyltransferase-...    249   4e-77   
gb|KEH31706.1|  membrane-bound O-acyltransferase family MBOAT pro...    249   5e-77   Medicago truncatula
ref|XP_010693498.1|  PREDICTED: lysophospholipid acyltransferase ...    248   1e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008646049.1|  PREDICTED: lysophospholipid acyltransferase 1      248   2e-76   
gb|KFK40546.1|  hypothetical protein AALP_AA2G010000                    248   2e-76   Arabis alpina [alpine rockcress]
gb|AFW72781.1|  hypothetical protein ZEAMMB73_982934                    248   4e-76   
ref|XP_003570095.1|  PREDICTED: lysophospholipid acyltransferase 2      246   1e-75   Brachypodium distachyon [annual false brome]
ref|XP_009391951.1|  PREDICTED: lysophospholipid acyltransferase ...    245   3e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047723.1|  Os02g0676000                                       244   8e-75   
gb|ABK24304.1|  unknown                                                 243   1e-74   Picea sitchensis
dbj|BAJ87726.1|  predicted protein                                      239   7e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002892698.1|  predicted protein                                  228   5e-69   
ref|XP_010494450.1|  PREDICTED: lysophospholipid acyltransferase ...    228   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_007023107.1|  MBOAT (membrane bound O-acyl transferase) fa...    208   2e-61   
ref|XP_001751825.1|  predicted protein                                  195   6e-56   
ref|XP_001780460.1|  predicted protein                                  194   9e-56   
ref|XP_001763507.1|  predicted protein                                  190   3e-54   
gb|KFK23829.1|  hypothetical protein AALP_AAs39384U000100               150   2e-42   Arabis alpina [alpine rockcress]
ref|XP_006665020.1|  PREDICTED: lysophospholipid acyltransferase-...    149   3e-39   
ref|XP_005649636.1|  membrane bound O-acyl transferase family pro...    135   7e-34   Coccomyxa subellipsoidea C-169
gb|AFW72780.1|  hypothetical protein ZEAMMB73_982934                    124   7e-33   
gb|KJB68448.1|  hypothetical protein B456_010G246400                    121   3e-29   Gossypium raimondii
ref|XP_005850438.1|  hypothetical protein CHLNCDRAFT_20761              122   3e-29   Chlorella variabilis
gb|EMT11338.1|  hypothetical protein F775_10017                         114   4e-29   
ref|XP_006386564.1|  hypothetical protein POPTR_0002s14510g             109   5e-27   
ref|XP_002500677.1|  predicted protein                                  106   1e-23   Micromonas commoda
ref|XP_011398849.1|  Membrane-bound O-acyltransferase domain-cont...  99.0    6e-21   Auxenochlorella protothecoides
gb|KDD76279.1|  membrane-bound O-acyltransferase                      98.6    2e-20   Helicosporidium sp. ATCC 50920
ref|XP_002950776.1|  hypothetical protein VOLCADRAFT_120919           94.0    1e-18   Volvox carteri f. nagariensis
gb|KIY98914.1|  hypothetical protein MNEG_9048                        89.7    2e-17   Monoraphidium neglectum
ref|XP_003084126.1|  Predicted membrane protein (ISS)                 89.4    2e-17   Ostreococcus tauri
ref|XP_004353223.1|  hypothetical protein ACA1_073390                 84.7    9e-16   Acanthamoeba castellanii str. Neff
ref|XP_007023108.1|  MBOAT (membrane bound O-acyl transferase) fa...  82.0    3e-15   
ref|XP_003064354.1|  predicted protein                                82.8    4e-15   Micromonas pusilla CCMP1545
gb|EMT11337.1|  hypothetical protein F775_10016                       79.0    5e-14   
gb|EMS54344.1|  hypothetical protein TRIUR3_33673                     77.8    1e-13   Triticum urartu
ref|XP_007511041.1|  predicted protein                                78.2    2e-13   Bathycoccus prasinos
ref|XP_642430.1|  membrane bound O-acyl transferase family protein    75.5    1e-12   Dictyostelium discoideum AX4
ref|XP_003283301.1|  hypothetical protein DICPUDRAFT_52171            75.1    2e-12   Dictyostelium purpureum
ref|XP_004356029.1|  membrane bound O-acyl transferase family pro...  73.9    4e-12   Cavenderia fasciculata
ref|XP_001422221.1|  predicted protein                                72.0    1e-11   Ostreococcus lucimarinus CCE9901
gb|EJY80788.1|  Membrane bound O-acyl transferase family protein      71.6    2e-11   Oxytricha trifallax
ref|XP_011499110.1|  PREDICTED: lysophospholipid acyltransferase 5    72.0    2e-11   Ceratosolen solmsi marchali
gb|EJY79920.1|  Membrane bound O-acyl transferase family protein      71.6    2e-11   Oxytricha trifallax
ref|XP_007433489.1|  PREDICTED: lysophospholipid acyltransferase 1    71.6    3e-11   Python bivittatus
ref|XP_009526166.1|  hypothetical protein PHYSODRAFT_314590           71.2    3e-11   Phytophthora sojae
ref|XP_699295.3|  PREDICTED: lysophospholipid acyltransferase 2 i...  71.2    3e-11   Danio rerio [leopard danio]
ref|XP_001360700.2|  GA14938                                          70.5    9e-11   Drosophila pseudoobscura pseudoobscura
ref|XP_002016308.1|  GL10561                                          70.5    9e-11   Drosophila persimilis
ref|XP_002059375.1|  GJ17620                                          69.7    1e-10   Drosophila virilis
ref|XP_001692975.1|  predicted protein                                67.8    3e-10   Chlamydomonas reinhardtii
ref|XP_011058665.1|  PREDICTED: membrane-bound O-acyltransferase ...  67.4    6e-10   Acromyrmex echinatior
ref|XP_007252280.1|  PREDICTED: membrane-bound O-acyltransferase ...  67.4    7e-10   
gb|EJY76231.1|  Membrane bound O-acyl transferase family protein      67.0    9e-10   Oxytricha trifallax
ref|XP_002063522.1|  GK21363                                          67.4    1e-09   Drosophila willistoni
emb|CDJ83922.1|  Membrane bound O-acyl transferase domain contain...  65.9    1e-09   Haemonchus contortus [red stomach worm]
dbj|GAM22032.1|  hypothetical protein SAMD00019534_052070             66.6    1e-09   Acytostelium subglobosum LB1
ref|XP_004868363.1|  PREDICTED: lysophospholipid acyltransferase ...  66.6    1e-09   Heterocephalus glaber [naked mole rat]
ref|XP_004644660.1|  PREDICTED: lysophospholipid acyltransferase 2    66.2    2e-09   Octodon degus
ref|XP_001959520.1|  GF12916                                          66.6    2e-09   Drosophila ananassae
ref|XP_002670587.1|  predicted protein                                66.2    2e-09   Naegleria gruberi strain NEG-M
ref|XP_004082306.1|  PREDICTED: lysophospholipid acyltransferase 2    66.2    2e-09   Oryzias latipes [Japanese rice fish]
ref|XP_001381215.1|  PREDICTED: lysophospholipid acyltransferase ...  66.2    2e-09   Monodelphis domestica
ref|XP_011332944.1|  PREDICTED: membrane-bound O-acyltransferase ...  65.9    2e-09   Ooceraea biroi
ref|XP_002089885.1|  GE21852                                          66.2    2e-09   Drosophila yakuba
ref|NP_610546.1|  oysgedart, isoform A                                65.9    3e-09   Drosophila melanogaster
gb|EFA78146.1|  membrane bound O-acyl transferase family protein      65.5    3e-09   Heterostelium album PN500
ref|XP_003962745.1|  PREDICTED: membrane-bound O-acyltransferase ...  65.5    3e-09   
ref|XP_005696929.1|  PREDICTED: lysophospholipid acyltransferase 1    65.5    3e-09   
ref|XP_005101404.1|  PREDICTED: membrane-bound O-acyltransferase ...  65.5    3e-09   Aplysia californica
ref|XP_002590246.1|  hypothetical protein BRAFLDRAFT_254328           65.1    3e-09   Branchiostoma floridae
ref|XP_008306774.1|  PREDICTED: lysophospholipid acyltransferase 2    65.1    4e-09   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_001986306.1|  GH21285                                          65.5    4e-09   Drosophila grimshawi
ref|XP_003757931.1|  PREDICTED: membrane-bound O-acyltransferase ...  65.1    5e-09   Sarcophilus harrisii
ref|XP_004384055.1|  PREDICTED: lysophospholipid acyltransferase 1    64.7    5e-09   Trichechus manatus latirostris
ref|XP_005177952.1|  PREDICTED: lysophospholipid acyltransferase 1    65.1    5e-09   Musca domestica
ref|XP_005801344.1|  PREDICTED: membrane-bound O-acyltransferase ...  64.7    5e-09   
ref|XP_004521129.1|  PREDICTED: membrane-bound O-acyltransferase ...  65.1    6e-09   
ref|XP_003464977.1|  PREDICTED: membrane-bound O-acyltransferase ...  64.7    6e-09   
emb|CCA75323.1|  hypothetical protein PIIN_09308                      64.7    6e-09   Serendipita indica DSM 11827
ref|XP_010620974.1|  PREDICTED: lysophospholipid acyltransferase 2    64.7    6e-09   Fukomys damarensis [Damara mole rat]
ref|XP_007671493.1|  PREDICTED: LOW QUALITY PROTEIN: lysophosphol...  64.3    6e-09   
ref|XP_011209779.1|  PREDICTED: lysophospholipid acyltransferase 1    64.7    6e-09   Bactrocera dorsalis [papaya fruit fly]
ref|XP_010590200.1|  PREDICTED: LOW QUALITY PROTEIN: lysophosphol...  64.3    7e-09   Loxodonta africana [African bush elephant]
ref|XP_005723976.1|  PREDICTED: membrane-bound O-acyltransferase ...  64.3    8e-09   Pundamilia nyererei
ref|XP_004540559.1|  PREDICTED: membrane-bound O-acyltransferase ...  64.3    8e-09   Maylandia zebra
ref|XP_005942406.1|  PREDICTED: membrane-bound O-acyltransferase ...  63.9    9e-09   Haplochromis burtoni
ref|XP_003219829.1|  PREDICTED: lysophospholipid acyltransferase 1    63.9    9e-09   Anolis carolinensis [Carolina anole]
gb|ETP43022.1|  hypothetical protein F442_10106                       63.9    9e-09   Phytophthora parasitica P10297
ref|XP_011151698.1|  PREDICTED: lysophospholipid acyltransferase 2    63.9    9e-09   Harpegnathos saltator
ref|XP_008848363.1|  PREDICTED: lysophospholipid acyltransferase 2    63.9    9e-09   Nannospalax galili
ref|XP_011427949.1|  PREDICTED: lysophospholipid acyltransferase ...  63.5    1e-08   Crassostrea gigas
gb|ENN75377.1|  hypothetical protein YQE_08152                        63.5    1e-08   Dendroctonus ponderosae
emb|CDW83355.1|  UNKNOWN                                              63.5    1e-08   Stylonychia lemnae
ref|XP_011196586.1|  PREDICTED: lysophospholipid acyltransferase 1    63.9    1e-08   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_001604606.2|  PREDICTED: lysophospholipid acyltransferase 5    63.5    1e-08   Nasonia vitripennis
gb|KDR07796.1|  Lysophospholipid acyltransferase 5                    63.5    1e-08   Zootermopsis nevadensis
ref|XP_002908001.1|  lysophospholipid acyltransferase, putative       63.5    1e-08   Phytophthora infestans T30-4
ref|XP_007197213.1|  PREDICTED: lysophospholipid acyltransferase ...  63.5    1e-08   Balaenoptera acutorostrata scammoni
ref|XP_007197214.1|  PREDICTED: lysophospholipid acyltransferase ...  63.5    1e-08   Balaenoptera acutorostrata scammoni
gb|EHB15193.1|  Lysophospholipid acyltransferase 2                    63.5    1e-08   Heterocephalus glaber [naked mole rat]
ref|XP_007476227.1|  PREDICTED: lysophospholipid acyltransferase ...  63.5    1e-08   
ref|XP_005404403.1|  PREDICTED: lysophospholipid acyltransferase 2    63.5    1e-08   Chinchilla lanigera
ref|XP_007664636.1|  PREDICTED: lysophospholipid acyltransferase 1    63.5    1e-08   
ref|XP_004368224.1|  Membranebound O-acyltransferase domain conta...  63.5    1e-08   Acanthamoeba castellanii str. Neff
ref|XP_008893287.1|  hypothetical protein PPTG_01659                  63.5    1e-08   Phytophthora parasitica INRA-310
ref|XP_002080853.1|  GD26012                                          63.9    1e-08   
ref|NP_524157.2|  nessy, isoform A                                    63.5    1e-08   Drosophila melanogaster
ref|XP_004660118.1|  PREDICTED: LOW QUALITY PROTEIN: lysophosphol...  63.5    1e-08   Jaculus jaculus
ref|XP_011228196.1|  PREDICTED: lysophospholipid acyltransferase 2    63.5    1e-08   
gb|EGI62973.1|  Membrane-bound O-acyltransferase domain-containin...  63.2    2e-08   Acromyrmex echinatior
ref|XP_008299182.1|  PREDICTED: membrane-bound O-acyltransferase ...  63.2    2e-08   Stegastes partitus
ref|XP_004019389.1|  PREDICTED: lysophospholipid acyltransferase 1    63.5    2e-08   
ref|XP_005477146.1|  PREDICTED: membrane-bound O-acyltransferase ...  63.2    2e-08   Oreochromis niloticus
ref|XP_001083917.2|  PREDICTED: lysophospholipid acyltransferase ...  62.8    2e-08   
ref|XP_007969738.1|  PREDICTED: lysophospholipid acyltransferase ...  62.8    2e-08   Chlorocebus sabaeus
ref|XP_007565592.1|  PREDICTED: lysophospholipid acyltransferase 2    63.2    2e-08   Poecilia formosa
gb|AAD28257.1|AF128112_1  putative transmembrane protein nessy        63.2    2e-08   Drosophila melanogaster
dbj|BAH12219.1|  unnamed protein product                              62.8    2e-08   Homo sapiens [man]
ref|XP_004401863.1|  PREDICTED: lysophospholipid acyltransferase 2    63.2    2e-08   Odobenus rosmarus divergens
ref|XP_006898258.1|  PREDICTED: lysophospholipid acyltransferase 2    63.2    2e-08   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004609428.1|  PREDICTED: lysophospholipid acyltransferase 2    63.2    2e-08   Sorex araneus [Eurasian shrew]
ref|XP_005867334.1|  PREDICTED: lysophospholipid acyltransferase 2    62.8    2e-08   Myotis brandtii
ref|NP_001087473.1|  lysophosphatidylcholine acyltransferase 3        62.8    2e-08   Xenopus laevis [clawed frog]
ref|XP_009063331.1|  hypothetical protein LOTGIDRAFT_129765           62.8    2e-08   Lottia gigantea
ref|XP_007446010.1|  PREDICTED: lysophospholipid acyltransferase 1    62.8    2e-08   Lipotes vexillifer [baiji]
ref|XP_007969727.1|  PREDICTED: lysophospholipid acyltransferase ...  62.8    2e-08   Chlorocebus sabaeus
ref|XP_011242607.1|  PREDICTED: lysophospholipid acyltransferase ...  62.0    2e-08   Mus musculus [mouse]
ref|XP_009440252.1|  PREDICTED: lysophospholipid acyltransferase 2    62.8    2e-08   
gb|ELK29149.1|  Lysophospholipid acyltransferase 2                    62.8    2e-08   Myotis davidii
ref|XP_683208.1|  PREDICTED: lysophospholipid acyltransferase 5       62.8    2e-08   
ref|XP_007053245.1|  PREDICTED: membrane-bound O-acyltransferase ...  62.8    2e-08   Chelonia mydas [green seaturtle]
gb|EPQ08440.1|  Lysophospholipid acyltransferase 2                    62.8    2e-08   Myotis brandtii
ref|XP_006106384.1|  PREDICTED: lysophospholipid acyltransferase 2    62.8    2e-08   
ref|XP_005576658.1|  PREDICTED: lysophospholipid acyltransferase ...  62.8    2e-08   Macaca fascicularis [crab eating macaque]
ref|XP_010377990.1|  PREDICTED: lysophospholipid acyltransferase 2    62.8    2e-08   Rhinopithecus roxellana
ref|XP_002042667.1|  GM14886                                          62.8    2e-08   Drosophila sechellia
ref|NP_001088865.1|  lysophosphatidylcholine acyltransferase 3        62.8    2e-08   Xenopus laevis [clawed frog]
ref|XP_003908301.1|  PREDICTED: lysophospholipid acyltransferase ...  62.8    2e-08   Papio anubis [baboon]
dbj|BAC85105.1|  unnamed protein product                              62.8    3e-08   Homo sapiens [man]
ref|NP_620154.2|  lysophospholipid acyltransferase 2                  62.8    3e-08   Homo sapiens [man]
ref|XP_006198743.1|  PREDICTED: lysophospholipid acyltransferase 1    62.4    3e-08   
ref|XP_002085460.1|  GD12294                                          62.4    3e-08   
ref|XP_004373135.1|  PREDICTED: lysophospholipid acyltransferase 2    62.8    3e-08   Trichechus manatus latirostris
ref|XP_009967143.1|  PREDICTED: membrane-bound O-acyltransferase ...  60.8    3e-08   Tyto alba [Schleiereule]
ref|XP_008560197.1|  PREDICTED: lysophospholipid acyltransferase ...  62.4    3e-08   Microplitis demolitor
ref|XP_005066484.1|  PREDICTED: lysophospholipid acyltransferase 1    62.4    3e-08   
ref|XP_007235305.1|  PREDICTED: membrane-bound O-acyltransferase ...  62.4    3e-08   Astyanax mexicanus [blind cave fish]
ref|XP_009235832.1|  PREDICTED: lysophospholipid acyltransferase ...  62.0    3e-08   
ref|XP_009842322.1|  hypothetical protein, variant 9                  61.6    3e-08   Aphanomyces astaci
ref|XP_005355055.1|  PREDICTED: lysophospholipid acyltransferase 1    62.4    3e-08   Microtus ochrogaster [prairie voles]
ref|XP_008300105.1|  PREDICTED: membrane-bound O-acyltransferase ...  62.4    4e-08   Stegastes partitus
ref|XP_002758028.3|  PREDICTED: lysophospholipid acyltransferase 2    62.4    4e-08   
ref|XP_002086338.1|  GE22919                                          62.0    4e-08   Drosophila yakuba
ref|XP_005709095.1|  membrane bound O-acyl transferase (MBOAT) fa...  62.0    4e-08   Galdieria sulphuraria
ref|XP_004186086.1|  membrane-bound O-acyltransferase mboat famil...  60.1    4e-08   Entamoeba invadens IP1
ref|XP_001969110.1|  GG25239                                          62.8    4e-08   
ref|XP_003496828.1|  PREDICTED: lysophospholipid acyltransferase ...  62.0    4e-08   Cricetulus griseus [Chinese hamsters]
ref|XP_002197683.1|  PREDICTED: membrane-bound O-acyltransferase ...  62.0    4e-08   Taeniopygia guttata
ref|XP_006864041.1|  PREDICTED: lysophospholipid acyltransferase 2    62.0    4e-08   Chrysochloris asiatica
ref|XP_005709094.1|  membrane bound O-acyl transferase (MBOAT) fa...  62.0    4e-08   Galdieria sulphuraria
ref|XP_004273580.1|  PREDICTED: lysophospholipid acyltransferase 1    62.0    4e-08   Orcinus orca [Orca]
ref|XP_002812355.3|  PREDICTED: lysophospholipid acyltransferase ...  62.0    4e-08   
ref|XP_010746884.1|  PREDICTED: membrane-bound O-acyltransferase ...  62.0    4e-08   Larimichthys crocea [croceine croaker]
ref|XP_010896429.1|  PREDICTED: lysophospholipid acyltransferase 2    62.0    4e-08   
ref|XP_003844361.1|  similar to MBOAT family protein                  62.0    4e-08   Leptosphaeria maculans JN3
gb|ERE79958.1|  lysophospholipid acyltransferase 1                    62.0    5e-08   Cricetulus griseus [Chinese hamsters]
ref|XP_008587713.1|  PREDICTED: lysophospholipid acyltransferase 1    61.6    5e-08   Galeopterus variegatus [Malayan flying lemur]
emb|CDQ79223.1|  unnamed protein product                              61.6    5e-08   Oncorhynchus mykiss
ref|XP_008992148.1|  PREDICTED: LOW QUALITY PROTEIN: lysophosphol...  61.6    5e-08   
ref|XP_005905579.1|  PREDICTED: lysophospholipid acyltransferase 2    61.6    5e-08   
ref|XP_007457003.1|  PREDICTED: lysophospholipid acyltransferase ...  61.6    5e-08   
emb|CCA18672.1|  lysophospholipid acyltransferase putative            61.6    5e-08   
ref|XP_010978414.1|  PREDICTED: lysophospholipid acyltransferase 1    61.6    5e-08   
gb|KJA21611.1|  hypothetical protein HYPSUDRAFT_140361                61.6    6e-08   
ref|XP_005521935.1|  PREDICTED: membrane-bound O-acyltransferase ...  61.6    6e-08   
ref|NP_705774.1|  lysophospholipid acyltransferase 1                  61.6    6e-08   
gb|EAX01013.1|  O-acyltransferase (membrane bound) domain contain...  61.6    6e-08   
ref|XP_010564996.1|  PREDICTED: lysophospholipid acyltransferase 2    61.6    6e-08   
ref|XP_001973313.1|  GG13418                                          61.6    6e-08   
ref|XP_006123680.1|  PREDICTED: membrane-bound O-acyltransferase ...  61.6    6e-08   
ref|XP_008178122.1|  PREDICTED: lysophospholipid acyltransferase ...  61.6    6e-08   
ref|XP_006123679.1|  PREDICTED: membrane-bound O-acyltransferase ...  61.6    6e-08   
gb|AAH24653.1|  Mboat1 protein                                        61.6    6e-08   
ref|XP_009842333.1|  hypothetical protein, variant 1                  61.2    6e-08   
ref|XP_009842324.1|  hypothetical protein, variant 11                 60.8    6e-08   
ref|XP_001253491.3|  PREDICTED: lysophospholipid acyltransferase ...  61.6    6e-08   
ref|XP_008400149.1|  PREDICTED: lysophospholipid acyltransferase 2    61.6    6e-08   
ref|NP_001096155.1|  membrane bound O-acyltransferase domain cont...  61.6    6e-08   
gb|KDO19623.1|  hypothetical protein SPRG_14300                       61.2    6e-08   
ref|NP_001102590.1|  lysophospholipid acyltransferase 1               61.2    7e-08   
ref|XP_008858839.1|  membrane-bound O-acyltransferase (MBOAT ) fa...  61.2    7e-08   
ref|XP_006073877.1|  PREDICTED: lysophospholipid acyltransferase 2    61.2    7e-08   
ref|NP_001026261.1|  membrane-bound O-acyltransferase domain-cont...  61.2    7e-08   
ref|XP_004274952.1|  PREDICTED: lysophospholipid acyltransferase 2    61.2    7e-08   
gb|EYB99497.1|  hypothetical protein Y032_0122g1082                   60.8    7e-08   
gb|EYB99499.1|  hypothetical protein Y032_0122g1082                   61.2    7e-08   
ref|XP_011332945.1|  PREDICTED: membrane-bound O-acyltransferase ...  61.2    7e-08   
ref|XP_003787425.1|  PREDICTED: lysophospholipid acyltransferase 2    61.2    7e-08   
gb|EKC41409.1|  Lysophospholipid acyltransferase 5                    60.8    8e-08   
gb|EHH21875.1|  hypothetical protein EGK_05035                        61.2    8e-08   
ref|XP_004436507.1|  PREDICTED: lysophospholipid acyltransferase ...  60.8    8e-08   
ref|XP_011416786.1|  PREDICTED: membrane-bound O-acyltransferase ...  61.2    8e-08   
ref|XP_006972346.1|  PREDICTED: lysophospholipid acyltransferase 1    61.2    8e-08   
ref|XP_007430948.1|  PREDICTED: membrane-bound O-acyltransferase ...  61.2    8e-08   
ref|XP_009842325.1|  hypothetical protein H257_15806                  60.8    9e-08   
ref|XP_007457002.1|  PREDICTED: lysophospholipid acyltransferase ...  60.8    9e-08   
ref|XP_007767942.1|  MBOAT-domain-containing protein                  60.8    9e-08   
ref|XP_006765254.1|  PREDICTED: lysophospholipid acyltransferase 2    61.2    9e-08   
ref|XP_006182285.1|  PREDICTED: lysophospholipid acyltransferase 1    60.8    9e-08   
ref|XP_001928378.1|  PREDICTED: lysophospholipid acyltransferase ...  60.8    1e-07   
ref|XP_006909296.1|  PREDICTED: lysophospholipid acyltransferase 1    60.8    1e-07   
emb|CCI43023.1|  unnamed protein product                              60.8    1e-07   
ref|XP_005898295.1|  PREDICTED: lysophospholipid acyltransferase 1    60.8    1e-07   
ref|NP_001179786.1|  lysophospholipid acyltransferase 1               60.8    1e-07   
ref|XP_004436506.1|  PREDICTED: lysophospholipid acyltransferase ...  60.8    1e-07   
gb|EPY83145.1|  lysophospholipid acyltransferase 1                    60.8    1e-07   
ref|XP_010847121.1|  PREDICTED: lysophospholipid acyltransferase ...  60.8    1e-07   
gb|EMF12021.1|  MBOAT-domain-containing protein                       60.8    1e-07   
ref|XP_011300527.1|  PREDICTED: lysophospholipid acyltransferase 1    60.8    1e-07   
ref|XP_005665670.1|  PREDICTED: lysophospholipid acyltransferase ...  60.5    1e-07   
ref|XP_003304329.1|  hypothetical protein PTT_16886                   60.8    1e-07   
ref|XP_004745813.1|  PREDICTED: lysophospholipid acyltransferase ...  60.5    1e-07   
ref|XP_007893047.1|  PREDICTED: lysophospholipid acyltransferase ...  60.8    1e-07   
ref|NP_001265531.1|  membrane bound O-acyltransferase domain cont...  60.5    1e-07   
ref|XP_008515857.1|  PREDICTED: lysophospholipid acyltransferase 2    60.8    1e-07   
gb|EFB27452.1|  hypothetical protein PANDA_012394                     60.5    1e-07   
ref|XP_005711715.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase   60.5    1e-07   
emb|CDQ58417.1|  unnamed protein product                              60.5    1e-07   
ref|XP_005487294.1|  PREDICTED: membrane-bound O-acyltransferase ...  60.5    1e-07   
ref|XP_003117707.1|  hypothetical protein CRE_00233                   60.5    1e-07   
ref|XP_008687022.1|  PREDICTED: lysophospholipid acyltransferase 2    60.5    1e-07   
ref|XP_001496894.1|  PREDICTED: lysophospholipid acyltransferase 1    60.5    1e-07   
ref|XP_011269104.1|  PREDICTED: lysophospholipid acyltransferase 1    60.5    1e-07   
ref|XP_006980998.1|  PREDICTED: lysophospholipid acyltransferase 2    60.5    2e-07   
ref|XP_320281.4|  AGAP012258-PA                                       60.1    2e-07   
ref|NP_080313.2|  lysophospholipid acyltransferase 2 isoform a        60.1    2e-07   
ref|XP_006271644.1|  PREDICTED: membrane-bound O-acyltransferase ...  60.1    2e-07   
ref|XP_010352404.1|  PREDICTED: lysophospholipid acyltransferase 1    60.1    2e-07   
gb|EUB56787.1|  Transmembrane protein 62                              60.8    2e-07   
gb|KDQ14382.1|  hypothetical protein BOTBODRAFT_159594                60.1    2e-07   
ref|XP_006046595.1|  PREDICTED: lysophospholipid acyltransferase 1    60.1    2e-07   
gb|EXX59759.1|  Ale1p                                                 60.1    2e-07   
ref|XP_004613994.1|  PREDICTED: lysophospholipid acyltransferase 1    60.1    2e-07   
ref|XP_006018476.1|  PREDICTED: membrane-bound O-acyltransferase ...  60.1    2e-07   
gb|ESA24244.1|  hypothetical protein GLOINDRAFT_100689                60.1    2e-07   
ref|XP_004363935.1|  hypothetical protein CAOG_03096                  60.1    2e-07   
gb|EFN76361.1|  Membrane-bound O-acyltransferase domain-containin...  60.1    2e-07   
ref|XP_003760187.1|  PREDICTED: lysophospholipid acyltransferase 1    60.1    2e-07   
ref|XP_004457275.1|  PREDICTED: lysophospholipid acyltransferase 2    60.1    2e-07   
gb|EKC35358.1|  Membrane-bound O-acyltransferase domain-containin...  60.1    2e-07   
gb|EMP42015.1|  Membrane-bound O-acyltransferase domain-containin...  60.1    2e-07   
gb|ETE68526.1|  Lysophospholipid acyltransferase 1                    59.7    2e-07   
emb|CBY31681.1|  unnamed protein product                              59.7    2e-07   
ref|XP_008845806.1|  PREDICTED: lysophospholipid acyltransferase 1    60.1    2e-07   
ref|XP_007098291.1|  PREDICTED: lysophospholipid acyltransferase 2    60.1    2e-07   
ref|XP_545360.3|  PREDICTED: lysophospholipid acyltransferase 1 i...  60.1    2e-07   
emb|CBY38811.1|  unnamed protein product                              59.7    2e-07   
ref|NP_001101486.2|  membrane-bound O-acyltransferase domain-cont...  60.1    2e-07   
ref|XP_011498420.1|  PREDICTED: lysophospholipid acyltransferase ...  59.7    2e-07   
ref|XP_005687152.1|  PREDICTED: lysophospholipid acyltransferase 2    60.1    2e-07   
ref|XP_007933308.1|  PREDICTED: LOW QUALITY PROTEIN: lysophosphol...  59.7    2e-07   
ref|XP_005963265.1|  PREDICTED: lysophospholipid acyltransferase 2    59.7    2e-07   
ref|XP_003984562.2|  PREDICTED: lysophospholipid acyltransferase 2    59.7    2e-07   
ref|XP_010007745.1|  PREDICTED: lysophospholipid acyltransferase 2    59.7    2e-07   
ref|XP_010981012.1|  PREDICTED: lysophospholipid acyltransferase 2    59.7    2e-07   
ref|XP_007100631.1|  PREDICTED: lysophospholipid acyltransferase ...  59.7    2e-07   
dbj|BAG65506.1|  unnamed protein product                              58.5    2e-07   
gb|KFO79758.1|  Membrane-bound O-acyltransferase domain-containin...  59.7    3e-07   
gb|KFQ45933.1|  Membrane-bound O-acyltransferase domain-containin...  59.7    3e-07   
ref|XP_004745812.1|  PREDICTED: lysophospholipid acyltransferase ...  59.7    3e-07   
ref|XP_009564047.1|  PREDICTED: lysophospholipid acyltransferase 2    59.7    3e-07   
ref|XP_006715063.1|  PREDICTED: lysophospholipid acyltransferase ...  58.5    3e-07   
gb|KIK65695.1|  hypothetical protein GYMLUDRAFT_39199                 59.7    3e-07   
ref|XP_008401785.1|  PREDICTED: membrane-bound O-acyltransferase ...  59.3    3e-07   
ref|NP_001286266.1|  oysgedart, isoform D                             59.7    3e-07   
ref|XP_007287206.1|  mboat family protein                             59.7    3e-07   
gb|KFW73093.1|  Membrane-bound O-acyltransferase domain-containin...  59.3    3e-07   
gb|EDL36985.1|  membrane bound O-acyltransferase domain containin...  59.7    3e-07   
ref|XP_002816515.1|  PREDICTED: lysophospholipid acyltransferase 1    59.3    3e-07   
gb|KFP16735.1|  Membrane-bound O-acyltransferase domain-containin...  59.3    3e-07   
ref|XP_009638079.1|  PREDICTED: lysophospholipid acyltransferase 2    59.7    3e-07   
ref|XP_007542063.1|  PREDICTED: lysophospholipid acyltransferase ...  59.3    3e-07   
ref|XP_005366549.1|  PREDICTED: lysophospholipid acyltransferase ...  59.3    3e-07   
ref|XP_005044342.1|  PREDICTED: membrane-bound O-acyltransferase ...  59.3    3e-07   
gb|ELT92172.1|  hypothetical protein CAPTEDRAFT_182891                59.3    3e-07   
ref|XP_653096.1|  membrane-bound O-acyltransferase (MBOAT ) famil...  59.3    3e-07   
ref|XP_006093811.1|  PREDICTED: lysophospholipid acyltransferase 1    59.3    3e-07   
gb|EAR97515.2|  membrane-bound O-acyltransferase family MBOAT pro...  58.9    3e-07   
gb|KFM05035.1|  Membrane-bound O-acyltransferase domain-containin...  59.3    3e-07   
ref|XP_005808738.1|  PREDICTED: lysophospholipid acyltransferase ...  59.3    3e-07   
ref|XP_009096185.1|  PREDICTED: lysophospholipid acyltransferase 2    59.3    3e-07   
ref|XP_001375972.1|  PREDICTED: lysophospholipid acyltransferase 1    59.3    3e-07   
ref|XP_002125907.1|  PREDICTED: lysophospholipid acyltransferase ...  59.3    3e-07   
gb|KFQ97242.1|  Membrane-bound O-acyltransferase domain-containin...  59.3    3e-07   
gb|ELR49221.1|  Lysophospholipid acyltransferase 2                    59.3    3e-07   
gb|KGL99857.1|  Membrane-bound O-acyltransferase domain-containin...  59.3    3e-07   
ref|XP_009330790.1|  PREDICTED: lysophospholipid acyltransferase 2    59.3    3e-07   
ref|XP_010391714.1|  PREDICTED: lysophospholipid acyltransferase 2    59.3    3e-07   
ref|XP_005950510.1|  PREDICTED: lysophospholipid acyltransferase ...  59.3    3e-07   
ref|XP_009463712.1|  PREDICTED: lysophospholipid acyltransferase 2    59.3    3e-07   
gb|EMC90277.1|  Membrane-bound O-acyltransferase domain-containin...  59.3    3e-07   
ref|XP_003036952.1|  hypothetical protein SCHCODRAFT_63856            59.3    3e-07   
ref|XP_006191937.1|  PREDICTED: lysophospholipid acyltransferase 2    59.3    3e-07   
ref|XP_005732862.1|  PREDICTED: lysophospholipid acyltransferase ...  59.3    3e-07   
ref|XP_005732861.1|  PREDICTED: lysophospholipid acyltransferase ...  59.3    3e-07   
ref|XP_005950509.1|  PREDICTED: lysophospholipid acyltransferase ...  59.3    3e-07   
ref|XP_004572906.1|  PREDICTED: lysophospholipid acyltransferase ...  59.3    3e-07   
ref|NP_001090470.1|  membrane bound O-acyltransferase domain cont...  59.3    3e-07   
gb|KFU90791.1|  Membrane-bound O-acyltransferase domain-containin...  59.3    3e-07   
ref|XP_006618896.1|  PREDICTED: lysophospholipid acyltransferase ...  59.3    3e-07   
gb|KFO65245.1|  Membrane-bound O-acyltransferase domain-containin...  59.3    3e-07   
ref|XP_009891566.1|  PREDICTED: lysophospholipid acyltransferase 2    59.3    3e-07   
ref|XP_006793510.1|  PREDICTED: lysophospholipid acyltransferase ...  59.3    4e-07   
ref|XP_004640210.1|  PREDICTED: lysophospholipid acyltransferase 1    59.3    4e-07   
ref|XP_005964475.1|  PREDICTED: lysophospholipid acyltransferase 1    59.3    4e-07   
ref|XP_006793511.1|  PREDICTED: lysophospholipid acyltransferase ...  58.9    4e-07   
gb|KFR16556.1|  Membrane-bound O-acyltransferase domain-containin...  58.9    4e-07   
ref|XP_009997542.1|  PREDICTED: lysophospholipid acyltransferase 2    59.3    4e-07   
ref|XP_005153390.1|  PREDICTED: LOW QUALITY PROTEIN: membrane-bou...  59.3    4e-07   
ref|XP_009273896.1|  PREDICTED: lysophospholipid acyltransferase 2    58.9    4e-07   
ref|XP_005238262.1|  PREDICTED: membrane-bound O-acyltransferase ...  58.9    4e-07   
ref|XP_006197334.1|  PREDICTED: lysophospholipid acyltransferase 2    58.9    4e-07   
ref|XP_005506960.1|  PREDICTED: membrane-bound O-acyltransferase ...  59.3    4e-07   
ref|XP_009940368.1|  PREDICTED: lysophospholipid acyltransferase 2    58.9    4e-07   
ref|XP_008640082.1|  PREDICTED: lysophospholipid acyltransferase 2    58.9    4e-07   
ref|XP_010850411.1|  PREDICTED: lysophospholipid acyltransferase 2    58.9    4e-07   
ref|XP_002004184.1|  GI19773                                          59.3    4e-07   
ref|XP_005420381.1|  PREDICTED: membrane-bound O-acyltransferase ...  58.9    4e-07   
ref|XP_624721.2|  PREDICTED: lysophospholipid acyltransferase 2-like  58.9    4e-07   
ref|XP_007364213.1|  MBOAT-domain-containing protein                  58.9    4e-07   
ref|XP_010336319.1|  PREDICTED: lysophospholipid acyltransferase ...  58.5    4e-07   
ref|XP_006888722.1|  PREDICTED: lysophospholipid acyltransferase ...  58.9    4e-07   
ref|XP_010077791.1|  PREDICTED: lysophospholipid acyltransferase 2    58.9    5e-07   
gb|KFW88882.1|  Membrane-bound O-acyltransferase domain-containin...  58.9    5e-07   
gb|KFV12019.1|  Membrane-bound O-acyltransferase domain-containin...  58.9    5e-07   
ref|XP_003395903.1|  PREDICTED: membrane-bound O-acyltransferase ...  58.9    5e-07   
ref|XP_010621390.1|  PREDICTED: lysophospholipid acyltransferase 1    58.5    5e-07   
ref|XP_005630649.1|  PREDICTED: lysophospholipid acyltransferase 2    58.9    5e-07   
ref|XP_008115914.1|  PREDICTED: lysophospholipid acyltransferase ...  58.5    5e-07   
ref|XP_002941254.1|  PREDICTED: lysophospholipid acyltransferase 5    58.5    5e-07   
ref|XP_008115909.1|  PREDICTED: lysophospholipid acyltransferase ...  58.5    5e-07   
ref|XP_003927360.1|  PREDICTED: lysophospholipid acyltransferase ...  58.5    5e-07   
ref|XP_007912419.1|  putative mboat family protein                    58.5    5e-07   
gb|EAW55418.1|  hCG37003, isoform CRA_a                               58.2    6e-07   
ref|XP_002714205.1|  PREDICTED: lysophospholipid acyltransferase ...  58.5    6e-07   
gb|AAH85443.1|  Wu:fq24h09                                            58.2    7e-07   
emb|CDQ80448.1|  unnamed protein product                              58.2    7e-07   
ref|XP_004693368.1|  PREDICTED: lysophospholipid acyltransferase 1    58.2    7e-07   
gb|EHH17983.1|  Lysophospholipid acyltransferase 1                    58.2    8e-07   
ref|XP_001098322.1|  PREDICTED: lysophospholipid acyltransferase ...  58.2    8e-07   
gb|EHH52747.1|  Lysophospholipid acyltransferase 1                    58.2    8e-07   
ref|XP_003747942.1|  PREDICTED: membrane-bound O-acyltransferase ...  58.2    8e-07   
ref|XP_005553995.1|  PREDICTED: lysophospholipid acyltransferase 1    58.2    8e-07   
ref|XP_007879910.1|  hypothetical protein PFL1_04196                  58.2    8e-07   
ref|XP_003263601.1|  PREDICTED: lysophospholipid acyltransferase 1    57.8    9e-07   
ref|NP_001007397.2|  lysophospholipid acyltransferase 1               57.8    9e-07   
ref|XP_006140916.1|  PREDICTED: lysophospholipid acyltransferase 2    58.2    9e-07   
ref|XP_008617359.1|  hypothetical protein SDRG_13055                  57.8    9e-07   
ref|XP_006626243.1|  PREDICTED: lysophospholipid acyltransferase ...  57.8    9e-07   
ref|NP_001073949.1|  lysophospholipid acyltransferase 1               57.8    9e-07   
ref|XP_005452546.1|  PREDICTED: lysophospholipid acyltransferase ...  57.8    9e-07   
ref|XP_003045299.1|  hypothetical protein NECHADRAFT_70470            57.8    1e-06   
ref|XP_005329217.1|  PREDICTED: lysophospholipid acyltransferase 1    57.8    1e-06   
dbj|BAJ99089.1|  predicted protein                                    57.8    1e-06   
emb|CDO96291.1|  unnamed protein product                              57.8    1e-06   
ref|XP_008069756.1|  PREDICTED: lysophospholipid acyltransferase ...  57.8    1e-06   
ref|XP_004043374.1|  PREDICTED: lysophospholipid acyltransferase 1    57.8    1e-06   
gb|AGO11950.1|  AaceriAGR271Cp                                        57.8    1e-06   
ref|XP_007971772.1|  PREDICTED: lysophospholipid acyltransferase 1    57.8    1e-06   
ref|XP_003897158.1|  PREDICTED: lysophospholipid acyltransferase ...  57.8    1e-06   
ref|XP_009202758.1|  PREDICTED: lysophospholipid acyltransferase ...  57.4    1e-06   
ref|XP_006121888.1|  PREDICTED: lysophospholipid acyltransferase ...  57.4    1e-06   
gb|KIO15837.1|  hypothetical protein M407DRAFT_34555                  57.4    1e-06   
ref|XP_009526165.1|  hypothetical protein PHYSODRAFT_351108           57.4    1e-06   
ref|XP_009678643.1|  PREDICTED: lysophospholipid acyltransferase ...  57.4    1e-06   
gb|ELK14940.1|  Lysophospholipid acyltransferase 1                    57.4    1e-06   
ref|XP_002644784.1|  Hypothetical protein CBG14799                    57.4    1e-06   
ref|XP_008248220.1|  PREDICTED: lysophospholipid acyltransferase 2    57.4    1e-06   
ref|XP_455985.1|  hypothetical protein                                57.4    1e-06   
gb|KIL95824.1|  hypothetical protein FAVG1_00562                      57.4    1e-06   
gb|KIY45977.1|  MBOAT-domain-containing protein                       57.4    1e-06   
gb|KFV84078.1|  Membrane-bound O-acyltransferase domain-containin...  57.4    1e-06   
ref|XP_004610692.1|  PREDICTED: lysophospholipid acyltransferase 5    57.0    1e-06   
ref|XP_011280404.1|  PREDICTED: lysophospholipid acyltransferase 1    57.4    1e-06   
gb|KIW09392.1|  hypothetical protein PV09_00286                       57.4    1e-06   
ref|XP_001839338.1|  endoplasmic reticulum protein                    57.4    1e-06   
ref|XP_007784935.1|  hypothetical protein W97_08878                   57.4    1e-06   
ref|XP_003966367.1|  PREDICTED: lysophospholipid acyltransferase ...  57.0    2e-06   
ref|XP_007901355.1|  PREDICTED: lysophospholipid acyltransferase ...  57.0    2e-06   
ref|XP_010816798.1|  PREDICTED: lysophospholipid acyltransferase ...  57.0    2e-06   



>ref|XP_011081031.1| PREDICTED: lysophospholipid acyltransferase 1-like [Sesamum indicum]
 ref|XP_011081032.1| PREDICTED: lysophospholipid acyltransferase 1-like [Sesamum indicum]
Length=465

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MELPEMESMASAIG+SV VLRFLLCF ATIPVS  HR VPGGAT RH+YA ATGA LSYL
Sbjct  1    MELPEMESMASAIGVSVSVLRFLLCFIATIPVSFFHRFVPGGATARHLYAAATGAILSYL  60

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SML+ R YCG ITF LAFGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  61   SFGFSSNLHFLVPMLLGYASMLLYRKYCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDA  120

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMVITLKIISC ++Y DGLLKEEDLREAQKKNRLL  PS+LEYFGYCL
Sbjct  121  TGALMVITLKIISCAINYNDGLLKEEDLREAQKKNRLLKLPSILEYFGYCL  171



>ref|XP_006358391.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum tuberosum]
Length=463

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 152/171 (89%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MELPEMESMA+AIG+SVPVLRFLLCF ATIPVS  HR VP  +TGRH+YA   G  LSYL
Sbjct  1    MELPEMESMATAIGVSVPVLRFLLCFVATIPVSFFHRFVPT-STGRHLYAAVMGGVLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHF VPMLLGY SM+I RPYCG ITF +AFGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFFVPMLLGYASMVIYRPYCGIITFFIAFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLKIISC ++YQDGLLKEEDLREAQKKNRLL  PSLLEYFGYCL
Sbjct  120  TGALMVVTLKIISCAINYQDGLLKEEDLREAQKKNRLLKLPSLLEYFGYCL  170



>ref|XP_009764156.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
sylvestris]
Length=463

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MELPEMESMA+AIG+SVPVLRFLLCF ATIPVS +HR VP  ATG+H+YA   G  LSYL
Sbjct  1    MELPEMESMATAIGVSVPVLRFLLCFIATIPVSFLHRFVPS-ATGKHLYAAVMGGVLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM+LGYGSM+++R YCG ITF +AFGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMVLGYGSMVVSRSYCGIITFFIAFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLKIISCV++YQDGLLKEEDLREAQKKNRLL  PS+LEYFGYCL
Sbjct  120  TGALMVVTLKIISCVINYQDGLLKEEDLREAQKKNRLLKLPSVLEYFGYCL  170



>ref|XP_004244602.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum lycopersicum]
Length=463

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 152/171 (89%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MELPEMESMA+AIG+SVPVLRFLLCF ATIPVS  HR VP  +TGRH+YA   G  LSYL
Sbjct  1    MELPEMESMATAIGVSVPVLRFLLCFVATIPVSFFHRFVPS-STGRHLYAAVMGGVLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM+I RPYCG ITF +AFGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMLLGYASMVIYRPYCGIITFFIAFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLKIIS  ++YQDGLLKEEDLREAQKKNRLL  PSLLEYFGYCL
Sbjct  120  TGALMVVTLKIISSAINYQDGLLKEEDLREAQKKNRLLKLPSLLEYFGYCL  170



>emb|CDP09808.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   296 bits (757),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MELPEMESMASAIG+SVPVLRFLLCF ATIPVS +HR VPG  TGRH+YA  TGA LSYL
Sbjct  1    MELPEMESMASAIGVSVPVLRFLLCFVATIPVSFLHRFVPG-VTGRHLYAAVTGAVLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM+I+R +CG ITF +AFGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMLLGYASMVISRKHCGIITFFVAFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMVITLKIISCV++Y DG LKEE+LREAQKKNRL   PS LEYFGYCL
Sbjct  120  TGALMVITLKIISCVINYGDGSLKEENLREAQKKNRLEKLPSFLEYFGYCL  170



>ref|XP_009628905.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=463

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MELPEMESMA+AIG+SVPVLRFLLCF ATIPVS +HR VP  ATG+H+YA   G  LSYL
Sbjct  1    MELPEMESMATAIGVSVPVLRFLLCFIATIPVSFLHRFVPS-ATGKHLYAAVMGGVLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHF+VPM+LGY SM+++R YCG ITF + FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFMVPMVLGYVSMVVSRSYCGIITFFIVFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLKIISCV++YQDGLLKEEDLREAQKKNRLL  PS+LEYFGYCL
Sbjct  120  TGALMVVTLKIISCVINYQDGLLKEEDLREAQKKNRLLKLPSVLEYFGYCL  170



>ref|XP_011072149.1| PREDICTED: lysophospholipid acyltransferase 1-like [Sesamum indicum]
Length=465

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MELPEMESMAS IG+SVPVLRFL+CFAATIPVS +HR VPGG  GRH++A  TGA LSYL
Sbjct  1    MELPEMESMASGIGVSVPVLRFLICFAATIPVSFMHRFVPGGTAGRHLFAAVTGAFLSYL  60

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHF+ PMLLGY SM+  R YCG I F+L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  61   SFGFSSNLHFITPMLLGYASMVFCRKYCGIIAFILGFGYLIGCHVYYMSGDAWKEGGIDA  120

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMVITLKIISCV++Y DGLLKEEDL EAQKK RLL  PSLLEYFGYCL
Sbjct  121  TGALMVITLKIISCVINYNDGLLKEEDLSEAQKKYRLLKIPSLLEYFGYCL  171



>gb|EYU38990.1| hypothetical protein MIMGU_mgv1a005877mg [Erythranthe guttata]
Length=466

 Score =   293 bits (749),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 153/172 (89%), Gaps = 1/172 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M+LPEMESMASAIG+SV VLRFLLCF ATIPV  +HR VPGG   RH+YA ATGA LSYL
Sbjct  1    MDLPEMESMASAIGVSVAVLRFLLCFVATIPVGFLHRFVPGGPAARHLYAAATGAILSYL  60

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM++ R +CG ITF LAFGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  61   SFGFSSNLHFLVPMLLGYASMVLCRKHCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDA  120

Query  422  TGALMVITLKIISCVMSYQDGLLKEED-LREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMVITLKIISCV++Y DGLLKEE+ LREAQKKNRLLN PSLLEY GYCL
Sbjct  121  TGALMVITLKIISCVINYNDGLLKEEENLREAQKKNRLLNLPSLLEYVGYCL  172



>ref|XP_009609255.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=463

 Score =   291 bits (744),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M LPEMESMASAIG+SVPVLRFLLCF ATIP+S +HR VP  A GRH+YA  TGA LSYL
Sbjct  1    MGLPEMESMASAIGVSVPVLRFLLCFVATIPMSFLHRFVPS-AVGRHLYAAVTGAVLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHF  PMLLGY SM+++R +CG ITF  AFGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFFGPMLLGYASMVLSRRFCGIITFFAAFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMVITLKIISCV++YQDGLLKEEDLREAQKKNRLL  PSLLEY GYCL
Sbjct  120  TGALMVITLKIISCVINYQDGLLKEEDLREAQKKNRLLKLPSLLEYVGYCL  170



>gb|EYU29840.1| hypothetical protein MIMGU_mgv1a0059782mg, partial [Erythranthe 
guttata]
Length=328

 Score =   285 bits (729),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EM+SMASAIG+SV VLRFLLCFAATIPVS +HRLVPGG   RH+YA ATGA LSYLSFGF
Sbjct  2    EMDSMASAIGVSVAVLRFLLCFAATIPVSFLHRLVPGGPAARHLYAAATGAYLSYLSFGF  61

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHF+VPMLLGY SM++ R YCG +TF L FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  62   SSNLHFVVPMLLGYASMVLCRKYCGIVTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGAL  121

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MVITLKIISCV++Y DGLLKEE LREAQKKNRLL  PSLLEYFGY L
Sbjct  122  MVITLKIISCVINYNDGLLKEEGLREAQKKNRLLKLPSLLEYFGYGL  168



>ref|XP_009759896.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nicotiana 
sylvestris]
Length=463

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M LPEMESMASAIG+SVPVLRFLLCF ATIPVS +HR VP  A  RH+YA  TGA LSYL
Sbjct  1    MGLPEMESMASAIGVSVPVLRFLLCFVATIPVSFLHRFVPS-AVCRHLYAAVTGAVLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHF  PMLLGY SM+++R YCG ITF  AFGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFFGPMLLGYVSMVVSRRYCGIITFFAAFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMVITLKIISCV++YQDGLLKEEDLREAQKKN LL  PSL EY GYCL
Sbjct  120  TGALMVITLKIISCVINYQDGLLKEEDLREAQKKNCLLKLPSLFEYIGYCL  170



>ref|XP_004245650.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum lycopersicum]
Length=463

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M LPE+ESMA AIG+SVPVLRFLLCF ATIPVS +HR VP  ATGRH+YA  TGA LSYL
Sbjct  1    MGLPELESMAPAIGVSVPVLRFLLCFIATIPVSFLHRFVPS-ATGRHLYAAVTGAVLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHF  PMLLGY SM++ R YCG IT++ AFGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFFGPMLLGYASMVLCRRYCGIITYVAAFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMVITLKIIS V++YQDGLLKEEDLREAQKKNRLL  PSLLEY G+CL
Sbjct  120  TGALMVITLKIISSVINYQDGLLKEEDLREAQKKNRLLELPSLLEYIGFCL  170



>ref|XP_006364125.1| PREDICTED: lysophospholipid acyltransferase 2-like [Solanum tuberosum]
Length=464

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M  PEM+SMASAIG+S+PV RFLLCF  TIPVS +HR VP   +GRH YA  +GA LSYL
Sbjct  1    MSAPEMDSMASAIGVSIPVFRFLLCFVGTIPVSFLHRFVPC-VSGRHFYAALSGAVLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM++ R YCG ITF LAFGYLIGCHVYYMSGDAWK+GG+DA
Sbjct  60   SFGFSSNLHFLVPMLLGYASMVLCRHYCGIITFFLAFGYLIGCHVYYMSGDAWKKGGMDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMVI+LKIIS V++YQDGLLKEEDLREAQKKNRLL  PSLLEYFGYCL
Sbjct  120  TGALMVISLKIISSVINYQDGLLKEEDLREAQKKNRLLKLPSLLEYFGYCL  170



>ref|XP_006358867.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum tuberosum]
Length=463

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M LPE+ESMA AIG+SVPVLRFLLCF ATIPVS +HR VP  ATGRH+YA  TGA LSYL
Sbjct  1    MGLPELESMAPAIGVSVPVLRFLLCFIATIPVSFLHRFVPS-ATGRHLYAAVTGAVLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHF  PMLLGY SM++ R YCG IT++ AFGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFFGPMLLGYASMVLCRRYCGIITYIAAFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMVITLKIIS V++YQDGLLKEEDLRE+QKKNRLL  PSLLEY G+CL
Sbjct  120  TGALMVITLKIISSVINYQDGLLKEEDLRESQKKNRLLELPSLLEYVGFCL  170



>gb|AER57988.1| putative lysophosphatidylcholine acyltransferase 1 [Helianthus 
annuus]
Length=462

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +MES A+AIG+SVPVLRFLLCF ATIP    HR VPGGATG+H+YA  TG  LSYLSFGF
Sbjct  2    DMESTAAAIGVSVPVLRFLLCFIATIPTGFFHRFVPGGATGKHLYAAVTGVVLSYLSFGF  61

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPML+GY SM++ R  CG ITF+LAFGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  62   SSNLHFLVPMLVGYVSMVVYRKRCGVITFVLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  121

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEEDLR++QKKNRLL  PSL+EY GYCL
Sbjct  122  MVLTLKVISCAINYNDGLLKEEDLRDSQKKNRLLKLPSLIEYMGYCL  168



>ref|XP_011029182.1| PREDICTED: lysophospholipid acyltransferase 1-like [Populus euphratica]
Length=465

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMASAIG+SVPVLRFLLCF ATIPVS  HR VP    G+H+YA  +GA LSYLSFGF
Sbjct  4    EMESMASAIGVSVPVLRFLLCFVATIPVSFTHRFVPS-PFGKHLYAALSGAFLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM+LGY SM++ RPYCG +TFLL FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMVLGYLSMVLFRPYCGILTFLLGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC MSY DGLLKEE+LREAQKKNRL+  PS  EY GYCL
Sbjct  123  MVLTLKVISCAMSYNDGLLKEEELREAQKKNRLIELPSFTEYVGYCL  169



>gb|AHE80985.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Bernardia pulchella]
Length=466

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
             MESMAS+IG+S+PVLRFLLCF ATIPVS +HR++PG   G+H+YA  +GA LSYLSFGF
Sbjct  4    HMESMASSIGVSIPVLRFLLCFVATIPVSFVHRVIPG-RLGKHVYAALSGAVLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGYGSM++ R +CG +TF L FGYLIGCHV+YMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYGSMVLFRSHCGIMTFALGFGYLIGCHVHYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC M+Y DGLLKEEDLRE+QKKNRL+  PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAMNYNDGLLKEEDLRESQKKNRLIKLPSLIEYFGYCL  169



>gb|AER57989.2| putative lysophosphatidylcholine acyltransferase 2 [Helianthus 
annuus]
Length=454

 Score =   275 bits (703),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNL  265
            MASAIG+SVPVLRFLLCF ATIPVS  HRLVPGGAT RH+YA  TGA LSY+SFGFSSNL
Sbjct  1    MASAIGVSVPVLRFLLCFVATIPVSFFHRLVPGGATARHLYAAVTGALLSYISFGFSSNL  60

Query  266  HFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVIT  445
            HF VPML+ YGSM++ R +CG I+FL A GYLIGCHVYYMSGDAWKEGGIDATG+LMVIT
Sbjct  61   HFFVPMLISYGSMVVARKWCGVISFLSAMGYLIGCHVYYMSGDAWKEGGIDATGSLMVIT  120

Query  446  LKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            LK+ISC ++Y DGLLKE DLRE+QKKNR+L  PSL+EY GYCL
Sbjct  121  LKVISCAINYNDGLLKEADLRESQKKNRILKLPSLIEYVGYCL  163



>ref|XP_011033798.1| PREDICTED: lysophospholipid acyltransferase 1-like [Populus euphratica]
Length=465

 Score =   275 bits (703),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMA+AIG+SVPVLRFLLCF  TIPVS IHR VP  + G+H+YA  +GA LSYLSFGF
Sbjct  4    EMESMAAAIGVSVPVLRFLLCFVVTIPVSFIHRFVPS-SFGKHLYAAISGAFLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM++ RPYCG +TFL  FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYLSMVLFRPYCGILTFLFGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC M+Y DGLLKEE+LRE QKKNRL+  PS +EY GYCL
Sbjct  123  MVLTLKVISCAMNYNDGLLKEEELREVQKKNRLIQLPSFIEYVGYCL  169



>ref|XP_002304469.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
 gb|EEE79448.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
Length=465

 Score =   275 bits (702),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMA+AIG+SVPVLRFLLCF  TIPVS IHR VP  + G+H+YA  +GA LSYLSFGF
Sbjct  4    EMESMAAAIGVSVPVLRFLLCFVVTIPVSFIHRFVPS-SFGKHLYAAISGAFLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM++ RPYCG +TFL  FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYLSMVLFRPYCGILTFLFGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC M+Y DGLLKEE+LRE QKKNRL+  PS +EY GYCL
Sbjct  123  MVLTLKVISCAMNYNDGLLKEEELREVQKKNRLIKLPSFIEYVGYCL  169



>gb|AHE80989.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Carthamus tinctorius]
Length=462

 Score =   275 bits (702),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMASAIG+SVPVLRFLLCF ATIPVS  HRLVPGG   RH+YA  TGA LSY+SFGF
Sbjct  2    EMESMASAIGVSVPVLRFLLCFVATIPVSFFHRLVPGGPAARHLYAAFTGALLSYISFGF  61

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHF VPML+ Y SM++ R  CG I+FL A GYLIGCHVYYMSGDAWKEGGIDATG+L
Sbjct  62   SSNLHFFVPMLISYASMVLYRKRCGIISFLSAMGYLIGCHVYYMSGDAWKEGGIDATGSL  121

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MVITLK+ISC ++Y DGLLKEEDLRE+QKKNRL+  PS +EY GYC+
Sbjct  122  MVITLKVISCAINYNDGLLKEEDLRESQKKNRLIKLPSFIEYVGYCM  168



>gb|AGL74879.1| 1-acylglycerophosphocholine O-acyltransferase [Vernicia fordii]
Length=465

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +ME+MASAIG+S+PVLRFLLCF ATIPVS +HRL PG   G+H+YA  +G  LSYLSFGF
Sbjct  4    DMEAMASAIGVSIPVLRFLLCFVATIPVSFMHRLTPG-RLGKHLYAAGSGVILSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM++ R YCG +TF+L FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYASMVLFRAYCGTLTFVLGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE+LREAQK+N+L+  PSLLEYFGYCL
Sbjct  123  MVLTLKVISCAINYNDGLLKEEELREAQKRNQLIKLPSLLEYFGYCL  169



>gb|EPS74023.1| hypothetical protein M569_00723, partial [Genlisea aurea]
Length=461

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            E+ +MASAIG+SVPVLRFLLCF ATIP+S +HR VPGG   RH YAVA GA LSYLSFG 
Sbjct  1    EISTMASAIGVSVPVLRFLLCFVATIPLSFLHRFVPGGPNTRHFYAVAIGAVLSYLSFGL  60

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSN HF+VP+LLGY +ML  R +CG ITF LAFGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  61   SSNFHFIVPILLGYAAMLFYRKHCGIITFFLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  120

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLKIISC ++Y DGLLKEEDL  AQKK RL+  PSLLEYFGYCL
Sbjct  121  MVVTLKIISCAINYNDGLLKEEDLSSAQKKYRLIKLPSLLEYFGYCL  167



>ref|XP_002282807.1| PREDICTED: lysophospholipid acyltransferase 1 [Vitis vinifera]
Length=463

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +MESMASAIG+SVPVLRFLLCF ATIPVS + R +PG  T RH+Y+  TGA+LSYLSFGF
Sbjct  4    DMESMASAIGVSVPVLRFLLCFVATIPVSFLVRFIPGAFT-RHVYSAFTGASLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY +ML+ R  CG ITF L FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYAAMLLCRRRCGVITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC M+Y DGLLKE+ LREAQKKNRLL  PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAMNYNDGLLKEDGLREAQKKNRLLKLPSLIEYFGYCL  169



>gb|KHG22777.1| Lysophospholipid acyltransferase 2 [Gossypium arboreum]
Length=276

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M +MA++IG+SVPV+RFLLCF  TIPVS + RLVPG    +H+Y+  TGA LSYL
Sbjct  1    MEL-DMVTMAASIGVSVPVIRFLLCFVTTIPVSFLWRLVPG-PLAKHLYSAFTGALLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY +M++ RP CG ITF L FG+LIGCHVYYMSGDAWK+GGIDA
Sbjct  59   SFGFSSNLHFLVPMLLGYAAMVLYRPKCGVITFFLGFGFLIGCHVYYMSGDAWKQGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC M+Y DGLLKEEDLREAQKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYFGYCL  169



>ref|XP_010278548.1| PREDICTED: lysophospholipid acyltransferase 1 [Nelumbo nucifera]
Length=464

 Score =   272 bits (696),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 149/171 (87%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            ME+ EMESMAS+IG+SVPVLRFLLCFAATIPVS I RLVPG    +HIY+ A+GA LSYL
Sbjct  1    MEI-EMESMASSIGVSVPVLRFLLCFAATIPVSFIWRLVPGTLL-KHIYSAASGALLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPML+GY SML+ R  CG ITF   FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLVPMLMGYISMLVYRRRCGIITFFTGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLLKEE LREAQKKNRLL  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGLLKEEGLREAQKKNRLLRLPSLIEYFGYCL  169



>ref|XP_002298063.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
 gb|EEE82868.2| membrane bound O-acyl transferase family protein [Populus trichocarpa]
Length=465

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMA AIG+SVPVLRFLLCF ATIPVS  HR VP    G+H+YA  +GA LSYLSFGF
Sbjct  4    EMESMALAIGVSVPVLRFLLCFVATIPVSFTHRFVPS-LFGKHLYAALSGAFLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM++ RPYCG +TFL  FGYLIGCH+YYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYLSMVLFRPYCGILTFLSGFGYLIGCHMYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC MSY DGLLKEE+LREAQKKNRL+  PS +EY GYCL
Sbjct  123  MVLTLKVISCAMSYNDGLLKEEELREAQKKNRLIELPSFIEYVGYCL  169



>ref|XP_004252578.1| PREDICTED: lysophospholipid acyltransferase 1-like [Solanum lycopersicum]
Length=459

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFS  256
            MESMASAIG+S+PV RFLLCF  TIPVS +HR VP   +GRH YA  +GA LSYLSFGFS
Sbjct  1    MESMASAIGVSIPVFRFLLCFVGTIPVSFLHRFVPC-VSGRHFYAALSGAVLSYLSFGFS  59

Query  257  SNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALM  436
            SNLHFLVPMLLGY SM++ R YCG ITF LAFGYLIGCHVYYMSGDAWK+GG+DATGALM
Sbjct  60   SNLHFLVPMLLGYASMVLCRHYCGIITFFLAFGYLIGCHVYYMSGDAWKKGGMDATGALM  119

Query  437  VITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            VI+LKIIS V++YQDGLLK EDL EAQKKNRLL  PSLLEYFGYCL
Sbjct  120  VISLKIISSVINYQDGLLKVEDLSEAQKKNRLLKLPSLLEYFGYCL  165



>ref|XP_002509709.1| o-acyltransferase (membrane bound) domain containing protein, 
putative [Ricinus communis]
 gb|EEF51096.1| o-acyltransferase (membrane bound) domain containing protein, 
putative [Ricinus communis]
Length=338

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            ++ESMASAIG+S+PVLRFLLCF ATIPVS +HRL PG + G+H+YA  TGA LSYLSFGF
Sbjct  4    DLESMASAIGVSIPVLRFLLCFVATIPVSFMHRLAPG-SLGKHLYAALTGAFLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM++ R +CG + FLL FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYASMVLFRSHCGILVFLLGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y+DGLLKEE+L+ +QKKNRL+  PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAINYKDGLLKEEELQGSQKKNRLIKLPSLIEYFGYCL  169



>gb|KJB68443.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=333

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M +MA++IG+SVPV+RFLLCF  TIPVS + RLVPG    +H+Y+  TGA LSYL
Sbjct  1    MEL-DMVTMAASIGVSVPVIRFLLCFVTTIPVSFLWRLVPG-PLAKHLYSAFTGALLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY +M++ RP CG ITF L FG+LIGCHVYYMSGDAWK+GGIDA
Sbjct  59   SFGFSSNLHFLVPMLLGYAAMVLYRPKCGIITFFLGFGFLIGCHVYYMSGDAWKQGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC M+Y DGLLKEEDLREAQKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYFGYCL  169



>ref|XP_008364537.1| PREDICTED: lysophospholipid acyltransferase 1-like [Malus domestica]
Length=460

 Score =   270 bits (690),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMA+AIG+SVPVLRFLLCF ATIPVS I RLVP     +H+YA A+GA LSYLSFGF
Sbjct  4    EMESMAAAIGVSVPVLRFLLCFVATIPVSFIWRLVPS-PPAKHLYAFASGALLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM+  R +CG ITF+L FGYLIGCHV+YMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYASMVFARNHCGIITFILGFGYLIGCHVFYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LRE+QKKNRL+  PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAINYNDGVLKEEGLRESQKKNRLIKLPSLIEYFGYCL  169



>gb|KJB68445.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=433

 Score =   268 bits (686),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M +MA++IG+SVPV+RFLLCF  TIPVS + RLVPG    +H+Y+  TGA LSYL
Sbjct  1    MEL-DMVTMAASIGVSVPVIRFLLCFVTTIPVSFLWRLVPG-PLAKHLYSAFTGALLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY +M++ RP CG ITF L FG+LIGCHVYYMSGDAWK+GGIDA
Sbjct  59   SFGFSSNLHFLVPMLLGYAAMVLYRPKCGIITFFLGFGFLIGCHVYYMSGDAWKQGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC M+Y DGLLKEEDLREAQKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYFGYCL  169



>ref|XP_010546005.1| PREDICTED: lysophospholipid acyltransferase 1 [Tarenaya hassleriana]
Length=463

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M L +M+SMA++IG+SVPVLRFLLCF ATIPVS + RLVP    G+HIY+ A+GA LSYL
Sbjct  1    MGLVDMDSMAASIGVSVPVLRFLLCFVATIPVSFMWRLVPS-RLGKHIYSAASGAFLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM+LGY SM I RP CG ITF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMMLGYASMAIYRPRCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+ LK+ISC ++Y DG+L+EE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLVLKVISCAINYNDGMLEEEGLREAQKKNRLIQMPSLIEYFGYCL  170



>gb|AGO14581.1| lysophosphatidylcholine acyltransferase [Ricinus communis]
 gb|AHF20951.1| lysophosphatidylcholine: acyl-CoA acyltransferase [Ricinus communis]
Length=465

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            ++ESMASAIG+S+PVLRFLLCF ATIPVS +HRL PG + G+H+YA  TGA LSYLSFGF
Sbjct  4    DLESMASAIGVSIPVLRFLLCFVATIPVSFMHRLAPG-SLGKHLYAALTGAFLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM++ R +CG + FLL FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYASMVLFRSHCGILVFLLGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y+DGLLKEE+L+ +QKKNRL+  PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAINYKDGLLKEEELQGSQKKNRLIKLPSLIEYFGYCL  169



>gb|KJB68442.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
 gb|KJB68446.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=464

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M +MA++IG+SVPV+RFLLCF  TIPVS + RLVPG    +H+Y+  TGA LSYL
Sbjct  1    MEL-DMVTMAASIGVSVPVIRFLLCFVTTIPVSFLWRLVPG-PLAKHLYSAFTGALLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY +M++ RP CG ITF L FG+LIGCHVYYMSGDAWK+GGIDA
Sbjct  59   SFGFSSNLHFLVPMLLGYAAMVLYRPKCGIITFFLGFGFLIGCHVYYMSGDAWKQGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC M+Y DGLLKEEDLREAQKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYFGYCL  169



>gb|AHE80988.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Hiptage benghalensis]
Length=462

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 146/171 (85%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M++MAS+IG+SVPVLRFLLCF ATIPVS +HR VP  + G+H YA   GA LSYL
Sbjct  1    MEL-DMDAMASSIGVSVPVLRFLLCFVATIPVSYLHRFVPS-SLGKHAYAFGVGAYLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFG SSN HFLVPML GY SML+ R +CG ITFLL FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGMSSNAHFLVPMLSGYASMLLFRRHCGIITFLLGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLLKEEDLRE QKKNRL+  PSLLEYFGYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGLLKEEDLRETQKKNRLIKMPSLLEYFGYCL  169



>gb|KJB68447.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=429

 Score =   266 bits (680),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M +MA++IG+SVPV+RFLLCF  TIPVS + RLVPG    +H+Y+  TGA LSYL
Sbjct  1    MEL-DMVTMAASIGVSVPVIRFLLCFVTTIPVSFLWRLVPG-PLAKHLYSAFTGALLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY +M++ RP CG ITF L FG+LIGCHVYYMSGDAWK+GGIDA
Sbjct  59   SFGFSSNLHFLVPMLLGYAAMVLYRPKCGIITFFLGFGFLIGCHVYYMSGDAWKQGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC M+Y DGLLKEEDLREAQKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYFGYCL  169



>ref|XP_010112575.1| hypothetical protein L484_010580 [Morus notabilis]
 gb|EXC34122.1| hypothetical protein L484_010580 [Morus notabilis]
Length=464

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +MESMAS+IG+SV V RFLLCF ATIPVS + R +PG    +H+YA  +GA LSYL
Sbjct  1    MEL-DMESMASSIGLSVAVFRFLLCFVATIPVSFLWRFIPG-QHAKHLYAALSGAILSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM++ R  CG ITF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLVPMLLGYASMVLYRRRCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLLKEEDLREAQKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGLLKEEDLREAQKKNRLVKLPSLIEYFGYCL  169



>emb|CBI34747.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNL  265
            MASAIG+SVPVLRFLLCF ATIPVS + R +PG  T RH+Y+  TGA+LSYLSFGFSSNL
Sbjct  1    MASAIGVSVPVLRFLLCFVATIPVSFLVRFIPGAFT-RHVYSAFTGASLSYLSFGFSSNL  59

Query  266  HFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVIT  445
            HFLVPMLLGY +ML+ R  CG ITF L FGYLIGCHVYYMSGDAWKEGGIDATGALMV+T
Sbjct  60   HFLVPMLLGYAAMLLCRRRCGVITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGALMVLT  119

Query  446  LKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            LK+ISC M+Y DGLLKE+ LREAQKKNRLL  PSL+EYFGYCL
Sbjct  120  LKVISCAMNYNDGLLKEDGLREAQKKNRLLKLPSLIEYFGYCL  162



>ref|XP_007023110.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
5 [Theobroma cacao]
 gb|EOY25732.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
5 [Theobroma cacao]
Length=385

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M +MA++IG+SVPVLRFLLCF ATIPVS   RLVPG    +H+Y+  +GA LSYL
Sbjct  1    MEL-DMGTMAASIGVSVPVLRFLLCFVATIPVSFSWRLVPG-RLAKHVYSAFSGALLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM+LGY +M++ RP CG ITF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLVPMVLGYAAMVLYRPKCGVITFFLGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLLKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGLLKEEGLREAQKKNRLIKLPSLIEYFGYCL  169



>gb|AHE80984.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Bernardia pulchella]
Length=459

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EM+SMASAIG+SVPVLRFLLCF ATIPVS +HR+VPG   G+H YA  +G  LSYLSFGF
Sbjct  4    EMDSMASAIGVSVPVLRFLLCFVATIPVSCMHRVVPG-RLGKHAYAALSGVLLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM++ R +CG + F+L FGYLIGCH YYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYASMVLFRSHCGILAFILGFGYLIGCHAYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE+LRE+QKKNRL+  PSL+EY GYCL
Sbjct  123  MVLTLKVISCAINYNDGLLKEEELRESQKKNRLIKLPSLIEYIGYCL  169



>ref|XP_006440537.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
 gb|ESR53777.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
Length=359

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M L EMESMA +IG+SV VLRFLLC+ ATIPVS + R VP   TG+H+YA A+GA LSYL
Sbjct  1    MALLEMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM I R  CG ITF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMLLGYLSMAIYRAKCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGL+ EE+LREAQKKNRL   PSL+EY GYCL
Sbjct  120  TGALMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCL  170



>ref|XP_009364173.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
 ref|XP_009364174.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
Length=465

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMA AIG+SVPVLRFLLCF ATIPVS I RLVP     +H+YA A+GA LSYLSFGF
Sbjct  4    EMESMAVAIGVSVPVLRFLLCFVATIPVSFIWRLVPS-PPAKHLYAFASGALLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM+  R +CG ITF+L FGYLIGCHV+YMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYASMVFARNHCGIITFILGFGYLIGCHVFYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+IS  ++Y DG+LKEE LRE+QKKNRL+  PSL+EYFGYCL
Sbjct  123  MVLTLKVISSAINYNDGVLKEEGLRESQKKNRLIKLPSLIEYFGYCL  169



>gb|AGM15932.1| lysophosphatidylcholine acyltransferase 2 [Physaria fendleri]
Length=465

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 145/171 (85%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M+SMAS+IG+SV VLRFLLCF ATIPVS + R VP    G+HIY+ A+GA LSYL
Sbjct  1    MELLDMDSMASSIGVSVAVLRFLLCFVATIPVSFLWRFVPS-RLGKHIYSAASGAFLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I RP+ G ITF L F YLIGCHV+YMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRPFSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCL  170



>ref|XP_009377923.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
 ref|XP_009344265.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
Length=465

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMA+ IG+SV VLRFLLCF ATIPVS I RLVP  A  +H+YA A+GA LSYLSFGF
Sbjct  4    EMESMAAGIGVSVSVLRFLLCFVATIPVSFIWRLVPS-APAKHLYAAASGALLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM   R +CG ITF+L FGYLIGCHV+YMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYASMAFARNHCGIITFVLGFGYLIGCHVFYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LRE+QKKNRL+  PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAINYNDGVLKEEGLRESQKKNRLIKLPSLIEYFGYCL  169



>ref|XP_007023106.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
 ref|XP_007023109.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
 gb|EOY25728.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
 gb|EOY25731.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
1 [Theobroma cacao]
Length=461

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M +MA++IG+SVPVLRFLLCF ATIPVS   RLVPG    +H+Y+  +GA LSYL
Sbjct  1    MEL-DMGTMAASIGVSVPVLRFLLCFVATIPVSFSWRLVPG-RLAKHVYSAFSGALLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM+LGY +M++ RP CG ITF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLVPMVLGYAAMVLYRPKCGVITFFLGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLLKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGLLKEEGLREAQKKNRLIKLPSLIEYFGYCL  169



>gb|AGM15931.1| lysophosphatidylcholine acyltransferase 1 [Physaria fendleri]
Length=465

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL  M SMA +IG+SV VLRFLLCF ATIPVS + R+VP    G+H+YA  +G  LSYL
Sbjct  1    MELMNMSSMAGSIGVSVAVLRFLLCFVATIPVSFVWRIVPS-KLGKHLYAAVSGVLLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GYGSM I RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYGSMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC M+Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCAMNYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCL  170



>gb|KDO63566.1| hypothetical protein CISIN_1g012501mg [Citrus sinensis]
Length=387

 Score =   263 bits (671),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M L EMESMA +IG+SV VLRFLLC+ ATIPVS + R VP   TG+H+YA A+GA LSYL
Sbjct  1    MALLEMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM I R  CG ITF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMLLGYLSMAIYRAKCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGL+ EE+LREAQKKNRL   PSL+EY GYCL
Sbjct  120  TGALMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCL  170



>ref|XP_008369472.1| PREDICTED: lysophospholipid acyltransferase 1-like [Malus domestica]
Length=465

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMA+ IG+SV VLRFLLCF ATIPVS I RLVP     +H+YA A+GA LSYLSFGF
Sbjct  4    EMESMAAGIGVSVSVLRFLLCFVATIPVSFIWRLVPS-PPAKHLYAAASGALLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM+  R +CG ITF+L FGYLIGCHV+YMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYASMVFARNHCGIITFVLGFGYLIGCHVFYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LRE+QKKNRL+  PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAINYNDGVLKEEGLRESQKKNRLIKLPSLIEYFGYCL  169



>ref|XP_009339650.1| PREDICTED: lysophospholipid acyltransferase 1-like [Pyrus x bretschneideri]
Length=461

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFS  256
            MESMA+AIG+SVPVLRFLLCF ATIPVS I RLVP     +H+YA A+GA LSYLSFGFS
Sbjct  1    MESMAAAIGVSVPVLRFLLCFVATIPVSFIWRLVPS-PPAKHLYAFASGALLSYLSFGFS  59

Query  257  SNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALM  436
            SNLHFLVPMLLGY SM+  R +CG ITF+L FGYLIGCHV+YMSGDAWKEGGIDATGALM
Sbjct  60   SNLHFLVPMLLGYASMVFARNHCGIITFILGFGYLIGCHVFYMSGDAWKEGGIDATGALM  119

Query  437  VITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            V+TLK+IS  ++Y DG+LKEE LRE+QKKNRL+  PSL+EYFGYCL
Sbjct  120  VLTLKVISSAINYNDGVLKEEGLRESQKKNRLIKLPSLIEYFGYCL  165



>gb|KDP25507.1| hypothetical protein JCGZ_20663 [Jatropha curcas]
Length=458

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNL  265
            MA+AIG+S+PVLRFLLCF ATIPVS IHRL PG   G+H+YA  +G  LSYLSFGFSSNL
Sbjct  1    MAAAIGVSIPVLRFLLCFVATIPVSFIHRLAPG-RLGKHLYAAGSGIILSYLSFGFSSNL  59

Query  266  HFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVIT  445
            HFLVPMLLGY SM++ R YCG +TF+L FGYLIGCHVYYMSGDAWKEGGIDATGALMV+T
Sbjct  60   HFLVPMLLGYASMVLFRAYCGILTFILGFGYLIGCHVYYMSGDAWKEGGIDATGALMVLT  119

Query  446  LKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            LK+ISC ++Y DGLLKEE+LREAQKK RL+  PSL+EYFGYCL
Sbjct  120  LKVISCAINYNDGLLKEEELREAQKKYRLIKLPSLIEYFGYCL  162



>gb|KDO63565.1| hypothetical protein CISIN_1g012501mg [Citrus sinensis]
Length=420

 Score =   263 bits (673),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M L EMESMA +IG+SV VLRFLLC+ ATIPVS + R VP   TG+H+YA A+GA LSYL
Sbjct  1    MALLEMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM I R  CG ITF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMLLGYLSMAIYRAKCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGL+ EE+LREAQKKNRL   PSL+EY GYCL
Sbjct  120  TGALMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCL  170



>ref|XP_002886438.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH62697.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=465

 Score =   265 bits (676),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M SMAS+IG+SV VLRFLLCF ATIP+S + R VP    G+HIY+ A+GA LSYL
Sbjct  1    MELLDMNSMASSIGVSVAVLRFLLCFVATIPISFLWRFVPS-RLGKHIYSAASGAFLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I RP  G ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRPLSGLITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+ RPSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIQRPSLIEYFGYCL  170



>ref|XP_010476235.1| PREDICTED: lysophospholipid acyltransferase 1 [Camelina sativa]
Length=465

 Score =   265 bits (676),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            ME  +M SMA++IG+SV VLRFLLCF ATIPVS   R+VP G  G+H+YA A+GA LSYL
Sbjct  1    MEWVDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRIVPSG-IGKHLYAAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM + RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAVYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC M+Y DG+LKEE LREAQKK+RL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCAMNYNDGMLKEEGLREAQKKHRLIQMPSLIEYFGYCL  170



>ref|XP_010933881.1| PREDICTED: lysophospholipid acyltransferase 1-like [Elaeis guineensis]
Length=465

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL EM SMASAIG+S+PVLRFLLCF ATIPVS + R VPG    +H+YA  +GAALSYL
Sbjct  1    MEL-EMASMASAIGVSIPVLRFLLCFVATIPVSFLWRFVPG-TLAKHLYAGLSGAALSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFL+PM  GY SML+ R YCG +TF + FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLIPMAAGYASMLLCRRYCGILTFFVGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLL+EE LREAQKKNRL++ PS++EYFGYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGLLREEGLREAQKKNRLIHCPSVIEYFGYCL  169



>gb|AHE80986.1| acyl-CoA:lysophosphatidylcholine acyltransferase [Hiptage benghalensis]
Length=462

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 145/171 (85%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL ++++MAS+IG+SVPVLRFLLCF ATIPV   HR VP  + G+H+YA   GA LSYL
Sbjct  1    MEL-DLDAMASSIGVSVPVLRFLLCFVATIPVGYFHRFVPS-SFGKHVYAFGAGAYLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFG SSN HFLVPMLLGY SML+ R +CG ITF L FGYLIGCHVYYMSGDAWKEGGID+
Sbjct  59   SFGMSSNAHFLVPMLLGYASMLLFRRHCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDS  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLLKEEDLRE QKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGLLKEEDLRETQKKNRLIKMPSLIEYFGYCL  169



>ref|XP_008795385.1| PREDICTED: lysophospholipid acyltransferase 1-like [Phoenix dactylifera]
Length=465

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL EM SMASAIG+S+PVLRFLLCF ATIPVS + RLVPG    +HIYA  +GAALS L
Sbjct  1    MEL-EMASMASAIGVSIPVLRFLLCFVATIPVSFLWRLVPG-TLAKHIYAGLSGAALSCL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFL+PM  GYGSML+ R YCG +TF + FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLIPMSAGYGSMLLCRRYCGILTFFVGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLL+EE LREAQKKNRL++ PS++EYFGYC+
Sbjct  119  TGALMVLTLKVISCAINYNDGLLREEGLREAQKKNRLIHCPSIIEYFGYCV  169



>gb|KCW72088.1| hypothetical protein EUGRSUZ_E00532 [Eucalyptus grandis]
Length=388

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL EMESMASAIG+SV V RFLLC+ ATIPVS + R VPG    +H YA  +GA LSYL
Sbjct  1    MEL-EMESMASAIGVSVAVFRFLLCYLATIPVSFLWRFVPG-RLAKHAYAAGSGALLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM+  R  CG +TF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLVPMLLGYLSMVACRSKCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLLKEEDLR++QKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGLLKEEDLRDSQKKNRLIKLPSLIEYFGYCL  169



>ref|XP_010553491.1| PREDICTED: lysophospholipid acyltransferase 1-like [Tarenaya 
hassleriana]
Length=462

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 145/171 (85%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M L +M+SMA+AIG+SVPVLRFL+CF ATIPVS + RLVP    G+HIY+ A+GA LSYL
Sbjct  1    MGLVDMDSMAAAIGVSVPVLRFLICFVATIPVSFLWRLVPS-RLGKHIYSAASGAFLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM++GY SM I RP CG ITF L F YLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMMIGYASMAIYRPKCGIITFSLGFAYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+ LK+ISC ++Y DG+L+EE LREAQKKNRL+  PS +EYFGYCL
Sbjct  120  TGALMVLVLKVISCAINYNDGMLEEEGLREAQKKNRLIQMPSPIEYFGYCL  170



>ref|XP_006307436.1| hypothetical protein CARUB_v10009061mg [Capsella rubella]
 gb|EOA40334.1| hypothetical protein CARUB_v10009061mg [Capsella rubella]
Length=465

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M SMA++IG+SV VLRFLLCF ATIPVS   R+VP    G+H+YA A+GA LSYL
Sbjct  1    MELMDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRIVPS-RLGKHLYAAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC M+Y DG+LKEE L EAQKKNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCAMNYNDGMLKEEGLSEAQKKNRLIQMPSLIEYFGYCL  170



>ref|XP_006440536.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
 gb|ESR53776.1| hypothetical protein CICLE_v10020062mg [Citrus clementina]
Length=462

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M L EMESMA +IG+SV VLRFLLC+ ATIPVS + R VP   TG+H+YA A+GA LSYL
Sbjct  1    MALLEMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM I R  CG ITF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMLLGYLSMAIYRAKCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGL+ EE+LREAQKKNRL   PSL+EY GYCL
Sbjct  120  TGALMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCL  170



>ref|XP_010494443.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X1 
[Camelina sativa]
Length=465

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M L +M SMA++IG+SV VLRFLLCF A IPVS   R+VP G  G+H+YA A+GA LSYL
Sbjct  1    MGLVDMSSMAASIGVSVAVLRFLLCFVAMIPVSFAWRIVPSG-IGKHLYAAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM + RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAVYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC M+Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCAMNYNDGMLKEEGLREAQKKNRLVQMPSLIEYFGYCL  170



>gb|KDO63564.1| hypothetical protein CISIN_1g012501mg [Citrus sinensis]
Length=462

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M L EMESMA +IG+SV VLRFLLC+ ATIPVS + R VP   TG+H+YA A+GA LSYL
Sbjct  1    MALLEMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM I R  CG ITF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMLLGYLSMAIYRAKCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGL+ EE+LREAQKKNRL   PSL+EY GYCL
Sbjct  120  TGALMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCL  170



>dbj|BAJ34298.1| unnamed protein product [Thellungiella halophila]
Length=339

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M SMA++IG+SV VLRFLLCF ATIPVS   R+VP    G+H+Y+ A+GA LSYL
Sbjct  1    MELMDMNSMAASIGVSVAVLRFLLCFVATIPVSFAWRIVPS-RLGKHVYSAASGAFLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LREAQ KNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCAINYNDGMLKEEGLREAQMKNRLIGMPSLIEYFGYCL  170



>gb|KCW72087.1| hypothetical protein EUGRSUZ_E00532 [Eucalyptus grandis]
Length=391

 Score =   260 bits (665),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL EMESMASAIG+SV V RFLLC+ ATIPVS + R VPG    +H YA  +GA LSYL
Sbjct  1    MEL-EMESMASAIGVSVAVFRFLLCYLATIPVSFLWRFVPG-RLAKHAYAAGSGALLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM+  R  CG +TF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLVPMLLGYLSMVACRSKCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLLKEEDLR++QKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGLLKEEDLRDSQKKNRLIKLPSLIEYFGYCL  169



>ref|XP_007209112.1| hypothetical protein PRUPE_ppa005358mg [Prunus persica]
 gb|EMJ10311.1| hypothetical protein PRUPE_ppa005358mg [Prunus persica]
Length=465

 Score =   262 bits (670),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMA+AIG+SV VLRFLLCF  TIPVS + RLVP     +H+YA  +GA LSYLSFGF
Sbjct  4    EMESMAAAIGVSVAVLRFLLCFVFTIPVSFLWRLVPS-PPAKHLYAAVSGALLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM+  R +CG ITF+L+FGYLIGCHV YMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYASMVFARSHCGIITFILSFGYLIGCHVVYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE LRE+QKKNRL+  PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAINYNDGLLKEEGLRESQKKNRLIKLPSLIEYFGYCL  169



>ref|XP_002892700.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68959.1| membrane bound O-acyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=462

 Score =   262 bits (669),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +M SMA++IG+SV VLRFLLCF ATIPVS   R+VP    G+H+YA A+GA LSYLSFGF
Sbjct  2    DMSSMAASIGVSVAVLRFLLCFVATIPVSFACRIVPS-RLGKHLYAAASGAFLSYLSFGF  60

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM +GY SM I RP CG ITF L FGYLIGCHV+YMSGDAWKEGGID+TGAL
Sbjct  61   SSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFGYLIGCHVFYMSGDAWKEGGIDSTGAL  120

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC M+Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  121  MVLTLKVISCAMNYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCL  167



>ref|XP_008803275.1| PREDICTED: lysophospholipid acyltransferase 1-like [Phoenix dactylifera]
Length=466

 Score =   262 bits (669),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 145/171 (85%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL EM SMA+AIG+S+PVLRFLLCF ATIP S + RLVPG    +H+YA  +GAALSYL
Sbjct  1    MEL-EMASMAAAIGVSIPVLRFLLCFVATIPASFLWRLVPG-TLAKHLYAGLSGAALSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFL+PM  GY SML+ R YCG  TF   FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLIPMAAGYASMLLCRRYCGIFTFFAGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLL+EE LREAQKKNR+L+ PS++EYFGYCL
Sbjct  119  TGALMVLTLKVISCAINYSDGLLREEGLREAQKKNRILHCPSIIEYFGYCL  169



>ref|XP_004298745.1| PREDICTED: lysophospholipid acyltransferase 1 [Fragaria vesca 
subsp. vesca]
Length=464

 Score =   262 bits (669),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMA++IG+SVPVLRFLLC+ ATIPVS + R+VPG    +H YA A+GA LSYLSFGF
Sbjct  4    EMESMAASIGVSVPVLRFLLCYVATIPVSFLWRVVPG-PLAKHFYAAASGAILSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM LGY SM+  R +CG ITF+L FGYLIGCH+YYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMSLGYASMMFFRKHCGIITFVLGFGYLIGCHMYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LRE+QKK+RL   PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAINYNDGILKEEGLRESQKKHRLTKLPSLIEYFGYCL  169



>ref|XP_010458693.1| PREDICTED: lysophospholipid acyltransferase 1-like [Camelina 
sativa]
Length=465

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M L +M SMA++IG+SV VLRFLLCF ATIPVS   R+VP G  G+H+YA A+GA LSYL
Sbjct  1    MGLVDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRIVPSG-IGKHLYAAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLV M +GY SM + RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVLMTIGYASMAVYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC M+Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCAMNYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCL  170



>ref|XP_010055596.1| PREDICTED: lysophospholipid acyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW72086.1| hypothetical protein EUGRSUZ_E00532 [Eucalyptus grandis]
Length=465

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL EMESMASAIG+SV V RFLLC+ ATIPVS + R VPG    +H YA  +GA LSYL
Sbjct  1    MEL-EMESMASAIGVSVAVFRFLLCYLATIPVSFLWRFVPG-RLAKHAYAAGSGALLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM+  R  CG +TF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLVPMLLGYLSMVACRSKCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLLKEEDLR++QKKNRL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGLLKEEDLRDSQKKNRLIKLPSLIEYFGYCL  169



>ref|XP_006477394.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Citrus sinensis]
Length=462

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M L +MESMA +IG+SV VLRFLLC+ ATIPVS + R VP   TG+H+YA A+GA LSYL
Sbjct  1    MALLDMESMAGSIGVSVAVLRFLLCYVATIPVSFLWRFVPS-RTGKHVYAAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SM I R  CG ITF + FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  60   SFGFSSNLHFLVPMLLGYLSMAIYRAKCGIITFFIGFGYLIGCHVYYMSGDAWKEGGIDA  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGL+ EE+LREAQKKNRL   PSL+EY GYCL
Sbjct  120  TGALMVLTLKVISCAINYNDGLVTEENLREAQKKNRLTRLPSLIEYIGYCL  170



>ref|XP_006417213.1| hypothetical protein EUTSA_v10007564mg [Eutrema salsugineum]
 gb|ESQ35566.1| hypothetical protein EUTSA_v10007564mg [Eutrema salsugineum]
Length=465

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M SMA++IG+SV VLRFLLCF ATIPVS   R+VP    G+H+Y+ A+GA LSYL
Sbjct  1    MELMDMNSMAASIGVSVAVLRFLLCFVATIPVSFAWRIVPS-RLGKHVYSAASGAFLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LREAQ KNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCAINYNDGMLKEEGLREAQMKNRLIGMPSLIEYFGYCL  170



>ref|NP_176493.1| lysophosphatidylcholine acyltransferase [Arabidopsis thaliana]
 sp|Q9CAN8.1|MBOA2_ARATH RecName: Full=Lysophospholipid acyltransferase 2; Short=AtLPLAT2; 
AltName: Full=1-acylglycerophosphocholine O-acyltransferase 
2; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; 
AltName: Full=1-acylglycerophosphoserine O-acyltransferase; 
AltName: Full=Lysophosphatidylcholine acyltransferase 
2; Short=LPCAT2; AltName: Full=Lysophosphatidylethanolamine 
acyltransferase; Short=LPEAT; AltName: Full=Lysophosphatidylglycerol 
acyltransferase; Short=LPGAT; AltName: Full=Lysophosphatidylserine 
acyltransferase; Short=LPSAT [Arabidopsis 
thaliana]
 gb|AAG51612.1|AC010795_16 unknown protein; 29405-27288 [Arabidopsis thaliana]
 gb|AAL59903.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67512.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34045.1| lysophosphatidylcholine acyltransferase [Arabidopsis thaliana]
Length=465

 Score =   259 bits (663),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M SMA++IG+SV VLRFLLCF ATIP+S + R +P    G+HIY+ A+GA LSYL
Sbjct  1    MELLDMNSMAASIGVSVAVLRFLLCFVATIPISFLWRFIPS-RLGKHIYSAASGAFLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I RP  G ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRPLSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCL  170



>emb|CDY63224.1| BnaCnng41640D [Brassica napus]
Length=467

 Score =   259 bits (663),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            ME  +M SMA++IG+SV VLRFLLCF ATIPVS   R VP    G+HIY+ A+GA LSYL
Sbjct  1    MESLDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRFVPS-RLGKHIYSAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRPMCGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LREAQ+KNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCSINYNDGMLKEETLREAQRKNRLVRMPSLIEYFGYCL  170



>ref|XP_009148576.1| PREDICTED: lysophospholipid acyltransferase 1 [Brassica rapa]
Length=466

 Score =   259 bits (662),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +M+SMA++IG+SV VLRFLLCF ATIPVS   R+VP    G+HIYA A+G  LSYLSFGF
Sbjct  5    DMDSMAASIGVSVAVLRFLLCFVATIPVSFFWRIVPS-RLGKHIYAAASGVFLSYLSFGF  63

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM +GY SM + RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFLVPMTIGYASMAMYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGAL  123

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  124  MVLTLKVISCAVNYNDGMLKEEGLREAQKKNRLIEMPSLIEYFGYCL  170



>ref|NP_172724.2| lysophosphatidylcholine acyltransferase 1 [Arabidopsis thaliana]
 sp|F4IDU4.1|MBOA1_ARATH RecName: Full=Lysophospholipid acyltransferase 1; Short=AtLPLAT1; 
AltName: Full=1-acylglycerophosphocholine O-acyltransferase 
1; AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; 
AltName: Full=1-acylglycerophosphoserine O-acyltransferase; 
AltName: Full=Lysophosphatidylcholine acyltransferase 
1; Short=LPCAT1; AltName: Full=Lysophosphatidylethanolamine 
acyltransferase; Short=LPEAT; AltName: Full=Lysophosphatidylglycerol 
acyltransferase; Short=LPGAT; AltName: Full=Lysophosphatidylserine 
acyltransferase; Short=LPSAT [Arabidopsis 
thaliana]
 gb|AEE28904.1| MBOAT (membrane bound O-acyl transferase)-like protein [Arabidopsis 
thaliana]
Length=462

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +M SMA +IG+SV VLRFLLCF ATIPVS   R+VP    G+H+YA A+GA LSYLSFGF
Sbjct  2    DMSSMAGSIGVSVAVLRFLLCFVATIPVSFACRIVPS-RLGKHLYAAASGAFLSYLSFGF  60

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM +GY SM I RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+TGAL
Sbjct  61   SSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGAL  120

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC M+Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  121  MVLTLKVISCSMNYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCL  167



>emb|CDX98051.1| BnaA06g08020D [Brassica napus]
Length=466

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +M+SMA++IG+SV VLRFLLCF ATIPVS   R+VP    G+H+YA A+G  LSYLSFGF
Sbjct  5    DMDSMAASIGVSVAVLRFLLCFVATIPVSFFWRIVPS-RLGKHVYAAASGVFLSYLSFGF  63

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM +GY SM + RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFLVPMTIGYASMAMYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGAL  123

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  124  MVLTLKVISCAVNYNDGMLKEEGLREAQKKNRLIEMPSLIEYFGYCL  170



>gb|KFK43529.1| hypothetical protein AALP_AA1G138000 [Arabis alpina]
Length=465

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +M SMA++IG+S+ VLRFLLCF ATIPVS   R+VP    G+H+Y+ A+GA LSYL
Sbjct  1    MELMDMSSMAASIGVSIAVLRFLLCFVATIPVSFAWRIVPS-QLGKHVYSFASGAFLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I R  CG ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRAKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCSINYNDGILKEEGLREAQKKNRLIRMPSLIEYFGYCL  170



>ref|XP_004515799.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X2 
[Cicer arietinum]
Length=465

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 145/171 (85%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +++SMA++IG+S+PVLRFL+CF ATIP+S + R VPG    +H Y+ A G  LSYL
Sbjct  1    MEL-QLDSMAASIGVSIPVLRFLICFVATIPLSFLCRFVPG-RLPKHFYSAAVGVVLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SML+ RP CG +TF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLVPMLLGYASMLLYRPRCGIVTFFLGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKE+ LREAQKKNRL+  P+L+EY GYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGMLKEDGLREAQKKNRLIQLPTLIEYVGYCL  169



>ref|XP_010255524.1| PREDICTED: lysophospholipid acyltransferase 1-like [Nelumbo nucifera]
Length=464

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = +2

Query  71   PEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFG  250
            P+MESMAS+I +SVPVLRFLLCF ATIPVS + RLVPG    +H+Y+ A+GA LSYLSFG
Sbjct  3    PDMESMASSISVSVPVLRFLLCFVATIPVSFLWRLVPG-TIPKHLYSAASGAVLSYLSFG  61

Query  251  FSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGA  430
             SSNLHFLV ML+GY SML+ R  CG I+F   FGYLIGCH+YYMSGDAWKEGGIDATGA
Sbjct  62   LSSNLHFLVSMLMGYTSMLVYRRRCGIISFFTGFGYLIGCHIYYMSGDAWKEGGIDATGA  121

Query  431  LMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            LMV++LK+ISC ++Y DGLLKEE LR AQKKNRLL  P+L+EYFGYCL
Sbjct  122  LMVVSLKVISCAINYNDGLLKEEGLRVAQKKNRLLKLPTLVEYFGYCL  169



>ref|XP_008238778.1| PREDICTED: lysophospholipid acyltransferase 1 [Prunus mume]
Length=465

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMESMA+ IG+SV VLRFLLCF ATIPVS + RLVP     +H+YA  +GA LSYLSFGF
Sbjct  4    EMESMAATIGVSVAVLRFLLCFVATIPVSFLWRLVPS-PPAKHLYAAVSGALLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPMLLGY SM+  R +CG ITF+L FGYLIGCHV+YMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMLLGYASMVFARSHCGIITFILGFGYLIGCHVFYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE L E+QKKNRL+  PSL+EY GYCL
Sbjct  123  MVLTLKVISCAINYNDGLLKEEGLLESQKKNRLIKLPSLIEYVGYCL  169



>ref|XP_010919229.1| PREDICTED: lysophospholipid acyltransferase 1-like [Elaeis guineensis]
Length=465

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL EM SMA+AIG+S+PVLRFLLCF ATIP S   RLVPG    +H+YA  +GAALSYL
Sbjct  1    MEL-EMASMAAAIGVSIPVLRFLLCFVATIPASFFWRLVPG-TLAKHLYAGLSGAALSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFG SSNLHFL+PM +GY SML+ R YCG +TF   FGYLIGCHVYYMSG+AWKEGGIDA
Sbjct  59   SFGLSSNLHFLIPMAVGYASMLLCRRYCGTLTFFAGFGYLIGCHVYYMSGNAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DGLL+EE LREAQ KNRLL+ PS++EYFGYCL
Sbjct  119  TGALMVLTLKVISCTINYSDGLLREEGLREAQTKNRLLHCPSIIEYFGYCL  169



>ref|XP_008448977.1| PREDICTED: lysophospholipid acyltransferase 1 [Cucumis melo]
Length=464

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMES+A++IG+SVPVLRFLLCF ATIPVS + R+VPG    +H+Y+  +G  LSYLSFGF
Sbjct  4    EMESLAASIGVSVPVLRFLLCFVATIPVSFLWRIVPG-RLPKHLYSALSGVLLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM LGY SM++ R +CG ITF L FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMFLGYASMVLFRRHCGLITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE L EAQKKNRL+  PSL+EY GYCL
Sbjct  123  MVLTLKVISCAINYNDGLLKEEGLTEAQKKNRLIKLPSLIEYIGYCL  169



>ref|XP_004148282.1| PREDICTED: lysophospholipid acyltransferase-like [Cucumis sativus]
 ref|XP_004162789.1| PREDICTED: lysophospholipid acyltransferase-like [Cucumis sativus]
 gb|KGN55973.1| hypothetical protein Csa_3G043890 [Cucumis sativus]
Length=464

 Score =   257 bits (656),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EMES+A++IG+SVPVLRFLLCF ATIPVS + R+VPG    +H+Y+  +G  LSYLSFGF
Sbjct  4    EMESLAASIGVSVPVLRFLLCFVATIPVSFLWRIVPG-RLPKHLYSALSGVLLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM LGY SM++ R +CG ITF L FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMFLGYASMVLFRRHCGLITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE L EAQKKNRL+  PSL+EY GYCL
Sbjct  123  MVLTLKVISCAINYNDGLLKEEGLTEAQKKNRLIKLPSLIEYIGYCL  169



>gb|AAM13086.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91162.1| unknown protein [Arabidopsis thaliana]
Length=462

 Score =   257 bits (656),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +M SMA +IG+SV VLRFLLCF ATIPVS   R+VP    G+H+YA A+GA LSYLSFGF
Sbjct  2    DMSSMAGSIGVSVAVLRFLLCFVATIPVSFACRIVPS-RLGKHLYAAASGAFLSYLSFGF  60

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM +GY SM I RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+TGAL
Sbjct  61   SSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGAL  120

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC M+Y DG+LKEE LREAQKKNRL+  PSL++YFGYCL
Sbjct  121  MVLTLKVISCSMNYNDGMLKEEGLREAQKKNRLIQMPSLIKYFGYCL  167



>ref|XP_010430382.1| PREDICTED: lysophospholipid acyltransferase 2-like [Camelina 
sativa]
Length=465

 Score =   257 bits (656),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +M+SMA++IG+SV VLRFLLCF ATIPVS + R VP    G+HIYA A+GA LSYLSFGF
Sbjct  5    DMDSMAASIGVSVAVLRFLLCFVATIPVSFLWRFVPS-RLGKHIYAAASGAFLSYLSFGF  63

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM +GY SM I RP  G ITF L F YLIGCHV+YMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFLVPMTIGYASMAIYRPLSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGAL  123

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  124  MVLTLKVISCSINYNDGVLKEEGLREAQKKNRLIGMPSLIEYFGYCL  170



>ref|XP_004515798.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X1 
[Cicer arietinum]
Length=484

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 145/171 (85%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +++SMA++IG+S+PVLRFL+CF ATIP+S + R VPG    +H Y+ A G  LSYL
Sbjct  1    MEL-QLDSMAASIGVSIPVLRFLICFVATIPLSFLCRFVPG-RLPKHFYSAAVGVVLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPMLLGY SML+ RP CG +TF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLVPMLLGYASMLLYRPRCGIVTFFLGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKE+ LREAQKKNRL+  P+L+EY GYCL
Sbjct  119  TGALMVLTLKVISCAINYNDGMLKEDGLREAQKKNRLIQLPTLIEYVGYCL  169



>ref|XP_010418312.1| PREDICTED: lysophospholipid acyltransferase 2-like [Camelina 
sativa]
Length=465

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +M+SMA++IG+SV VLRFLLCF ATIPVS + R VP    G+HIYA A+GA LSYLSFGF
Sbjct  5    DMDSMAASIGVSVAVLRFLLCFVATIPVSFLWRFVPS-RLGKHIYAAASGAFLSYLSFGF  63

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM +GY SM I+RP  G ITF L F YLIGCHV+YMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFLVPMTIGYASMAIHRPLSGFITFFLGFTYLIGCHVFYMSGDAWKEGGIDSTGAL  123

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LREAQ+KNRL+  PSL+EYFGYCL
Sbjct  124  MVLTLKVISCSINYNDGVLKEEGLREAQRKNRLIGMPSLIEYFGYCL  170



>gb|KHN14121.1| Membrane-bound O-acyltransferase domain-containing protein 2 
[Glycine soja]
Length=463

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
             M+SMA++IG+SVPVLRFLLCFAAT+P+S + RL+P G   +H+Y+ A G ALSYLSFG 
Sbjct  2    SMDSMATSIGVSVPVLRFLLCFAATVPLSFLCRLLPRGLP-KHLYSAAVGVALSYLSFGV  60

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM LGY SML+ RP CG +TF L FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  61   SSNLHFLVPMFLGYASMLLFRPRCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGAL  120

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE LREAQKK RL+  PSL+EY GYCL
Sbjct  121  MVLTLKVISCAVNYNDGLLKEEGLREAQKKYRLIKLPSLIEYIGYCL  167



>ref|XP_009113025.1| PREDICTED: lysophospholipid acyltransferase 2 [Brassica rapa]
Length=467

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            ME  +M SMA++IG+SV VLRFLLCF ATIPVS   R VP    G+HIY+ A+GA LSYL
Sbjct  1    MESFDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRFVPS-RLGKHIYSAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I RP  G ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRPMSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLVRMPSLIEYFGYCL  170



>gb|KHN34432.1| Lysophospholipid acyltransferase 2 [Glycine soja]
Length=463

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFS  256
            M+SMA++IG+SVPVLRFLLCFAAT+P+S + RL+P G   +H+Y+ A G ALSYLSFG S
Sbjct  3    MDSMAASIGVSVPVLRFLLCFAATVPLSFLCRLLPRGLP-KHLYSAAVGVALSYLSFGVS  61

Query  257  SNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALM  436
            SNLHFLVPM LGY SML+ RP CG +TF L FGYLIGCHVYYMSGDAWKEGGIDATGALM
Sbjct  62   SNLHFLVPMFLGYASMLLYRPRCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGALM  121

Query  437  VITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            V+TLK+ISC ++Y DGLLKEE LREAQKK RL+  PSL+EY GYCL
Sbjct  122  VLTLKVISCAVNYNDGLLKEEGLREAQKKYRLIKLPSLIEYIGYCL  167



>emb|CDY45972.1| BnaA09g12940D [Brassica napus]
Length=467

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            ME  +M SMA++IG+SV VLRFLLCF ATIPVS   R VP    G+HIY+ A+GA LSYL
Sbjct  1    MESFDMSSMAASIGVSVAVLRFLLCFVATIPVSFAWRFVPS-RLGKHIYSAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I RP  G ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRPMSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  120  TGALMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLVRMPSLIEYFGYCL  170



>ref|XP_003525728.1| PREDICTED: lysophospholipid acyltransferase 2-like [Glycine max]
Length=463

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 142/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFS  256
            M+SMA++IG+SVPVLRFLLCFAAT+P+S + RL+P G   +H+Y+ A G ALSYLSFG S
Sbjct  3    MDSMAASIGVSVPVLRFLLCFAATVPLSFLCRLLPRGLP-KHLYSAAVGVALSYLSFGVS  61

Query  257  SNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALM  436
            SNLHFLVPM LGY SML+ RP CG +TF L FGYLIGCHVYYMSGDAWKEGGIDATGALM
Sbjct  62   SNLHFLVPMFLGYASMLLFRPRCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGALM  121

Query  437  VITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            V+TLK+ISC ++Y DGLLKEE LREAQKK RL+  PSL+EY GYCL
Sbjct  122  VLTLKVISCAVNYNDGLLKEEGLREAQKKYRLIKLPSLIEYIGYCL  167



>ref|XP_003549863.1| PREDICTED: lysophospholipid acyltransferase 2 [Glycine max]
Length=463

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
             M+SMA++IG+SVPVLRFLLCFAAT+P+S + R +P G   +H+Y+   G ALSYLSFGF
Sbjct  2    SMDSMATSIGVSVPVLRFLLCFAATVPLSFLCRFLPRGLP-KHLYSSVVGVALSYLSFGF  60

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM LGY SML+ RP CG +TF L FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  61   SSNLHFLVPMFLGYASMLLYRPRCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGAL  120

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE LREAQKK RL+  PSL+EY GYCL
Sbjct  121  MVLTLKVISCAVNYNDGLLKEEGLREAQKKYRLIKLPSLIEYIGYCL  167



>emb|CDY57076.1| BnaCnng31560D [Brassica napus]
Length=465

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +M SMA++IG+SV VLRFL CF ATIPVS   R+VP    G+HIYA A+G  LSYLSFGF
Sbjct  5    DMNSMAASIGVSVAVLRFLQCFVATIPVSFFWRIVPS-RLGKHIYAAASGVFLSYLSFGF  63

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM +GY SM + RP CG I+F L F YLIGCHV+YMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFLVPMTIGYASMAMYRPKCGIISFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGAL  123

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  124  MVLTLKVISCAVNYNDGMLKEEGLREAQKKNRLIEMPSLIEYFGYCL  170



>ref|XP_010473534.1| PREDICTED: lysophospholipid acyltransferase 2 [Camelina sativa]
Length=465

 Score =   254 bits (650),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +M+SMA++IG+SV VLRFLLCF ATIPVS + R VP    G+HIYA A+GA LSYLSFGF
Sbjct  5    DMDSMAASIGVSVAVLRFLLCFVATIPVSFLWRFVPS-RLGKHIYAAASGAFLSYLSFGF  63

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM +GY SM I  P  G ITF L F YLIGCHV+YMSGDAWKEGGID+TGAL
Sbjct  64   SSNLHFLVPMTIGYASMAIYPPLSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGAL  123

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  124  MVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIGMPSLIEYFGYCL  170



>gb|KJB29823.1| hypothetical protein B456_005G120200 [Gossypium raimondii]
Length=462

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 143/171 (84%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL  +E+MA+AIG+SVPVLRFLLCF ATIPVS + R VP     +H+Y+  +G  LSYL
Sbjct  1    MEL-GLETMAAAIGVSVPVLRFLLCFVATIPVSFLWRFVPR-TLPKHVYSAFSGVVLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFG SSNL FLVPMLLGY +ML+ RP CG ITF L+FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGISSNLLFLVPMLLGYAAMLLYRPKCGIITFFLSFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+IS  ++Y DGLLKEEDLREAQKK RL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISSAINYNDGLLKEEDLREAQKKYRLVKLPSLIEYFGYCL  169



>gb|KJB29824.1| hypothetical protein B456_005G120200 [Gossypium raimondii]
Length=463

 Score =   254 bits (649),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 143/171 (84%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL  +E+MA+AIG+SVPVLRFLLCF ATIPVS + R VP     +H+Y+  +G  LSYL
Sbjct  1    MEL-GLETMAAAIGVSVPVLRFLLCFVATIPVSFLWRFVPR-TLPKHVYSAFSGVVLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFG SSNL FLVPMLLGY +ML+ RP CG ITF L+FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGISSNLLFLVPMLLGYAAMLLYRPKCGIITFFLSFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+IS  ++Y DGLLKEEDLREAQKK RL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISSAINYNDGLLKEEDLREAQKKYRLVKLPSLIEYFGYCL  169



>ref|XP_010934444.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X2 
[Elaeis guineensis]
Length=433

 Score =   253 bits (647),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL EMES+A+AIG+SVPVLRFL CF ATIPVSL  RLVPG    +H+YA  TGA LSYL
Sbjct  1    MEL-EMESIAAAIGVSVPVLRFLHCFVATIPVSLAWRLVPG-TLPKHLYAAVTGAVLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFG SSNLHFL+PM LGY SM + R +CG ITF + FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGLSSNLHFLIPMALGYASMRLFRRHCGIITFFIGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK++SC ++Y DGLLKEE LR+AQKK RL++ PS++EY GYCL
Sbjct  119  TGALMVLTLKVVSCAINYGDGLLKEEGLRDAQKKYRLIHCPSIIEYIGYCL  169



>ref|XP_006857893.1| hypothetical protein AMTR_s00069p00124460 [Amborella trichopoda]
 gb|ERN19360.1| hypothetical protein AMTR_s00069p00124460 [Amborella trichopoda]
Length=463

 Score =   254 bits (649),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +M++MA++IG+SVPVLRFLLCF ATIPVS + R VPG    +H+Y+  TGA LSYLSFGF
Sbjct  2    DMQAMAASIGVSVPVLRFLLCFVATIPVSWLWRFVPG-RLPKHLYSALTGALLSYLSFGF  60

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFL+PM LGY SML+ RP CG  TF+  FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  61   SSNLHFLIPMSLGYLSMLVYRPLCGPFTFIAGFGYLIGCHVYYMSGDAWKEGGIDATGAL  120

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE LREAQKK RL+  PSL+EY GYCL
Sbjct  121  MVLTLKVISCSINYNDGLLKEEGLREAQKKYRLIQCPSLIEYIGYCL  167



>gb|AAF88094.1|AC025417_22 T12C24.17 [Arabidopsis thaliana]
Length=457

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNL  265
            MA +IG+SV VLRFLLCF ATIPVS   R+VP    G+H+YA A+GA LSYLSFGFSSNL
Sbjct  1    MAGSIGVSVAVLRFLLCFVATIPVSFACRIVPS-RLGKHLYAAASGAFLSYLSFGFSSNL  59

Query  266  HFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVIT  445
            HFLVPM +GY SM I RP CG ITF L F YLIGCHV+YMSGDAWKEGGID+TGALMV+T
Sbjct  60   HFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGALMVLT  119

Query  446  LKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            LK+ISC M+Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  120  LKVISCSMNYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCL  162



>ref|XP_010934443.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X1 
[Elaeis guineensis]
Length=465

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL EMES+A+AIG+SVPVLRFL CF ATIPVSL  RLVPG    +H+YA  TGA LSYL
Sbjct  1    MEL-EMESIAAAIGVSVPVLRFLHCFVATIPVSLAWRLVPG-TLPKHLYAAVTGAVLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFG SSNLHFL+PM LGY SM + R +CG ITF + FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGLSSNLHFLIPMALGYASMRLFRRHCGIITFFIGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK++SC ++Y DGLLKEE LR+AQKK RL++ PS++EY GYCL
Sbjct  119  TGALMVLTLKVVSCAINYGDGLLKEEGLRDAQKKYRLIHCPSIIEYIGYCL  169



>ref|XP_006300445.1| hypothetical protein CARUB_v10020125mg [Capsella rubella]
 gb|EOA33343.1| hypothetical protein CARUB_v10020125mg [Capsella rubella]
Length=531

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +2

Query  44   EVSSGDMELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATG  223
              S   M L +M+S A++IG+SV VLRFLLCF ATIPVS   R VP    G+HIYA A+G
Sbjct  61   HTSHATMGLLDMDSTAASIGVSVAVLRFLLCFVATIPVSFSWRFVPS-RLGKHIYAAASG  119

Query  224  AALSYLSFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWK  403
              LSYLSFGFSSNLHFLVPM +GY SM I RP  G ITF L F YLIGCHV+YMSGDAWK
Sbjct  120  VFLSYLSFGFSSNLHFLVPMTIGYASMAIYRPLSGFITFFLGFAYLIGCHVFYMSGDAWK  179

Query  404  EGGIDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            EGGID+TGALMV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  180  EGGIDSTGALMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCL  236



>gb|KHG06049.1| Lysophospholipid acyltransferase 2 [Gossypium arboreum]
Length=462

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 143/171 (84%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL  +E+MA+AIG+SVPVL FLLCF ATIPVS + R VPG    +H+Y+  +G  LSYL
Sbjct  1    MEL-GLETMAAAIGVSVPVLWFLLCFVATIPVSFLWRFVPG-TLPKHVYSAFSGLVLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFG SSNL FLVPMLLGY +ML+ RP CG ITF L+FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGISSNLLFLVPMLLGYAAMLLYRPKCGIITFFLSFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+IS  ++Y DGLLKEEDLREAQKK RL+  PSL+EYFGYCL
Sbjct  119  TGALMVLTLKVISSAINYNDGLLKEEDLREAQKKYRLVKLPSLIEYFGYCL  169



>ref|XP_006391786.1| hypothetical protein EUTSA_v10023446mg [Eutrema salsugineum]
 gb|ESQ29072.1| hypothetical protein EUTSA_v10023446mg [Eutrema salsugineum]
Length=466

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            ME  +M SMA++IG+SV VLRFLLCF ATIPVS   RLVP    G+HIY+ A+GA LSYL
Sbjct  1    MESFDMGSMAASIGVSVAVLRFLLCFVATIPVSFAWRLVPS-RLGKHIYSAASGAFLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I RP  G ITF L F YLIGCHV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRPMSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EY GYCL
Sbjct  120  TGALMVLTLKVISCSINYNDGMLKEESLREAQKKNRLIQLPSLIEYCGYCL  170



>ref|XP_007155562.1| hypothetical protein PHAVU_003G212400g [Phaseolus vulgaris]
 gb|ESW27556.1| hypothetical protein PHAVU_003G212400g [Phaseolus vulgaris]
Length=463

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFS  256
            M+SMA++IG+SVPVLRFLLCFAAT+P+S + R +P G   +H+Y+   G  LSYLSFG S
Sbjct  3    MDSMAASIGVSVPVLRFLLCFAATVPLSFLCRFLPRGLP-KHLYSAVVGVVLSYLSFGVS  61

Query  257  SNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALM  436
            SNLHFLVPM LGY SML+ RP CG +TF L FGYLIGCHVYYMSGDAWKEGGIDATGALM
Sbjct  62   SNLHFLVPMFLGYASMLLFRPRCGILTFFLGFGYLIGCHVYYMSGDAWKEGGIDATGALM  121

Query  437  VITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            V+TLK+ISC ++Y DGLLKEE LREAQKK RL+  PSLLEY GYCL
Sbjct  122  VLTLKVISCAVNYNDGLLKEEGLREAQKKYRLVRLPSLLEYIGYCL  167



>gb|AGL81301.1| lysophosphatidylcholine acyltransferase [Momordica charantia]
Length=465

 Score =   252 bits (643),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EME +A++IGISVPVLRFLLCF ATIPVS + RLVPG    +H+Y+  +G  LSYLSFGF
Sbjct  4    EMEPLAASIGISVPVLRFLLCFVATIPVSFLWRLVPG-RLPKHLYSALSGVLLSYLSFGF  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLVPM LGY SML+   +CG ITF L FGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVPMSLGYASMLLFHRHCGFITFFLGFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE L EAQKKNRL+  PS +EY GYCL
Sbjct  123  MVLTLKVISCAINYNDGLLKEEGLSEAQKKNRLIKLPSSIEYIGYCL  169



>ref|XP_002454488.1| hypothetical protein SORBIDRAFT_04g031990 [Sorghum bicolor]
 gb|EES07464.1| hypothetical protein SORBIDRAFT_04g031990 [Sorghum bicolor]
Length=457

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EME+MA++IG+SVPVLRFLLCFAATIP  L+ R VPG ATGRH+YA  TGA LSYLSFG 
Sbjct  4    EMEAMAASIGVSVPVLRFLLCFAATIPTGLLWRAVPG-ATGRHLYAGLTGATLSYLSFGP  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNL F+VPM LGY +ML++R + G ITFL AFG+LI CHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLLFVVPMTLGYLAMLLSRRHAGLITFLGAFGFLIACHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LR+AQKK RL   PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAINYSDGILKEEGLRDAQKKYRLTKLPSLIEYFGYCL  169



>ref|XP_004953433.1| PREDICTED: lysophospholipid acyltransferase-like [Setaria italica]
Length=457

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EME+MA++IG+SVPVLRFLLCFAATIP  L+ R VPG ATGRH+YA  TGAALSYLSFG 
Sbjct  4    EMEAMAASIGVSVPVLRFLLCFAATIPTGLLWRAVPG-ATGRHLYAGLTGAALSYLSFGA  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            +SNL F+VPM LGY +ML+ R + G ITFL AFG+LI CHVYYMSGDAWKEGGIDATGAL
Sbjct  63   TSNLLFVVPMALGYLAMLLFRRHAGLITFLGAFGFLIACHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LR+AQKK RL   PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAINYSDGILKEEGLRDAQKKYRLTKLPSLIEYFGYCL  169



>gb|KEH31706.1| membrane-bound O-acyltransferase family MBOAT protein [Medicago 
truncatula]
Length=462

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            MEL +++SMA++IG+SV VLRFLLCF ATIP+S   R VPG    +H Y+ A G  LSYL
Sbjct  1    MEL-QLDSMAASIGVSVAVLRFLLCFVATIPLSFFWRFVPG-RLPKHFYSAAVGVFLSYL  58

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM+LGY SM+I R  CG ITF L FGYLIGCHVYYMSGDAWKEGGIDA
Sbjct  59   SFGFSSNLHFLVPMVLGYASMVIYRQRCGIITFFLGFGYLIGCHVYYMSGDAWKEGGIDA  118

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LR+AQKKNRL+  PS++EY G+CL
Sbjct  119  TGALMVLTLKVISCAINYNDGILKEEGLRDAQKKNRLVKLPSVIEYVGFCL  169



>ref|XP_010693498.1| PREDICTED: lysophospholipid acyltransferase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +M SMA+A+G+SV VLRFLLCF ATIP+SL+ RLVP     +HIY+  TG  L  +SFG 
Sbjct  4    DMSSMAAAMGLSVAVLRFLLCFVATIPISLLWRLVPR-TLPKHIYSAFTGVLLCCISFGI  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            SSNLHFLV +L+GY SML+ RP CG I F  AFGYLIGCHVYYMSGDAWKEGGIDATGAL
Sbjct  63   SSNLHFLVSILIGYSSMLVYRPKCGLIAFFAAFGYLIGCHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++YQDGLLK+EDLREAQKKNRLL  PSL EY GYCL
Sbjct  123  MVLTLKVISCAINYQDGLLKDEDLREAQKKNRLLKMPSLFEYVGYCL  169



>ref|XP_008646049.1| PREDICTED: lysophospholipid acyltransferase 1 [Zea mays]
 gb|AFW72782.1| hypothetical protein ZEAMMB73_982934 [Zea mays]
Length=457

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EME+MA +IG+SVPVLRFLLCFAATIP  L+ R VPG A GRH+YA  TGA LSYLSFG 
Sbjct  4    EMEAMAGSIGVSVPVLRFLLCFAATIPTGLLWRAVPG-AMGRHLYAGLTGATLSYLSFGA  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            +SNL F+VPM LGY +ML+ R + G ITFL AFG+LI CHVYYMSGDAWKEGGIDATGAL
Sbjct  63   TSNLLFVVPMTLGYLAMLLFRRHAGLITFLGAFGFLIACHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LR+AQKKNRL   PSL+EYFGYCL
Sbjct  123  MVLTLKVISCSINYSDGILKEEGLRDAQKKNRLTKLPSLIEYFGYCL  169



>gb|KFK40546.1| hypothetical protein AALP_AA2G010000 [Arabis alpina]
Length=467

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            ME  ++ SMA+ IG+SV VLRFLLCF ATIP+S   R VP    G+HIY+ A+GA LSYL
Sbjct  1    MESLDLSSMAATIGVSVAVLRFLLCFVATIPISFAWRFVPS-RLGKHIYSAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM I RP  G ITF L F YLIGCH +YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAIYRPLSGFITFFLGFAYLIGCHWFYMSGDAWKEGGIDS  119

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC ++Y DG+LKEE LREAQKKNRL+  PSL+EY GYCL
Sbjct  120  TGALMVLTLKVISCSINYTDGMLKEEGLREAQKKNRLIQMPSLIEYCGYCL  170



>gb|AFW72781.1| hypothetical protein ZEAMMB73_982934 [Zea mays]
Length=483

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EME+MA +IG+SVPVLRFLLCFAATIP  L+ R VPG A GRH+YA  TGA LSYLSFG 
Sbjct  4    EMEAMAGSIGVSVPVLRFLLCFAATIPTGLLWRAVPG-AMGRHLYAGLTGATLSYLSFGA  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            +SNL F+VPM LGY +ML+ R + G ITFL AFG+LI CHVYYMSGDAWKEGGIDATGAL
Sbjct  63   TSNLLFVVPMTLGYLAMLLFRRHAGLITFLGAFGFLIACHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DG+LKEE LR+AQKKNRL   PSL+EYFGYCL
Sbjct  123  MVLTLKVISCSINYSDGILKEEGLRDAQKKNRLTKLPSLIEYFGYCL  169



>ref|XP_003570095.1| PREDICTED: lysophospholipid acyltransferase 2 [Brachypodium distachyon]
Length=459

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EME MA+AIG+SVPVLRFLLCFAATIP  L+ R VPG ATGRH+YA  +GAALSYLSFG 
Sbjct  4    EMEPMAAAIGVSVPVLRFLLCFAATIPTGLLWRAVPG-ATGRHLYAGLSGAALSYLSFGA  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            +SNL F+VPM LGY +ML+ R + G +TFL A G+LI CHVYYMSGDAWKEGGIDATGAL
Sbjct  63   TSNLLFVVPMALGYLAMLLCRRHAGLVTFLGALGFLIACHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE LR+AQKK RL   PSL+EYFGYCL
Sbjct  123  MVLTLKVISCAINYSDGLLKEEGLRDAQKKYRLAKLPSLVEYFGYCL  169



>ref|XP_009391951.1| PREDICTED: lysophospholipid acyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = +2

Query  98   IGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNLHFLV  277
            IG+SVPVLRFL CF ATIPVSL  RLVPG    RH+YA  +GA LSYLSFG SSNLHFL+
Sbjct  12   IGVSVPVLRFLFCFVATIPVSLAWRLVPG-TLPRHLYAAVSGAVLSYLSFGASSNLHFLI  70

Query  278  PMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVITLKII  457
            PM + Y SML  R Y GAITF   FGYLIGCHVYYMSGDAWKEGGIDATGALMV+TLK+I
Sbjct  71   PMSVSYASMLFIRRYAGAITFFAGFGYLIGCHVYYMSGDAWKEGGIDATGALMVLTLKVI  130

Query  458  SCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            SC ++Y DGLLKEE LREAQKKNRL+  PSL+EY GYCL
Sbjct  131  SCAINYSDGLLKEESLREAQKKNRLVRCPSLVEYIGYCL  169



>ref|NP_001047723.1| Os02g0676000 [Oryza sativa Japonica Group]
 dbj|BAD29531.1| membrane bound O-acyl transferase-like [Oryza sativa Japonica 
Group]
 dbj|BAF09637.1| Os02g0676000 [Oryza sativa Japonica Group]
 gb|EEC73776.1| hypothetical protein OsI_08451 [Oryza sativa Indica Group]
 gb|EEE57566.1| hypothetical protein OsJ_07912 [Oryza sativa Japonica Group]
Length=459

 Score =   244 bits (622),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EME MA+AIG+SVPVLRFLLCFAATIP  L+ R VPG A GRH+YA  TGAALSYLSFG 
Sbjct  4    EMEGMAAAIGVSVPVLRFLLCFAATIPTGLMWRAVPGAA-GRHLYAGLTGAALSYLSFGA  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            +SNL F+VPM  GY +ML+ R   G +TFL AFG+LI CH+YYMSGDAWKEGGIDATGAL
Sbjct  63   TSNLLFVVPMAFGYLAMLLCRRLAGLVTFLGAFGFLIACHMYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLKIISC ++Y DG+LKEE LR+AQKK RL   PSL+EYFGYCL
Sbjct  123  MVLTLKIISCAINYSDGMLKEEGLRDAQKKYRLAKLPSLIEYFGYCL  169



>gb|ABK24304.1| unknown [Picea sitchensis]
Length=465

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 138/166 (83%), Gaps = 3/166 (2%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFS  256
            ME +A+ +G+SVPVLRFL+CF ATIPVS   R +     GRH+Y+  TGA LSYLSFGFS
Sbjct  7    MERVAAIMGLSVPVLRFLMCFVATIPVSWACRFM---GRGRHLYSAFTGAFLSYLSFGFS  63

Query  257  SNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALM  436
            SNLHFLVP+ +GYGSML  R + G ITF LAFGYLIGCHVYYMSGDAWK+GGIDATGALM
Sbjct  64   SNLHFLVPISVGYGSMLFCRRHSGRITFFLAFGYLIGCHVYYMSGDAWKQGGIDATGALM  123

Query  437  VITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            V+TLK+IS  ++YQDGLLKE+ LRE+QKKNRLLN PS +EY GYCL
Sbjct  124  VLTLKVISSAVNYQDGLLKEDGLRESQKKNRLLNCPSFIEYLGYCL  169



>dbj|BAJ87726.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   239 bits (609),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EME MA+AIG+SVPVLRFLLCFAATIP  L+ R VP  ATGRH+YA  +GA LSYLSFG 
Sbjct  4    EMEPMAAAIGVSVPVLRFLLCFAATIPTGLLWRAVPS-ATGRHLYAGLSGAGLSYLSFGA  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            +SNL F+ PM LGY +ML+ R   G +TFL AFG+LI CHVYYMSGDAWKEGGIDATGAL
Sbjct  63   TSNLLFVGPMALGYLAMLLCRRRAGLVTFLGAFGFLIACHVYYMSGDAWKEGGIDATGAL  122

Query  434  MVITLKIISCVMSYQDGLLKEED-LREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC M+Y DGLLKEE+ LR+AQKK RL   PSL+EYFGYCL
Sbjct  123  MVLTLKVISCSMNYSDGLLKEEEGLRDAQKKYRLTTMPSLVEYFGYCL  170



>ref|XP_002892698.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68957.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=447

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 128/163 (79%), Gaps = 11/163 (7%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNL  265
            MA++IG+SV VLRFLLCF ATIPVS   R+VP    G+H+YA A+G  LSYLSFGFSSNL
Sbjct  1    MAASIGVSVAVLRFLLCFVATIPVSFAWRIVPS-RLGKHLYAAASGVLLSYLSFGFSSNL  59

Query  266  HFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVIT  445
            HFLVPM +GY SM I RP CG ITF L F YLIGCHV+YMSGDAWKEGGIDATGALMV+T
Sbjct  60   HFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDATGALMVLT  119

Query  446  LKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            LK+ISC M+Y DG+          +KNRL+  PSL+EYFGYCL
Sbjct  120  LKVISCAMNYNDGI----------RKNRLVQMPSLIEYFGYCL  152



>ref|XP_010494450.1| PREDICTED: lysophospholipid acyltransferase 1-like isoform X2 
[Camelina sativa]
Length=449

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 131/171 (77%), Gaps = 17/171 (10%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            M L +M SMA++IG+SV VLRFLLCF A IPVS   R+VP G  G+H+YA A+GA LSYL
Sbjct  1    MGLVDMSSMAASIGVSVAVLRFLLCFVAMIPVSFAWRIVPSG-IGKHLYAAASGALLSYL  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            SFGFSSNLHFLVPM +GY SM + RP                 HV+YMSGDAWKEGGID+
Sbjct  60   SFGFSSNLHFLVPMTIGYASMAVYRP----------------NHVFYMSGDAWKEGGIDS  103

Query  422  TGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TGALMV+TLK+ISC M+Y DG+LKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  104  TGALMVLTLKVISCAMNYNDGMLKEEGLREAQKKNRLVQMPSLIEYFGYCL  154



>ref|XP_007023107.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
2 [Theobroma cacao]
 gb|EOY25729.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
2 [Theobroma cacao]
Length=417

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +2

Query  218  TGAALSYLSFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDA  397
            TGA LSYLSFGFSSNLHFLVPM+LGY +M++ RP CG ITF L FGYLIGCHVYYMSGDA
Sbjct  7    TGALLSYLSFGFSSNLHFLVPMVLGYAAMVLYRPKCGVITFFLGFGYLIGCHVYYMSGDA  66

Query  398  WKEGGIDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            WKEGGIDATGALMV+TLK+ISC ++Y DGLLKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  67   WKEGGIDATGALMVLTLKVISCAINYNDGLLKEEGLREAQKKNRLIKLPSLIEYFGYCL  125



>ref|XP_001751825.1| predicted protein [Physcomitrella patens]
 gb|EDQ83260.1| predicted protein [Physcomitrella patens]
Length=469

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 124/167 (74%), Gaps = 2/167 (1%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFS  256
            M  +A A+GI +PVL FL+ F A+IPVS + R V  G T RH+YA A+GA LS+ +FG+ 
Sbjct  4    MRDVAGALGIGIPVLWFLMAFMASIPVSWLRRFV-RGVTARHLYAAASGALLSHCAFGYE  62

Query  257  SNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALM  436
            SNL+ +VP+ + YG+M+++R  CG I+ + AFG+LI CHV +MSGDAWK GGID TG++M
Sbjct  63   SNLYLMVPICVSYGAMVVSRRMCGVISAVFAFGFLIYCHVMFMSGDAWKSGGIDHTGSMM  122

Query  437  VITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGYCL  574
            V+TLK+ S   +YQDGL+K EE LREAQKK+RL   PS L Y GYC 
Sbjct  123  VLTLKVTSAAFNYQDGLIKDEESLREAQKKSRLGKLPSFLAYLGYCF  169



>ref|XP_001780460.1| predicted protein [Physcomitrella patens]
 gb|EDQ54750.1| predicted protein [Physcomitrella patens]
Length=468

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = +2

Query  122  RFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGS  301
            RFLLCF  +IP S + R +P G   R +YAVATG  LSY SFG  +NL F+ P+ +GYGS
Sbjct  19   RFLLCFVGSIPCSALARFMPSGRV-RSVYAVATGILLSYYSFGPEANLFFIPPIAVGYGS  77

Query  302  MLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQD  481
            ML+   +CGAITF++AF +L+ CHV  +SGDAWK GGID TGALMV+TLK+IS  MSYQD
Sbjct  78   MLLAPRHCGAITFVVAFAFLLTCHVMMLSGDAWKNGGIDTTGALMVLTLKVISASMSYQD  137

Query  482  GLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            GL+K+EDLR +QKKNRL   PSL++Y GYCL
Sbjct  138  GLVKKEDLRVSQKKNRLKELPSLVQYLGYCL  168



>ref|XP_001763507.1| predicted protein [Physcomitrella patens]
 gb|EDQ71696.1| predicted protein [Physcomitrella patens]
Length=466

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFS  256
            ME +A  +GI VPVL FL  F A+IPVS + R  PG A  RH+YA A+GA L++ +FG+ 
Sbjct  1    MEDVAGTLGIGVPVLWFLASFVASIPVSWLWRFAPGVA-ARHLYAAASGAFLAHCAFGYE  59

Query  257  SNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALM  436
            +NL+ ++P+ + YG+M++NR  CG ++ + AFG+L+ CHV +MSGDAWK GGID TG++M
Sbjct  60   ANLYMMIPICVSYGAMMLNRRMCGVVSAIFAFGFLVYCHVMFMSGDAWKSGGIDHTGSMM  119

Query  437  VITLKIISCVMSYQDGLLKEED-LREAQKKNRLLNRPSLLEYFGYC  571
            V+TLK+ S   +YQDGL+K+ D LREAQKK RL   PS + Y GYC
Sbjct  120  VLTLKVTSAAFNYQDGLIKDGDSLREAQKKYRLEKPPSFIAYLGYC  165



>gb|KFK23829.1| hypothetical protein AALP_AAs39384U000100 [Arabis alpina]
Length=129

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 91/129 (71%), Gaps = 8/129 (6%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            ME  ++ SMA++IG+SV VLRF LC  AT  +S   R VP    G+HIY+ A+GA LSY+
Sbjct  1    MESLDLSSMAASIGVSVAVLRFFLCLVATNLISFAWRFVPS-RLGKHIYSAASGALLSYV  59

Query  242  SFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGC-------HVYYMSGDAW  400
            SFGFSSNLHFLVPM +GY SM I RP  G ITF L F YL+GC       H +YMSGDAW
Sbjct  60   SFGFSSNLHFLVPMTIGYASMTIYRPLSGFITFFLGFAYLVGCKVVILCSHWFYMSGDAW  119

Query  401  KEGGIDATG  427
            K GGID+TG
Sbjct  120  KGGGIDSTG  128



>ref|XP_006665020.1| PREDICTED: lysophospholipid acyltransferase-like [Oryza brachyantha]
Length=388

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +2

Query  281  MLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVITLKIIS  460
            M  GY +ML+ R   G ITFL AFG+LI CHVYYMSGDAWKEGGIDATGALMV+TLKIIS
Sbjct  1    MAFGYLAMLLCRRLAGLITFLGAFGFLIACHVYYMSGDAWKEGGIDATGALMVLTLKIIS  60

Query  461  CVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            C ++Y DG+LKEE LR+AQKK RL   PSL+EYFGYCL
Sbjct  61   CAINYSDGMLKEEGLRDAQKKYRLTKLPSLIEYFGYCL  98



>ref|XP_005649636.1| membrane bound O-acyl transferase family protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25092.1| membrane bound O-acyl transferase family protein [Coccomyxa subellipsoidea 
C-169]
Length=499

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 2/161 (1%)
 Frame = +2

Query  92   SAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNLHF  271
             A GI V +LRF + F A++PV  + + +P    G+H +A+ TG AL Y  FG    LH 
Sbjct  21   EATGIHVSLLRFAISFVASVPVGALFKFIPT-VRGKHTFAIVTGFALLYYPFGIGV-LHL  78

Query  272  LVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVITLK  451
            LVP  L Y  ML  R     +++++ F YLI CHV   SG  WKEG +D TGA+MV+ LK
Sbjct  79   LVPTFLTYLVMLQVRENSATLSWVINFAYLIACHVAASSGSKWKEGQVDFTGAMMVLALK  138

Query  452  IISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            +IS  +SYQDGL K E+L   Q+ ++L   PS+LE+  +  
Sbjct  139  LISAGVSYQDGLRKSEELTPYQQAHKLTQMPSVLEWLSFTF  179



>gb|AFW72780.1| hypothetical protein ZEAMMB73_982934 [Zea mays]
Length=101

 Score =   124 bits (312),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 78/97 (80%), Gaps = 1/97 (1%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            EME+MA +IG+SVPVLRFLLCFAATIP  L+ R VPG A GRH+YA  TGA LSYLSFG 
Sbjct  4    EMEAMAGSIGVSVPVLRFLLCFAATIPTGLLWRAVPG-AMGRHLYAGLTGATLSYLSFGA  62

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLI  364
            +SNL F+VPM LGY +ML+ R + G ITFL AFG+LI
Sbjct  63   TSNLLFVVPMTLGYLAMLLFRRHAGLITFLGAFGFLI  99



>gb|KJB68448.1| hypothetical protein B456_010G246400 [Gossypium raimondii]
Length=359

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  383  MSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYF  562
            MSGDAWK+GGIDATGALMV+TLK+ISC M+Y DGLLKEEDLREAQKKNRL+  PSL+EYF
Sbjct  1    MSGDAWKQGGIDATGALMVLTLKVISCAMNYNDGLLKEEDLREAQKKNRLIKLPSLIEYF  60

Query  563  GYCL  574
            GYCL
Sbjct  61   GYCL  64



>ref|XP_005850438.1| hypothetical protein CHLNCDRAFT_20761 [Chlorella variabilis]
 gb|EFN58336.1| hypothetical protein CHLNCDRAFT_20761 [Chlorella variabilis]
Length=485

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 97/165 (59%), Gaps = 4/165 (2%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            E+ + ASA G+++   RF + F  ++ V    R+VP    GRH ++V TG  L Y  FG 
Sbjct  17   ELNACASA-GLTISQFRFTVAFLLSVLVGAFLRVVP--RRGRHAFSVVTGFLLIYYPFG-  72

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            +  +H  VP  L Y  M   R +CG + +L+AF YLI  HV   SG AWKEG +D TGA 
Sbjct  73   NGCIHAFVPSALVYFCMCRFRTHCGTLAWLIAFPYLILAHVMQASGVAWKEGHLDFTGAQ  132

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGY  568
            MV+TL++I+  +SYQDG    E L E   K +L   PSLLEYF Y
Sbjct  133  MVLTLRLIAVAVSYQDGTKPPERLSEYASKKQLRQLPSLLEYFSY  177



>gb|EMT11338.1| hypothetical protein F775_10017 [Aegilops tauschii]
Length=94

 Score =   114 bits (286),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNL  265
            MA+AIG+SVPVLRFLLCFAATIP  L+ R VP  ATGRH+YA  +GAALSYLSFG +SNL
Sbjct  1    MAAAIGVSVPVLRFLLCFAATIPTGLLWRAVPS-ATGRHLYAGLSGAALSYLSFGATSNL  59

Query  266  HFLVPMLLGYGSMLINRPYCGAITFLLAFGYLI  364
             F+ PM LGY SML+ R   G +TFL AFG+LI
Sbjct  60   LFVGPMALGYLSMLLCRRRAGLVTFLGAFGFLI  92



>ref|XP_006386564.1| hypothetical protein POPTR_0002s14510g [Populus trichocarpa]
 gb|ERP64361.1| hypothetical protein POPTR_0002s14510g [Populus trichocarpa]
Length=88

 Score =   109 bits (272),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFS  256
            MESMA+ IG+SVPVLRFLLCF   IPVS IHR V     G+H+YA  +GA LSYLS GFS
Sbjct  1    MESMAATIGVSVPVLRFLLCFVVMIPVSFIHRFVLS-PFGKHLYAALSGAFLSYLSSGFS  59

Query  257  SNLHFLVPMLLGYGSMLINRPYCGAITFL  343
            SNLHFLV MLLGY SM++   YC  + FL
Sbjct  60   SNLHFLVSMLLGYLSMVLFWSYCEILEFL  88



>ref|XP_002500677.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61935.1| predicted protein [Micromonas sp. RCC299]
Length=494

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 98/176 (56%), Gaps = 3/176 (2%)
 Frame = +2

Query  50   SSGDMELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAA  229
            S  + +   +E  A   GI    + F     A++P+  + +L+P   T +++Y+  +G  
Sbjct  9    SMAEWQRGVVEPFAQMSGIPPGTVLFTFALWASLPLGAVFQLIPW-PTLKNVYSFVSGVL  67

Query  230  LSYLSFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            LS  +FG SS     V  +  Y +M+I+R  CG + F  +F YLI  H +  SG+AWK G
Sbjct  68   LSLFAFG-SSTYTCAVLGIFSYAAMVIDRKRCGYVVFAGSFAYLIYFHAFSASGEAWKAG  126

Query  410  GIDATGALMVITLKIISCVMSYQD-GLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
             ID TG LMV+TLK+ +C ++YQD G + E +  + Q++  +   P ++EY G+ +
Sbjct  127  NIDITGLLMVLTLKVTACALNYQDSGTIAESERNDFQRRRAVETLPGVIEYAGWLM  182



>ref|XP_011398849.1| Membrane-bound O-acyltransferase domain-containing protein 2 
[Auxenochlorella protothecoides]
 gb|KFM25953.1| Membrane-bound O-acyltransferase domain-containing protein 2 
[Auxenochlorella protothecoides]
Length=456

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHV  376
            RH YAV TG  L Y  FG +  LH LVP  L Y +M     +CG + +L+AF YLI  HV
Sbjct  12   RHWYAVITGFLLIYYPFG-TGVLHALVPSSLIYLAMCAFPTHCGTLAWLIAFPYLIMNHV  70

Query  377  YYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNR-PSLL  553
            +  SG +WKEG +D TGA MV+TLK+++  + YQDG    +      +    L+R PSLL
Sbjct  71   FQASGLSWKEGQLDFTGAQMVLTLKLVAIGVCYQDGRTHADKHDRPYRAAMRLDRLPSLL  130

Query  554  EYFGYCL  574
            EY+ YC 
Sbjct  131  EYYSYCF  137



>gb|KDD76279.1| membrane-bound O-acyltransferase [Helicosporidium sp. ATCC 50920]
Length=522

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 88/172 (51%), Gaps = 13/172 (8%)
 Frame = +2

Query  89   ASAIGISVPVLRFLLCFAATIPVSLIHR----------LVPGGATGRHIYAVATGAALSY  238
            A ++G+S+   RF + F A++ V    R          L   GA   HI+   TG AL Y
Sbjct  19   AESVGLSLSQFRFAISFLASVLVGFGLRHIRSRQGAFALFWKGAVSEHIFL--TGFALIY  76

Query  239  LSFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGID  418
              FG +   H +    L Y  M   R +CG +T++  F YLI  HV   SG +W++G +D
Sbjct  77   YPFG-NGVFHAVFTSALTYAIMSRFRTHCGTLTWMTIFPYLIANHVLQASGLSWEKGELD  135

Query  419  ATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
             TGA MV+TL++I+  + YQDG    E LR     NRL   P  LE+F YC 
Sbjct  136  FTGAQMVLTLRLIAAAVCYQDGARSIEKLRPYAVGNRLEELPGALEFFAYCF  187



>ref|XP_002950776.1| hypothetical protein VOLCADRAFT_120919 [Volvox carteri f. nagariensis]
 gb|EFJ48091.1| hypothetical protein VOLCADRAFT_120919 [Volvox carteri f. nagariensis]
Length=625

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 92/165 (56%), Gaps = 5/165 (3%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC-FAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFS  256
            E ++SA G+S+   RF L  FA+ + V+ I  L     T RH+YA+ TG A+ Y  FG S
Sbjct  5    EQLSSATGLSLSQFRFTLALFASVLLVAGIRLL--RNTTLRHLYALVTGVAIIYYPFG-S  61

Query  257  SNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALM  436
              +H L   +  Y ++ +     GA+ +   F YLI  HV   SG++WK G +D TG  M
Sbjct  62   GIIHVLPMAVAAYLALHLAPRRAGAVAWCTVFPYLIYLHVVNASGESWKTGNMDFTGGAM  121

Query  437  VITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGY  568
            V  LK++S  +  QD   K +EDL   Q  ++L++ P+LLE+  Y
Sbjct  122  VAVLKLVSICVCRQDSFRKNKEDLSAYQAAHQLVSTPTLLEFLSY  166



>gb|KIY98914.1| hypothetical protein MNEG_9048 [Monoraphidium neglectum]
Length=529

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 91/167 (54%), Gaps = 4/167 (2%)
 Frame = +2

Query  74   EMESMASAI-GISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFG  250
            + E  A  +  +++  +RF + F A I   ++ R +    T R++Y++A G  L Y  FG
Sbjct  2    DWEVQAQQVTALTLDQVRFAVSFLACIVAGILIRGL-RSPTARNLYSLAVGLLLLYYPFG  60

Query  251  FSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGA  430
             S  +H ++   + Y  M +    CG   +L+ F YL+  H    SG +W +G +D TGA
Sbjct  61   -SGIVHVVLTSWVTYIVMWLIPKKCGTWAWLINFPYLLMLHTINASGVSWNKGVLDPTGA  119

Query  431  LMVITLKIISCVMSYQDGLLKE-EDLREAQKKNRLLNRPSLLEYFGY  568
             MV+TLK+IS  M  QD   K+ E + + QK + L   PSLLE+FGY
Sbjct  120  QMVLTLKLISTAMCLQDSKEKKLEAMSDYQKSHHLKKLPSLLEFFGY  166



>ref|XP_003084126.1| Predicted membrane protein (ISS) [Ostreococcus tauri]
 emb|CAL58542.1| Membrane bound O-acyl transferase, MBOAT [Ostreococcus tauri]
Length=475

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 74/129 (57%), Gaps = 6/129 (5%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNL--HFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGC  370
            R +YA+  G ALS +SFG  + +  HF     + Y  M + R  CG + FL +F YLI  
Sbjct  64   RSVYALLAGVALSLMSFGRQTVVCAHFGA---VAYAVMALARRRCGVVVFLGSFAYLIRF  120

Query  371  HVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDG-LLKEEDLREAQKKNRLLNRPS  547
            HV   + + WK G +D +G LMV+TLK+ +C M+YQDG  +   ++ E Q +  L   P+
Sbjct  121  HVMADTANTWKAGEVDISGLLMVMTLKVTACAMNYQDGATVAASEMTEHQHRRHLKTLPN  180

Query  548  LLEYFGYCL  574
            +L+Y  + +
Sbjct  181  VLDYASWLM  189



>ref|XP_004353223.1| hypothetical protein ACA1_073390 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR23695.1| hypothetical protein ACA1_073390 [Acanthamoeba castellanii str. 
Neff]
Length=481

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 88/169 (52%), Gaps = 8/169 (5%)
 Frame = +2

Query  83   SMASAIGISVPVLRFLLCFAATIPVSLIHRLV-PGGATGRHIYAVATGAALSYLSFGFSS  259
             +++  G     L++L C  A IP+S I RL+ PG    +H+ ++       + S G  S
Sbjct  10   DLSAQTGFPADQLKYLACLLAAIPLSYIFRLLGPGRENAKHVLSIVISIFFCHFSLGEYS  69

Query  260  NLHFLVPMLLGYGSMLINRPY--CGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
             +H LV  ++ Y ++L   P+       F+ A GYL   H+Y M  D W    +D +G  
Sbjct  70   WIHSLVTAMISY-TLLSILPHGIAHKAVFVFAMGYLSVGHIYRMYTD-WSGWTLDFSGPQ  127

Query  434  MVITLKIISCVMSYQDG---LLKEEDLREAQKKNRLLNRPSLLEYFGYC  571
            M++T+K+ +  M Y DG     ++E +   QK++R+   PS+LE+FGY 
Sbjct  128  MILTIKLTTIAMDYYDGNRSKAEKEVMSPFQKEHRIERLPSMLEFFGYV  176



>ref|XP_007023108.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
3 [Theobroma cacao]
 gb|EOY25730.1| MBOAT (membrane bound O-acyl transferase) family protein isoform 
3 [Theobroma cacao]
Length=339

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  434  MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            MV+TLK+ISC ++Y DGLLKEE LREAQKKNRL+  PSL+EYFGYCL
Sbjct  1    MVLTLKVISCAINYNDGLLKEEGLREAQKKNRLIKLPSLIEYFGYCL  47



>ref|XP_003064354.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51259.1| predicted protein [Micromonas pusilla CCMP1545]
Length=497

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 84/161 (52%), Gaps = 2/161 (1%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNL  265
            ++  +G+    + F L   A++P+    R +      +++Y +  G  LS  +FG S+  
Sbjct  13   LSGPLGVPPGTVLFTLALFASLPIGAGFRFIESPVL-KNLYGLLAGTFLSVFAFG-SATA  70

Query  266  HFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVIT  445
               V     Y +M  +R  CGAI  + AF YLI  H    SG+AWK G ID TG LMV+T
Sbjct  71   SVFVFGAASYAAMAAHRKRCGAIVGVGAFAYLIYFHATSSSGEAWKAGNIDITGLLMVLT  130

Query  446  LKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGY  568
            LK+ +C ++YQD     + L + QK+  +   P+ L+Y  +
Sbjct  131  LKVTACALNYQDAAAPLDRLSDFQKRRAVTTLPNPLDYAAW  171



>gb|EMT11337.1| hypothetical protein F775_10016 [Aegilops tauschii]
Length=374

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = +2

Query  422  TGALMVITLKIISCVMSYQDGLLKEED-LREAQKKNRLLNRPSLLEYFGYCL  574
            +GALMV+TLK+ISC M+Y DGLLKEE+ LR+AQKK RL   PSL+EYFGYCL
Sbjct  3    SGALMVLTLKVISCSMNYSDGLLKEEEGLRDAQKKYRLAKLPSLVEYFGYCL  54



>gb|EMS54344.1| hypothetical protein TRIUR3_33673 [Triticum urartu]
Length=386

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +2

Query  425  GALMVITLKIISCVMSYQDGLLKEED-LREAQKKNRLLNRPSLLEYFGYCL  574
            GALMV+TLK+ISC M+Y DGLLKEE+ LR+AQKK RL   PSL+EYFGYCL
Sbjct  16   GALMVLTLKVISCSMNYSDGLLKEEEGLRDAQKKYRLAKLPSLVEYFGYCL  66



>ref|XP_007511041.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66601.1| predicted protein [Bathycoccus prasinos]
Length=556

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  326  GAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLLKEEDL  505
            G +TFL +FGYL+  H    SG  WK G ID TG LMV+ LK  SC M+++D  +K+E+ 
Sbjct  152  GFVTFLWSFGYLVYIHYSADSGGEWKRGNIDITGLLMVLCLKTTSCAMNFEDYEIKDEEK  211

Query  506  REAQKKNRLLNRPSLLEYFGYCL  574
                K++ L   P  LEY  +C+
Sbjct  212  SSFMKEHELSEAPKTLEYLAWCM  234



>ref|XP_642430.1| membrane bound O-acyl transferase family protein [Dictyostelium 
discoideum AX4]
 gb|EAL68443.1| membrane bound O-acyl transferase family protein [Dictyostelium 
discoideum AX4]
Length=469

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 82/168 (49%), Gaps = 8/168 (5%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFS  256
            ++S   A G  V  ++ ++C   + P + I + +P  A  +HI  +  G      S G  
Sbjct  2    IDSYLEATGFPVDQVKTVICLLLSYPFAAILKKLPN-ANLKHIMNICLGVFYCTWSLGEW  60

Query  257  SNLHFLVPMLLGYGSMLI--NRPYCGAITFLLAFGYLIGCHVYYMSGD--AWKEGGIDAT  424
            S LH  +  L+ YG +++  NR     I F    GYL   H+Y +  D   W    +D T
Sbjct  61   SWLHSFISSLISYGLLMVIPNRYKPQLIVFAFCLGYLSISHIYRIYTDYMGWT---LDFT  117

Query  425  GALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGY  568
            G  M++TLK+ S   +  DG   + +L + QK+  +   P+LLE+FG+
Sbjct  118  GPQMILTLKLTSFAWNLHDGSKADNELSDDQKRRSIKKLPTLLEFFGF  165



>ref|XP_003283301.1| hypothetical protein DICPUDRAFT_52171 [Dictyostelium purpureum]
 gb|EGC40111.1| hypothetical protein DICPUDRAFT_52171 [Dictyostelium purpureum]
Length=470

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 83/169 (49%), Gaps = 7/169 (4%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            ++++   + G     ++ ++C  A+ P + + R +P  A  +H+  +  G A    S G 
Sbjct  3    DLDAYLGSFGFPADQIKTVICLLASYPFAYLLRKLPN-ANLKHMLNIFLGIAYCTWSLGQ  61

Query  254  SSNLHFLVPMLLGYGS-MLINRPYCGAITFLLAFGYLIGCHVYYMSGD--AWKEGGIDAT  424
             S +H  +  L+ YG  M++ R Y   + F    GYL   H+Y +  D   W    +D T
Sbjct  62   WSWVHSFISSLISYGLLMVLPRRYSQLVVFAFCLGYLSVSHIYRIWTDYMGWT---LDFT  118

Query  425  GALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYC  571
            G  M++TLK+ S   +  DG   + +L   QK+  +   P+LLE+FG+ 
Sbjct  119  GPQMILTLKLTSFAWNLSDGSKPDNELSSDQKRRSIKKLPNLLEFFGFV  167



>ref|XP_004356029.1| membrane bound O-acyl transferase family protein [Dictyostelium 
fasciculatum]
 gb|EGG17545.1| membrane bound O-acyl transferase family protein [Dictyostelium 
fasciculatum]
Length=520

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 84/171 (49%), Gaps = 7/171 (4%)
 Frame = +2

Query  68   LPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSF  247
            + +++S     G  +  ++FL+C  A+ P++ +++ +P  +T +HI +V  G    + S 
Sbjct  46   MSDIDSYLGGFGFPIDQVKFLICVVASYPLATLYKRLPN-STLKHIMSVFLGILYCHWSL  104

Query  248  GFSSNLHFLVPMLLGYGSM-LINRPYCGAITFLLAFGYLIGCHVYYMSGD--AWKEGGID  418
            G  S +H  +  L+ Y  +  + R     I F  +  YL   H Y M  D   WK   +D
Sbjct  105  GEWSWIHSFISSLVVYLIVSFLPRRNSHLIAFTFSMIYLSVSHWYRMYTDYMGWK---MD  161

Query  419  ATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYC  571
             T   MV+TLK+ S   +Y DG     +L   Q K  +   PSLLE+FG+ 
Sbjct  162  YTSPQMVLTLKLTSFAWNYYDGQRASNELTPDQAKKAIKTLPSLLEFFGFV  212



>ref|XP_001422221.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00538.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=402

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 1/96 (1%)
 Frame = +2

Query  290  GYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVM  469
             Y +ML  R  CG + F  +F YL+  H    +  AWK G +D +G LMV+ LK+ +C +
Sbjct  21   AYATMLATRRRCGYVVFAGSFAYLMRYHFVADTATAWKSGEVDISGLLMVLVLKVTACAL  80

Query  470  SYQD-GLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            +YQD    K  ++ E Q +  L   PS L+Y  + +
Sbjct  81   NYQDAATTKASEMSEFQNRRHLKRLPSALDYASWLM  116



>gb|EJY80788.1| Membrane bound O-acyl transferase family protein [Oxytricha trifallax]
Length=466

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 73/136 (54%), Gaps = 10/136 (7%)
 Frame = +2

Query  182  GGATGRHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSMLIN-RPYCGAITFLLAFGY  358
             G   RH+Y++ TGA L YL +     L F+  ++L Y +M ++ R Y     F ++F +
Sbjct  21   NGQNVRHVYSIVTGAFLQYLMYR-EGVLDFMKVIVLSYLAMRLSPRKYVHFSVFAVSFSF  79

Query  359  LIGCHVYYMSGD--AWKEGGIDATGALMVITLKIISCVMSYQDGLLK---EEDLREAQKK  523
            L   H+  M  D   W+   +D     MV+ LK+ S   +Y+DG+ +   EE+L   Q +
Sbjct  80   LSYLHIKRMIEDYGGWR---VDTATQCMVLVLKVTSVGFAYRDGMYQKGYEEELFPHQIQ  136

Query  524  NRLLNRPSLLEYFGYC  571
             R++  PSL+E+F YC
Sbjct  137  ARIMTIPSLMEFFSYC  152



>ref|XP_011499110.1| PREDICTED: lysophospholipid acyltransferase 5 [Ceratosolen solmsi 
marchali]
Length=476

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 87/174 (50%), Gaps = 9/174 (5%)
 Frame = +2

Query  47   VSSGDMELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGA--TGRHIYAVAT  220
            ++SG++ +  +ES+A  IG+    LR L+      P++L HR +  G   T +H Y +  
Sbjct  1    MASGELIVGGLESLADIIGVPTDALRLLISLFLGFPLALFHREILYGKNPTIQHYYFIIC  60

Query  221  GAALSYLSFGFSSNLHFLVPMLLGYG--SMLINRPYCGAITFLLAFGYLIGCHVYYMSGD  394
            G  L + ++ +S  LH +  +L+ YG  S+  NR      TF+   GYL+ C  Y  + D
Sbjct  61   GLVLGFWNYEWSI-LHSIFTLLITYGIFSVFGNRSSSVVATFIFNMGYLL-CGYYATATD  118

Query  395  AWKEGGIDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLE  556
             +    I  T    V+TL++I    +  D    E+ L + QK   L  +PSLLE
Sbjct  119  DYD---IKWTMPQCVLTLRLIGLSFNLADSTKPEDKLSDTQKTTMLHEKPSLLE  169



>gb|EJY79920.1| Membrane bound O-acyl transferase family protein [Oxytricha trifallax]
Length=454

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 73/136 (54%), Gaps = 10/136 (7%)
 Frame = +2

Query  182  GGATGRHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSMLIN-RPYCGAITFLLAFGY  358
             G   RH+Y++ TGA L YL +     L F+  ++L Y +M ++ R Y     F ++F +
Sbjct  21   NGQNVRHVYSIVTGAFLQYLMYR-EGVLDFMKVIVLSYLAMRLSPRKYVHFSVFAVSFSF  79

Query  359  LIGCHVYYMSGD--AWKEGGIDATGALMVITLKIISCVMSYQDGLLK---EEDLREAQKK  523
            L   H+  M  D   W+   +D     MV+ LK+ S   +Y+DG+ +   EE+L   Q +
Sbjct  80   LSYLHIKRMIEDYGGWR---VDTATQCMVLVLKVTSVGFAYRDGMYQKGYEEELFPHQIQ  136

Query  524  NRLLNRPSLLEYFGYC  571
             R++  PSL+E+F YC
Sbjct  137  ARIMTIPSLMEFFSYC  152



>ref|XP_007433489.1| PREDICTED: lysophospholipid acyltransferase 1 [Python bivittatus]
Length=496

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 83/172 (48%), Gaps = 7/172 (4%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLV--PGGATG--RHIYAVATGAALSYLS  244
            +  ++   GI +  + F+ C    +  +   RL   P  A+   RH +A   G   +   
Sbjct  17   LHPLSDQFGIPLDQVNFVACQLFALLAAFWFRLYLRPSQASSGVRHAFATILGIYFAVFC  76

Query  245  FGFSSNLHFLVPMLLGYGSM-LINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG+ S +H  + +++ YG M + + P     +FL+A GYL  CH+  +    +     D 
Sbjct  77   FGWYS-IHIFILVMISYGIMNMASIPNVHRYSFLVAMGYLTLCHISRIFIFQYGILTTDF  135

Query  422  TGALMVITLKIISCVMSYQDGL-LKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            +G LM++T KI +      DG+  K EDL   Q ++ +  RPSLLEY  Y L
Sbjct  136  SGPLMIVTQKITTLAFQIHDGIGKKAEDLTSEQNQHAIKRRPSLLEYLSYQL  187



>ref|XP_009526166.1| hypothetical protein PHYSODRAFT_314590 [Phytophthora sojae]
 gb|EGZ17108.1| hypothetical protein PHYSODRAFT_314590 [Phytophthora sojae]
Length=492

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 96/184 (52%), Gaps = 25/184 (14%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +++++++++G+    LR++LC  A  P++L+++L+P GA+ +H+  V  G A++    G 
Sbjct  29   QVDTLSASLGLGSDQLRYVLCLFAAYPLALVYKLLP-GASLKHVMDVVLGVAIAQFVLG-  86

Query  254  SSNLHFLVPMLLGYGSMLIN---RPYCGAITFLLAFGYLIGCHVYYMSGD--AWKEGGID  418
            S  +H  V   L Y  +L+      +  A+ FL    Y+   H+Y +  D   W    +D
Sbjct  87   SGWVHSFVSSFLTY--LLVKFGPSKHAPALVFLFNMLYMSASHIYRLYVDYMGWT---LD  141

Query  419  ATGALMVITLKIISCVMSYQDGLLK-------------EEDLREAQKKNRLLNRPSLLEY  559
             TG  M++ +K+ S   +Y DG++              ++ + E ++K  +   PSLLE+
Sbjct  142  FTGPQMLLVIKLTSFAYNYYDGVVDKTFEKKGAEMSPGKKKVFEGRQKLAIHEIPSLLEF  201

Query  560  FGYC  571
            FGY 
Sbjct  202  FGYV  205



>ref|XP_699295.3| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Danio 
rerio]
Length=502

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 83/174 (48%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLV--PGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + +  + F++C    +  +   RL   P   +   RH+ A   G  L+   
Sbjct  13   LQPISKMIDLPLDQVNFVVCQLFALVTAFWFRLYLHPSKTSPFIRHVVATLLGFYLALFC  72

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ + LHFLV   L YG M+         YC    F++  GYL  CHV  +    +   
Sbjct  73   FGWYA-LHFLVQSGLAYGVMIFTSVEHMHKYC----FVVTMGYLSFCHVTRVYVFDYGMY  127

Query  410  GIDATGALMVITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGY  568
              D TG +MVIT KI S      DGL+K EE L+ +QK   +   PSLLEY  Y
Sbjct  128  SADFTGPMMVITQKITSLAFEIHDGLVKREEHLKPSQKYLAVRKMPSLLEYLSY  181



>ref|XP_001360700.2| GA14938 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL25275.2| GA14938 [Drosophila pseudoobscura pseudoobscura]
Length=729

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 84/170 (49%), Gaps = 14/170 (8%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +A  +G+SV ++ FLLC     F A++  S++H   P   +   RH +A++ G A  Y  
Sbjct  22   LADMVGLSVDLVNFLLCQISALFLASLFRSMLH---PSKVSSKLRHTFALSIGLAFGYFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPY-CGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG    +H      + Y  +    P        L+A  YL+  H+     D +    +D 
Sbjct  79   FG-QQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYD-YGSYALDI  136

Query  422  TGALMVITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGY  568
            TG LM+IT K+ S   S  DG ++ EEDL +AQ+ + +   PS LEYF Y
Sbjct  137  TGPLMIITQKVTSLAFSIHDGFVREEEDLTKAQQYHAIRKMPSALEYFSY  186



>ref|XP_002016308.1| GL10561 [Drosophila persimilis]
 gb|EDW32198.1| GL10561 [Drosophila persimilis]
Length=728

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 84/170 (49%), Gaps = 14/170 (8%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +A  +G+SV ++ FLLC     F A++  S++H   P   +   RH +A++ G A  Y  
Sbjct  22   LADMVGLSVDLVNFLLCQISALFLASLFRSMLH---PSKVSSKLRHTFALSIGLAFGYFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPY-CGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG    +H      + Y  +    P        L+A  YL+  H+     D +    +D 
Sbjct  79   FG-QQAIHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYD-YGSYALDI  136

Query  422  TGALMVITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGY  568
            TG LM+IT K+ S   S  DG ++ EEDL +AQ+ + +   PS LEYF Y
Sbjct  137  TGPLMIITQKVTSLAFSIHDGFVREEEDLTKAQQYHAIRKMPSALEYFSY  186



>ref|XP_002059375.1| GJ17620 [Drosophila virilis]
 gb|EDW58787.1| GJ17620 [Drosophila virilis]
Length=744

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 86/170 (51%), Gaps = 14/170 (8%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGAT--GRHIYAVATGAALSYLS  244
            +A A+G+SV ++ FL+C     F A++  S +H   P   +   RH +A++ G A  Y  
Sbjct  22   LADAVGLSVDLVNFLVCQISALFLASLFRSWLH---PSKVSYEVRHAFAMSLGLAFGYFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLL-AFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG  + +H      L Y  +    P     + LL A GYL+  H+     D +    +D 
Sbjct  79   FGQQA-IHIAGLPALCYIVIRTQDPRIVQRSVLLVAMGYLLCVHLMRQIYD-YGSYALDI  136

Query  422  TGALMVITLKIISCVMSYQDGLLKE-EDLREAQKKNRLLNRPSLLEYFGY  568
            TG LM+IT K+ S   S  DG +++ EDL  AQ+ + +   PS LEYF Y
Sbjct  137  TGPLMIITQKVTSLAFSIHDGFVRQDEDLTRAQQYHAIRKMPSALEYFSY  186



>ref|XP_001692975.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03544.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=368

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 89/176 (51%), Gaps = 21/176 (12%)
 Frame = +2

Query  47   VSSGDMELPEM---ESMASAIGISVPVLRFLLC-FAATIPVSLIHRLVPGGATGRHIYAV  214
            +S+    +P M   ES +  +G+S+   RF L  FA+ I V+ + RL     T RH+YAV
Sbjct  48   LSANHNLIPHMAWEESASGTLGLSLSQFRFTLALFASVILVAGV-RLF-RNPTLRHLYAV  105

Query  215  ATGAALSYLSFGFSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGD  394
            ATG  + Y  FG SS +H L   +  Y +ML+     G I +   F YLI  HV      
Sbjct  106  ATGILIIYYPFG-SSIMHVLPMAVAAYLAMLLAPRRAGLIAWCTVFPYLIYLHV------  158

Query  395  AWKEGGIDATGALMVITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEY  559
                  ++A+GA MV  LK+IS  +   D   K +EDL   Q  ++L   PS LE+
Sbjct  159  ------VNASGA-MVAVLKLISICVCRADSFRKNKEDLSPYQSAHQLTRTPSPLEF  207



>ref|XP_011058665.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2 [Acromyrmex echinatior]
Length=501

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 80/166 (48%), Gaps = 7/166 (4%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-FAATIPVSLIHR-LVPGGAT-GRHIYAVATGAALSYLSFGFS  256
            +A  +G+ +  + F+L  F A I  +L+   L P   T  +H+Y +  G AL Y  FG  
Sbjct  18   LADLVGLPIDQVNFVLTQFTALILATLLRSSLSPIATTPAKHVYGLTIGLALGYFCFGRQ  77

Query  257  SNLHFLVPMLLGYGSMLINRPY-CGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGAL  433
            + +H  +   L Y +M    P     +   +A  YL   H +    D +    +D TG L
Sbjct  78   A-IHLAILPALCYIAMRTQNPRNMQRVVLAIALIYLSCIHFHRQIYD-YGSYTLDITGPL  135

Query  434  MVITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGY  568
            MVIT K+ S   S  DGL + EEDL   Q+   +   P++LEYF Y
Sbjct  136  MVITQKVTSLAFSIHDGLTRCEEDLTPMQRHQAVQKMPTILEYFSY  181



>ref|XP_007252280.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Astyanax mexicanus]
Length=475

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 83/170 (49%), Gaps = 7/170 (4%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLV--PGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + +  + F++C    +  +   RL   P   +   RH+ A   G  L+   
Sbjct  14   LQPISEMIDLPLDQVNFVVCQLFVLFTACWFRLYLHPSKTSPFIRHVVATLLGFYLALFC  73

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG+ + LHFLV   L YG M+     +    +F++A GYL+ C +  +    +     D 
Sbjct  74   FGWYA-LHFLVQSGLTYGIMIFTGLEHMHRYSFVVALGYLMLCQITRVYVFDYGMYSADF  132

Query  422  TGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
            TG +MVIT KI S      DGL  KEE L+ +QK   +   PSLLEY  Y
Sbjct  133  TGPMMVITQKITSLAFEIHDGLTKKEEHLKPSQKYLAVRKMPSLLEYLSY  182



>gb|EJY76231.1| Membrane bound O-acyl transferase family protein [Oxytricha trifallax]
Length=475

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 73/155 (47%), Gaps = 11/155 (7%)
 Frame = +2

Query  119  LRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYG  298
            +R +LC     P+  I  L   G   RH++A  TG  L    +     +H L+  L+ Y 
Sbjct  25   IRIMLCMFMVYPLGWIMNLFLNGRVTRHLFATITGFLLQIYMYK-DQVIHPLLMTLITY-  82

Query  299  SMLIN---RPYCGAITFLLAFGYLIGCHVYYMSGD--AWKEGGIDATGALMVITLKIISC  463
             +L+N   R  C    F+   GYL G H+Y M  +   W    +D T   M++T K+ S 
Sbjct  83   -ILLNVLPRNQCHKAVFVFTMGYLSGSHIYRMLTNFGGWD---LDITTYTMILTAKLSSL  138

Query  464  VMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGY  568
               Y+DG  KEE+L   QK+ ++   P+ LE   Y
Sbjct  139  GFCYKDGGEKEENLIPDQKERKVEKMPTPLEMLSY  173



>ref|XP_002063522.1| GK21363 [Drosophila willistoni]
 gb|EDW74508.1| GK21363 [Drosophila willistoni]
Length=715

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 84/170 (49%), Gaps = 14/170 (8%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +A  +G+SV ++ FL+C     F A++  SL+H   P   +   RH++A++ G    Y  
Sbjct  22   LADMVGLSVDLVNFLICQISALFLASLFRSLLH---PSKVSSEVRHVFALSLGLTFGYFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPY-CGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG    +H      + Y  +    P        L+A  YL+  H+     D +    +D 
Sbjct  79   FG-QQAIHIAGLPAICYIVIRTQDPRIVQRSVMLVAMSYLLCIHLMRQLYD-YGSYALDI  136

Query  422  TGALMVITLKIISCVMSYQDGLLKE-EDLREAQKKNRLLNRPSLLEYFGY  568
            TG LM+IT K+ S   S  DG +++ ED+ +AQ+ + +   PS LEYF Y
Sbjct  137  TGPLMIITQKVTSLAFSIHDGFVRQDEDMTKAQQYHAIRKMPSALEYFSY  186



>emb|CDJ83922.1| Membrane bound O-acyl transferase domain containing protein [Haemonchus 
contortus]
Length=320

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 82/175 (47%), Gaps = 15/175 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHR--LVPGGAT--GRHIYAVATGAALSYLS  244
            ++ +A+   + V  + F++C  +++P++ + +    PG  T   R I+ +  G    +  
Sbjct  14   LQPIATYFEVQVDRINFVICMFSSLPLACVFKRFCAPGVVTRQTRTIFPLLIGIVFCFFC  73

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPY-CGAITFLLAFGYLIGCHVYYMSGDAW---KEGG  412
            FG +S  H L   LL Y  M  + P     + F  + GYL+  H +      W       
Sbjct  74   FGRASK-HLLANALLNYAIMRWSPPKLVHKLVFGFSMGYLLFIHFF-----RWLVLTRYY  127

Query  413  IDATGALMVITLKIISCVMSYQDGLLKE-EDLREAQKKNRLLNRPSLLEYFGYCL  574
            +D TG +MV   KI +   S  DG +K+ E+L E QK+  +   PSL+EY  Y  
Sbjct  128  LDITGPMMVAVQKITTLAFSLHDGKVKKKEELSEVQKREAITEVPSLVEYMSYVF  182



>dbj|GAM22032.1| hypothetical protein SAMD00019534_052070 [Acytostelium subglobosum 
LB1]
Length=462

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 77/162 (48%), Gaps = 11/162 (7%)
 Frame = +2

Query  101  GISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNLHFLVP  280
            G  V  ++F +C  A+ P ++I + +P  A  +HI ++  G      S G  S +H L+ 
Sbjct  11   GFPVDQIKFFICMMASYPFAMILKRLPN-ANMKHILSIVLGITYCSFSLGAYSWVHSLIS  69

Query  281  MLLGYGSMLIN---RPYCGAITFLLAFGYLIGCHVYYMSGD--AWKEGGIDATGALMVIT  445
              + Y  +L+N   R       F+ A GY+   H Y M  D   W    +D T   MV+T
Sbjct  70   STVVY--ILVNVLPRRVAHIYVFVFAMGYMSASHWYRMYVDYMGWT---MDFTAPQMVLT  124

Query  446  LKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYC  571
            LK+ S   +  DG     +L   +KK  +   P+LLE++G+ 
Sbjct  125  LKLTSFAWNLYDGSRPVAELSADEKKRSIKKIPTLLEFYGFV  166



>ref|XP_004868363.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Heterocephalus 
glaber]
Length=520

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 86/175 (49%), Gaps = 17/175 (10%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGATGRHIYAVATGAALSYL  241
            ++ +++A+ + +  + F++C     FAA    + +H      +  RH+ A   G  L++ 
Sbjct  12   LQPLSNAVQLPIDQVNFVVCQLFALFAAIWFRTYLHS-SKTSSFIRHVVATLLGLYLAFF  70

Query  242  SFGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKE  406
             FG+ + LHFLV   + Y  M++        YC    F+ A GYL  C +  +    + +
Sbjct  71   CFGWYA-LHFLVQSGISYCIMIVTGVESMHKYC----FVFALGYLTVCQITRVYIFDYGQ  125

Query  407  GGIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
               D +G +M+IT KI S      DG+  K+EDL  +Q+   +   PSLLEY  Y
Sbjct  126  YSADFSGPMMIITQKITSLACEIHDGMFRKDEDLTPSQRGLAVRRMPSLLEYVSY  180



>ref|XP_004644660.1| PREDICTED: lysophospholipid acyltransferase 2 [Octodon degus]
Length=520

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 84/174 (48%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ +++A+ + +  + F++C  FA    V     L     +   RH+ A   G  L++  
Sbjct  12   LQPLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLAFFC  71

Query  245  FGFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + + 
Sbjct  72   FGWYA-LHFLVQSGVSYCIMIIIGVESMHKYC----FVFALGYLTVCQVTRVYIFDYGQY  126

Query  410  GIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
              D +G +M+IT KI S      DGL  K+EDL  +Q+   +   PSLLEY  Y
Sbjct  127  SADFSGPMMIITQKITSLAYEIHDGLFRKDEDLTPSQRGLAVRRMPSLLEYVSY  180



>ref|XP_001959520.1| GF12916 [Drosophila ananassae]
 gb|EDV36342.1| GF12916 [Drosophila ananassae]
Length=745

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 85/170 (50%), Gaps = 14/170 (8%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +A  +G+SV ++ FL+C     F A++  S++H   P   +   RH +A++ G A  Y  
Sbjct  22   LADIVGLSVDLVNFLICQISALFLASLFRSVLH---PSKVSSKLRHTFALSIGLAFGYFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPY-CGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG  + +H      + Y  +    P        L+A  YL+  H+     D +    +D 
Sbjct  79   FGPQA-IHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCIHLMRQLYD-YGSYALDI  136

Query  422  TGALMVITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGY  568
            TG LM+IT K+ S   S  DG ++ EE+L +AQK + +   P+ LEYF Y
Sbjct  137  TGPLMIITQKVTSLAFSIHDGFVRPEEELTKAQKYHAIRKMPTALEYFSY  186



>ref|XP_002670587.1| predicted protein [Naegleria gruberi]
 gb|EFC37843.1| predicted protein [Naegleria gruberi]
Length=508

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 84/185 (45%), Gaps = 26/185 (14%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLL-CFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            ME  AS +G+ V    +++      IP++ + R +P G   R ++ +  G    + +FG 
Sbjct  12   MEKAASLVGLDVSACTYMMFLIVVNIPMAFLMRSLPFGM-ARILFGLIVGLFYCFYTFG-  69

Query  254  SSNLHFLVPMLLGYGSMLIN-------RPYCGA---------ITFLLAFGYLIGCHVYYM  385
            S+ LH +   L+ Y  + +        R Y              F  +FGYL+ CH   M
Sbjct  70   SATLHSVAIPLIVYVWLFLTVGMSSSVREYLKKSRLGLIVPLFAFFFSFGYLLICHYNRM  129

Query  386  SGD--AWKEGGIDATGALMVITLKIISCVMSYQDGLLKEED--LREAQKKNRLLNRPSLL  553
              D   WK   +D TG  M+ TLK IS   +  DG++ + D  +    K NR+   P LL
Sbjct  130  ITDYLGWK---LDFTGLQMLATLKTISVAWNIYDGMIAQSDEKMNYYHKVNRMERMPGLL  186

Query  554  EYFGY  568
            EYF Y
Sbjct  187  EYFSY  191



>ref|XP_004082306.1| PREDICTED: lysophospholipid acyltransferase 2 [Oryzias latipes]
Length=504

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 81/174 (47%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + +  + F+ C  FA  + +     L P   +   RH+ A   G  L+   
Sbjct  15   LQPLSEIINLPLDQVNFVACQLFALLMAMWFRIYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ S LHFLV   L YG M+         YC    F++  GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYGVMIFAGLEHMHKYC----FIVTLGYLIVCQITRVYVFDYGMY  129

Query  410  GIDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNR-PSLLEYFGY  568
              D TG +MVIT KI S      DGL K+E      +K   ++R PSLLEY  Y
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLAKKESQLTPNQKYLAISRMPSLLEYLSY  183



>ref|XP_001381215.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Monodelphis 
domestica]
Length=521

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 83/174 (48%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ +++A+ + +  + F++C  FA    V     L     +   RH+ A   G  LS   
Sbjct  13   LQPLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLHSSKTSSFIRHVVATLLGLYLSLFC  72

Query  245  FGFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ + LHFLV   + Y  M+I        YC    F+ A GYL  C +  +    + + 
Sbjct  73   FGWYA-LHFLVQSGISYSIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQY  127

Query  410  GIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
              D +G +M+IT KI S      DG+  KEE+L  +Q+   +   PSLLEY  Y
Sbjct  128  SADFSGPMMIITQKITSLAYEIHDGMFRKEEELTPSQRGLAVRRMPSLLEYLSY  181



>ref|XP_011332944.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2 isoform X1 [Cerapachys biroi]
 gb|EZA58101.1| Membrane-bound O-acyltransferase domain-containing protein [Cerapachys 
biroi]
Length=499

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 77/169 (46%), Gaps = 8/169 (5%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-FAATIPVSLIH---RLVPGGATGRHIYAVATGAALSYLSFGF  253
            +A  +G+ +  L F+L  F A I   L+    R +      RH+Y +  G AL Y  FG 
Sbjct  19   LADLVGLPIDQLNFVLTQFTALILAGLLRTSLRSIIATPAARHVYGLTIGLALGYFCFG-  77

Query  254  SSNLHFLVPMLLGYGSMLINRPYC-GAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGA  430
               +H      L Y +M    P     + F++A  YL   H +    D +    +D TG 
Sbjct  78   RQAIHLAGLPALCYVAMRTQSPRSMQRVVFVIALIYLSFIHFHRQIYD-YGSYTLDITGP  136

Query  431  LMVITLKIISCVMSYQDGLLKE-EDLREAQKKNRLLNRPSLLEYFGYCL  574
            LMVIT K+ S   S  DGL +  E+L   Q+   +   P++LEYF Y  
Sbjct  137  LMVITQKVTSLAYSVHDGLTRRAEELTPMQRHQAVQKMPTILEYFSYIF  185



>ref|XP_002089885.1| GE21852 [Drosophila yakuba]
 gb|EDW89597.1| GE21852 [Drosophila yakuba]
Length=721

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 85/170 (50%), Gaps = 14/170 (8%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +A  +G+SV ++ FL+C     F A++  S++H   P   +   RH +A++ G A  Y  
Sbjct  22   LADMVGLSVDLVNFLICQISALFLASLFRSMLH---PSKVSSKLRHTFALSIGLAFGYFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPY-CGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG  + +H      + Y  +    P        L+A  YL+  H+     D +    +D 
Sbjct  79   FGQQA-IHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYD-YGSYALDI  136

Query  422  TGALMVITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGY  568
            TG LM+IT K+ S   S  DG ++ +E+L +AQ+ + +   PS LEYF Y
Sbjct  137  TGPLMIITQKVTSLAFSIHDGFVRGDEELTKAQQYHAIRKMPSALEYFSY  186



>ref|NP_610546.1| oysgedart, isoform A [Drosophila melanogaster]
 ref|NP_001286265.1| oysgedart, isoform B [Drosophila melanogaster]
 ref|NP_001286267.1| oysgedart, isoform E [Drosophila melanogaster]
 gb|AAF58858.1| oysgedart, isoform A [Drosophila melanogaster]
 gb|AAR99097.1| RE60277p [Drosophila melanogaster]
 gb|AHN56063.1| oysgedart, isoform B [Drosophila melanogaster]
 gb|AHN56065.1| oysgedart, isoform E [Drosophila melanogaster]
Length=722

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 85/170 (50%), Gaps = 14/170 (8%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +A  +G+SV ++ FL+C     F A++  S++H   P   +   RH +A++ G A  Y  
Sbjct  22   LADMVGLSVDLVNFLICQISALFLASLFRSMLH---PSKVSSKLRHTFALSIGLAFGYFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPY-CGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG  + +H      + Y  +    P        L+A  YL+  H+     D +    +D 
Sbjct  79   FGQQA-IHIAGLPAICYIVIRTQDPRIVQRAVLLVAMSYLLCVHLMRQLYD-YGSYALDI  136

Query  422  TGALMVITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGY  568
            TG LM+IT K+ S   S  DG ++ +E+L +AQ+ + +   PS LEYF Y
Sbjct  137  TGPLMIITQKVTSLAFSIHDGFVRGDEELTKAQQYHAIRKMPSALEYFSY  186



>gb|EFA78146.1| membrane bound O-acyl transferase family protein [Polysphondylium 
pallidum PN500]
Length=462

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 78/159 (49%), Gaps = 7/159 (4%)
 Frame = +2

Query  101  GISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNLHFLVP  280
            G  +  ++F+LC   + P++++ R +P  +T +H+ ++A G    + S G  S +H    
Sbjct  11   GFPLDQVKFVLCMLFSYPMAMVLRSLPNAST-KHMMSIALGIFYCHFSLGAFSWIHSFAS  69

Query  281  MLLGYGSM-LINRPYCGAITFLLAFGYLIGCHVYYMSGD--AWKEGGIDATGALMVITLK  451
             L+ Y  + ++ R       F+ A  YL   H Y M  D   W    +D T   MV+TLK
Sbjct  70   SLVCYIMVSVLPRRVSHIWVFVFAMAYLSISHWYRMYTDYMGWT---MDFTSPQMVLTLK  126

Query  452  IISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGY  568
            + S   +  DG     +L   Q++  +   PSLLE+FG+
Sbjct  127  LTSFAWNLYDGSRPATELTSDQQRRSIKKVPSLLEFFGF  165



>ref|XP_003962745.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Takifugu rubripes]
Length=479

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 80/174 (46%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + +  + F+ C  FA  + V     L P   +   RH+ A   G+ L+   
Sbjct  15   LQPISEIINLPLDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGSYLALFC  74

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ S LHFLV   L Y  M+ +       YC    F++  GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFSGLENMHKYC----FIVTLGYLILCQITRVYVFDYGMY  129

Query  410  GIDATGALMVITLKIISCVMSYQDGLLKEE-DLREAQKKNRLLNRPSLLEYFGY  568
              D TG +MVIT KI S      DGL K +  L   QK   +   PSLLEY  Y
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLTKRDAQLNPNQKYLAIRRMPSLLEYLSY  183



>ref|XP_005696929.1| PREDICTED: lysophospholipid acyltransferase 1 [Capra hircus]
Length=515

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 89/201 (44%), Gaps = 18/201 (9%)
 Frame = +2

Query  8    DPGRDNQ*SLNGEVSSGDMELPEMESMASAIGISVPV-LRFLLCFAATIPVSLIHRLV--  178
            +P   +Q      +  G  E P     A  + +++PV + F+ C    +  +   RL   
Sbjct  16   NPDEFHQQPQFFNLQEGGKEDPHTGQTAKVLTLTLPVQVNFVACQLFALCAAFWFRLYLS  75

Query  179  PGGATG--RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSML------INRPYCGAI  334
            PG  +   RH +A   G       FG+ S +H  V +L+ YG M+      I+R      
Sbjct  76   PGKTSPDVRHAFATIFGVYFVIFCFGWYS-VHLFVLVLMCYGIMVTASISNIHR-----Y  129

Query  335  TFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGL-LKEEDLRE  511
            +F +A GYL  CH+  +    +     D +G LM++T KI +      DGL  + EDL  
Sbjct  130  SFFVAMGYLTVCHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSS  189

Query  512  AQKKNRLLNRPSLLEYFGYCL  574
             Q +  +  +PS LEY  Y L
Sbjct  190  EQHRLAVKAKPSFLEYVSYLL  210



>ref|XP_005101404.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Aplysia californica]
Length=544

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 78/172 (45%), Gaps = 12/172 (7%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC----FAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLS  244
            +  +A  IG+ +  + FL+C         P   +  +   GA  RHI     G  L+   
Sbjct  14   LTPVADTIGLPIDQINFLVCQLVALGFAFPFRSLFSVEKVGAQTRHIIEAVVGVLLTLFC  73

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG--I  415
            FG+    H LV  L+ Y  M      +  A  F+ +  YL  CH+Y    D    GG  +
Sbjct  74   FGYQI-WHLLVQSLVSYAFMAYGGSRFSHAFVFVFSMLYLSVCHIYRQVYDY---GGYTL  129

Query  416  DATGALMVITLKIISCVMSYQDGLLKEE-DLREAQKKNRLLNRPSLLEYFGY  568
            D TG LM+ T K+ S   +  DG  KEE  L + QK++ +   P++++Y  +
Sbjct  130  DITGPLMIQTQKLTSLAFALHDGRYKEEAKLSQDQKQHAVRKLPNVVQYLSF  181



>ref|XP_002590246.1| hypothetical protein BRAFLDRAFT_254328 [Branchiostoma floridae]
 gb|EEN46257.1| hypothetical protein BRAFLDRAFT_254328, partial [Branchiostoma 
floridae]
Length=420

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 78/154 (51%), Gaps = 8/154 (5%)
 Frame = +2

Query  125  FLLCFAATIPVSLIHRLVPG----GATGRHIYAVATGAALSYLSFGFSSNLHFLVPMLLG  292
            F+ C    + +SL+ R V      G T RH++A A G  ++Y    +   +HFL+   + 
Sbjct  4    FVACQVVALLLSLVFRYVLSAGRVGVTARHVFAAAVGMYMAYFCHRWQV-IHFLIQSTVC  62

Query  293  YGSMLINRP-YCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVM  469
            Y  +L ++P       FL +  YL  CH+Y    + +    +D TG LM++T K+ S   
Sbjct  63   YIIILSSKPSNMHKYVFLFSMLYLTLCHIYRTYYN-FGTYTLDFTGPLMIMTQKVTSLTC  121

Query  470  SYQDGLLKEEDLREAQKKNRLLNR-PSLLEYFGY  568
            +  DGL +++    A ++ + + R PS LEY+ Y
Sbjct  122  ALHDGLYRDDSSLSADQRKQAVRRIPSPLEYYCY  155



>ref|XP_008306774.1| PREDICTED: lysophospholipid acyltransferase 2 [Cynoglossus semilaevis]
Length=509

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 79/174 (45%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + +  + F+ C  FA  + V     L P   +   RH+ A   G  L+   
Sbjct  15   LQPISDIINLPLDQVNFVACQLFALLMAVWFRLYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ S LHFLV   L YG M+         YC    F++  GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYGVMVFAGLERMHRYC----FIVTMGYLIICQITRVYVFDYGMY  129

Query  410  GIDATGALMVITLKIISCVMSYQDGLLKEE-DLREAQKKNRLLNRPSLLEYFGY  568
              D TG +MVIT KI S      DGL K E  L   QK   +   PSLLEY  Y
Sbjct  130  SADFTGPMMVITQKITSMAFELHDGLTKREGQLTPNQKYLAISRMPSLLEYLSY  183



>ref|XP_001986306.1| GH21285 [Drosophila grimshawi]
 gb|EDW01173.1| GH21285 [Drosophila grimshawi]
Length=747

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 86/170 (51%), Gaps = 14/170 (8%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGAT--GRHIYAVATGAALSYLS  244
            +A  +G+SV ++ FL+C     F A++  S +H   P   +   RH++A++ G A  Y  
Sbjct  22   LADMVGLSVDLVNFLICQILALFLASLFRSWLH---PSRVSYEVRHVFALSLGLAFGYFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPY-CGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG  + +H      + +  +    P        L+A GYL+  H+     D +    +D 
Sbjct  79   FGQQA-IHIAGLPAICFIVIRTQDPRIVQRSVMLVAMGYLLCVHLMRQIYD-YGSYALDI  136

Query  422  TGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
            TG LM+IT K+ S   S  DG + K+ED+ +AQ+ + +   PS LE+F Y
Sbjct  137  TGPLMIITQKVTSLAFSIHDGFVRKDEDMTKAQQYHAIRKMPSALEFFSY  186



>ref|XP_003757931.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform 1 [Sarcophilus harrisii]
Length=521

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 84/174 (48%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATG----RHIYAVATGAALSYLS  244
            ++ +++A+ + +  + F++C    +  ++  R+    +      RH+ A   G  LS   
Sbjct  13   LQPLSNAVQLPIDQVNFVVCQLFALLAAVWFRIYLHSSKTSSFIRHVVATLLGLYLSLFC  72

Query  245  FGFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ + LHFLV   + Y  M+I        YC    F+ A GYL  C +  +    + + 
Sbjct  73   FGWYA-LHFLVQSGISYYIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQY  127

Query  410  GIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
              D +G +M+IT KI S      DG+  KEE+L  +Q+   +   PSLLEY  Y
Sbjct  128  SADFSGPMMIITQKITSLAYEIHDGMFRKEEELTPSQRGLAVRRMPSLLEYLSY  181



>ref|XP_004384055.1| PREDICTED: lysophospholipid acyltransferase 1 [Trichechus manatus 
latirostris]
Length=494

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 80/172 (47%), Gaps = 7/172 (4%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLV--PGGATG--RHIYAVATGAALSYLS  244
            +  ++  +GI +  + F+ C    +  +   RL   PG  +   RH +A   G       
Sbjct  19   LHPLSELLGIPLDQVNFVACQLFALFAAFWFRLYLSPGKTSPDVRHAFATIFGIYFVIFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLI-NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG+ S +H  V +L+ YG M+  + P     TF +A GYL  CH+  +    +     D 
Sbjct  79   FGWYS-IHLFVLVLICYGIMVTASIPNIHRYTFFVAMGYLTICHISRIYIFHYGILATDF  137

Query  422  TGALMVITLKIISCVMSYQDGLLKE-EDLREAQKKNRLLNRPSLLEYFGYCL  574
            +G LM++T KI +      DGL K  EDL   Q +  +  +PS LEY  Y L
Sbjct  138  SGPLMIVTQKITALAFQIHDGLGKRPEDLSAEQHRLAVKVKPSFLEYLSYLL  189



>ref|XP_005177952.1| PREDICTED: lysophospholipid acyltransferase 1 [Musca domestica]
 ref|XP_005177953.1| PREDICTED: lysophospholipid acyltransferase 1 [Musca domestica]
 ref|XP_005177954.1| PREDICTED: lysophospholipid acyltransferase 1 [Musca domestica]
 ref|XP_011290228.1| PREDICTED: lysophospholipid acyltransferase 1 [Musca domestica]
Length=666

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 86/171 (50%), Gaps = 12/171 (7%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLCFAATIPVSLIHRLV--PGGATG--RHIYAVATGAALSYLSFGF  253
            +A   G+SV ++ FL+C  + I ++ ++R V  P   +   RHI A++ G    Y  FG 
Sbjct  18   LADLSGLSVDLVNFLICQISAIFLASLYRSVLHPSKVSSNVRHIVALSIGLVFGYFCFGP  77

Query  254  SSNLHFLVPMLLGYGSMLINRPYCGAITFLL-AFGYLIGCHVYYMSGDAWKEGG--IDAT  424
             + +H        Y ++    P     T ++ A  YL+  HV     D   +G   +D T
Sbjct  78   QA-IHIAGLPSACYVAIRTQSPKVVQRTVMVVAMAYLLTIHVLRQIYD---DGSCSLDIT  133

Query  425  GALMVITLKIISCVMSYQDGLLKE-EDLREAQKKNRLLNRPSLLEYFGYCL  574
            G LM+IT K+ S   S  DG +++ +DL +AQ+ + +   PS LEYF Y L
Sbjct  134  GPLMIITQKVTSLAFSIHDGFVRQTKDLTKAQQYHAVNKLPSALEYFSYVL  184



>ref|XP_005801344.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Xiphophorus maculatus]
Length=505

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 80/175 (46%), Gaps = 16/175 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + V  + F+ C  FA  + V     L P   +   RH+ A   G  L+   
Sbjct  15   LQPISDIINLPVDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGLYLALFC  74

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ S +HFLV   L YG M+         YC    F++  GYLI C +  +    +   
Sbjct  75   FGWYS-VHFLVQSGLSYGVMIFASLEHMHKYC----FIVTLGYLILCQITRVYVFDYGMY  129

Query  410  GIDATGALMVITLKIISCVMSYQDGLLK--EEDLREAQKKNRLLNRPSLLEYFGY  568
              D TG +MVIT KI S      DGL K  E  L  +QK   +   PSLLEY  Y
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLSKHREGQLTPSQKYLAISRMPSLLEYLSY  184



>ref|XP_004521129.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform X1 [Ceratitis capitata]
 ref|XP_004521130.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform X2 [Ceratitis capitata]
 ref|XP_004521131.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform X3 [Ceratitis capitata]
 ref|XP_004521132.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform X4 [Ceratitis capitata]
Length=715

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 84/170 (49%), Gaps = 10/170 (6%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFG  250
            +A   G+SV ++ FL+C     F A++  S++H      A  RHI+A+  G A  Y  FG
Sbjct  22   LADMCGLSVDLINFLICQIGALFLASLFRSILHP-TRVSAHVRHIFALTVGLAFGYFCFG  80

Query  251  FSSNLHFLVPMLLGYGSMLINRPYC-GAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATG  427
              + +H      + Y  +    P        L+A  YL+  H+     D +    +D TG
Sbjct  81   PQA-IHIAGLPAVCYIVIRTQDPRVVQRNVMLVAMTYLLCIHLIRQIYD-YGSYSLDITG  138

Query  428  ALMVITLKIISCVMSYQDGLLKE-EDLREAQKKNRLLNRPSLLEYFGYCL  574
             LM+IT K+ S   S  DG +++ +DL +AQ+ + +   PS LEYF Y L
Sbjct  139  PLMIITQKVTSLAFSIHDGFVRQHKDLTKAQQYHAVYKLPSALEYFSYVL  188



>ref|XP_003464977.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Cavia porcellus]
Length=538

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 67/133 (50%), Gaps = 17/133 (13%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNLHFLVP--------MLLGYGSMLINRPYCGAITFLLAF  352
            RH+ A   G  L++  FG+ + LHFLV         +++G GSM     YC    F+ A 
Sbjct  67   RHVVATLLGLYLAFFCFGWYA-LHFLVQSGISYCIMIIIGVGSM---HKYC----FIFAL  118

Query  353  GYLIGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNR  529
            GYL  C +  +    + +   D +G +M+IT KI S      DG+  K+EDL  +Q+   
Sbjct  119  GYLTVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAFEIHDGMFRKDEDLTPSQRDLA  178

Query  530  LLNRPSLLEYFGY  568
            +   PSLLEY  Y
Sbjct  179  VRRMPSLLEYVSY  191



>emb|CCA75323.1| hypothetical protein PIIN_09308 [Piriformospora indica DSM 11827]
Length=571

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 76/174 (44%), Gaps = 16/174 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLCFAATIPVSLIH-RLVPGGATGRHIYAVATGAALSYLSFGF-  253
             S A A+G +   L+ + C     P++ +  RL  G A  +H++ ++      Y  FGF 
Sbjct  19   RSAADAVGATPDQLKLIFCLLIDYPLANVFIRLPKGNALLKHVFNLSISG---YYMFGFF  75

Query  254  ---SSNLHFLVPMLLGYGSMLINR----PYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
               S  L  L   L  +     +R    P+   I F +  G+L   H+Y         G 
Sbjct  76   KLYSGGLQLLASALATFFIAKFDRSKNMPW---IVFGVVMGHLFINHIYRTLNKV-NWGD  131

Query  413  IDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
             D TG  MV+TLK+ S   S  DG    E+L + Q   R+   PSLLE+ GY  
Sbjct  132  FDITGPQMVLTLKLTSYAWSIWDGRRPAEELDKGQMAARITKEPSLLEFLGYAF  185



>ref|XP_010620974.1| PREDICTED: lysophospholipid acyltransferase 2 [Fukomys damarensis]
Length=531

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 64/130 (49%), Gaps = 11/130 (8%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYL  361
            RH+ A   G  L++  FG+ + LHFLV   + Y  M+         YC    F+ A GYL
Sbjct  67   RHVVATLLGLYLAFFCFGWYA-LHFLVQSGISYCIMITTGVESTHRYC----FVFALGYL  121

Query  362  IGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLN  538
              C +  +    + +   D +G +M+IT KI S      DG+  KEEDL  +Q+   +  
Sbjct  122  TACQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKEEDLTPSQRGLAVRR  181

Query  539  RPSLLEYFGY  568
             PSLLEY  Y
Sbjct  182  MPSLLEYVSY  191



>ref|XP_007671493.1| PREDICTED: LOW QUALITY PROTEIN: lysophospholipid acyltransferase 
2 [Ornithorhynchus anatinus]
Length=498

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 66/131 (50%), Gaps = 13/131 (10%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGY------GSMLINRPYCGAITFLLAFGY  358
            RH+ A   G  L+   FG+ S LHF VP  + Y      G   I++ YC    F+ A GY
Sbjct  35   RHVVATLLGLYLALFCFGWXS-LHFSVPQGIKYYLICKIGIKTIHK-YC----FVFALGY  88

Query  359  LIGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLL  535
            L  C +  +    + +   D +G +M+IT KI S      DG+  KEE+L  +Q+   + 
Sbjct  89   LTVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKEEELTPSQRGLAVR  148

Query  536  NRPSLLEYFGY  568
              PSLLEYF Y
Sbjct  149  RMPSLLEYFSY  159



>ref|XP_011209779.1| PREDICTED: lysophospholipid acyltransferase 1 [Bactrocera dorsalis]
 ref|XP_011209780.1| PREDICTED: lysophospholipid acyltransferase 1 [Bactrocera dorsalis]
 ref|XP_011209781.1| PREDICTED: lysophospholipid acyltransferase 1 [Bactrocera dorsalis]
Length=697

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 14/172 (8%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +A   G+SV ++ FL+C     F A++  S++H   P   +   RHI+A+  G A  Y  
Sbjct  22   LADICGLSVDLVNFLICQIGALFLASLFRSILH---PSRVSAHVRHIFALTVGLAFGYFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPYC-GAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG  + +H      + Y  +    P        L+A  YL+  H+     D +    +D 
Sbjct  79   FGPQA-IHIAGLPSVCYIVIRTQDPRVVQRNVMLVAMTYLLCIHLIRQIYD-YGSYSLDI  136

Query  422  TGALMVITLKIISCVMSYQDGLLKE-EDLREAQKKNRLLNRPSLLEYFGYCL  574
            TG LM+IT K+ S   S  DG +++ +DL +AQ+ + +   PS LEYF Y L
Sbjct  137  TGPLMIITQKVTSLAFSIHDGFVRQHKDLTKAQQYHAIYKVPSALEYFSYVL  188



>ref|XP_010590200.1| PREDICTED: LOW QUALITY PROTEIN: lysophospholipid acyltransferase 
2 [Loxodonta africana]
Length=521

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 84/173 (49%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FA--ATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA  A I   +  R     +  RH+ A   G  L+   F
Sbjct  13   QPLSNAMQLPIDQVNFVVCQLFALLAAIWFRIYLRSSKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C +  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRDLAVRRMPSLLEYLSY  180



>ref|XP_005723976.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Pundamilia nyererei]
Length=505

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 78/174 (45%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + +  + F+ C  FA  + V     L P   +   RH+ A   G  L+   
Sbjct  15   LQPLSEIINLPLDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ S LHFLV   L Y  M+         YC    F++  GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFAGLENMHKYC----FIVTLGYLILCQITRVYVFDYGMY  129

Query  410  GIDATGALMVITLKIISCVMSYQDGLLKEE-DLREAQKKNRLLNRPSLLEYFGY  568
              D TG +MVIT KI S      DGL K E  L   QK   +   PSLLEY  Y
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLTKREGQLTPGQKYFAISRMPSLLEYLSY  183



>ref|XP_004540559.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Maylandia zebra]
Length=505

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 78/174 (45%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + +  + F+ C  FA  + V     L P   +   RH+ A   G  L+   
Sbjct  15   LQPLSEIINLPLDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ S LHFLV   L Y  M+         YC    F++  GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFAGLENMHKYC----FIVTLGYLILCQITRVYVFDYGMY  129

Query  410  GIDATGALMVITLKIISCVMSYQDGLLKEE-DLREAQKKNRLLNRPSLLEYFGY  568
              D TG +MVIT KI S      DGL K E  L   QK   +   PSLLEY  Y
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLTKREGQLTPGQKYFAISRMPSLLEYLSY  183



>ref|XP_005942406.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Haplochromis burtoni]
Length=505

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 78/174 (45%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + +  + F+ C  FA  + V     L P   +   RH+ A   G  L+   
Sbjct  15   LQPLSEIINLPLDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ S LHFLV   L Y  M+         YC    F++  GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFAGLENMHKYC----FIVTLGYLILCQITRVYVFDYGMY  129

Query  410  GIDATGALMVITLKIISCVMSYQDGLLKEE-DLREAQKKNRLLNRPSLLEYFGY  568
              D TG +MVIT KI S      DGL K E  L   QK   +   PSLLEY  Y
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLTKREGQLTPGQKYFAISRMPSLLEYLSY  183



>ref|XP_003219829.1| PREDICTED: lysophospholipid acyltransferase 1 [Anolis carolinensis]
Length=496

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 78/165 (47%), Gaps = 7/165 (4%)
 Frame = +2

Query  98   IGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLSFGFSSNL  265
            +GI +  + F  C  FA          L P   +   RH +A   G   +   FG+ S +
Sbjct  24   LGIPLDQVNFFACQLFALLAAFWFRSYLSPSHVSSGVRHAFATIFGVYFAVFCFGWYS-I  82

Query  266  HFLVPMLLGYGSMLINR-PYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVI  442
            H  V +++ Y  M++   P     +F++A GYL  CHV  +   ++     D +G LM+I
Sbjct  83   HIFVLVMISYSIMVLASIPNIHRYSFMVAMGYLTLCHVSRIYIFSYGILTTDFSGPLMII  142

Query  443  TLKIISCVMSYQDGL-LKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            T KI        DG+  K E+L + QK+  +  +PSLLEY  Y L
Sbjct  143  TQKITILAFQVHDGIGRKLEELTKEQKELAIKTKPSLLEYLSYQL  187



>gb|ETP43022.1| hypothetical protein F442_10106 [Phytophthora parasitica P10297]
Length=492

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 94/185 (51%), Gaps = 27/185 (15%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +++ +++ +G+    L ++LC  A  P++++++L+P GA+ +H++ V  G +++    G 
Sbjct  29   KVDELSATLGLGSDQLCYVLCLFAAYPLAVVYKLLP-GASLKHVFDVVLGVSIAQFVLG-  86

Query  254  SSNLHFLVPMLLGYGSMLINR----PYCGAITFLLAFGYLIGCHVYYMSGD--AWKEGGI  415
            S  +H  +   L Y   LI +     +   I FL    Y+   H+Y +  D   W    +
Sbjct  87   SGWVHSFISSFLTY---LIVKFGPSKHAPGIVFLFNMLYMSASHIYRLYVDYMGWT---L  140

Query  416  DATGALMVITLKIISCVMSYQDGLLK-------------EEDLREAQKKNRLLNRPSLLE  556
            D TG  M++ +K+ S   +Y DG++              ++ + E+++K  +   PSLLE
Sbjct  141  DFTGPQMLLVIKLTSFAYNYYDGVVDKTFEKKGAEMSPGKKKVYESRQKLAINEIPSLLE  200

Query  557  YFGYC  571
            +FGY 
Sbjct  201  FFGYV  205



>ref|XP_011151698.1| PREDICTED: lysophospholipid acyltransferase 2 [Harpegnathos saltator]
Length=500

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 77/169 (46%), Gaps = 8/169 (5%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-FAATIPVSLIH-RLVPGGAT--GRHIYAVATGAALSYLSFGF  253
            +A  IG+ +  + F+L  F A I   L+   L P   T   RH+Y +  G AL Y  FG 
Sbjct  17   LADFIGLPIDQVNFVLTQFTALILAGLLRTSLSPIATTPAARHVYGLTIGLALGYFCFG-  75

Query  254  SSNLHFLVPMLLGYGSMLINRP-YCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGA  430
               +H      L Y +M    P +   +   +A  YL   H +    D +    +D TG 
Sbjct  76   RQAIHLASLPALCYIAMRTQNPRHMQRVVLAIALIYLSCIHCHRQIYD-YGSYTLDITGP  134

Query  431  LMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            LMVIT K+ S   S  DGL  +EE+L   Q+   +   P+ LEYF Y  
Sbjct  135  LMVITQKVTSLAFSIHDGLTRREEELTPMQRHQAVQKMPTALEYFSYVF  183



>ref|XP_008848363.1| PREDICTED: lysophospholipid acyltransferase 2 [Nannospalax galili]
Length=520

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 84/173 (49%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATG----RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  + +  ++  R     +      RH+ A   G  L++  F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLSALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLAFFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C +  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVESMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYVSY  180



>ref|XP_011427949.1| PREDICTED: lysophospholipid acyltransferase 5-like [Crassostrea 
gigas]
Length=474

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 84/171 (49%), Gaps = 10/171 (6%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGR--HIYAVATGAALSYLSFG  250
            ++++AS IG SV    FLL      P+   HR    G      H++  ATG A+ Y +FG
Sbjct  5    LDALASQIGASVEATIFLLSLFIGYPLGFFHRAFIHGKDENIHHVFFTATGLAVYYFNFG  64

Query  251  FSSNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGC-HVYYMSGDAWKEGGIDATG  427
             +  +H +  +L+ Y  + +     G   F + F ++    ++ Y   ++ K  G   T 
Sbjct  65   LNF-IHPIANILVIYVLLRV----AGGSKFSVVFSFIFNSLYLLYSYVESVKLEGYSITW  119

Query  428  AL--MVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            +    V+TL++ + V+ Y DG   ++ L + QK+N + + PSLL  FG C 
Sbjct  120  STPQCVLTLRLTALVLDYYDGKKSQDKLSKDQKENFITDIPSLLAIFGQCF  170



>gb|ENN75377.1| hypothetical protein YQE_08152, partial [Dendroctonus ponderosae]
 gb|ERL90435.1| hypothetical protein D910_07784 [Dendroctonus ponderosae]
Length=492

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 84/173 (49%), Gaps = 10/173 (6%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATG----RHIYAVATGAALSYLS  244
            +E ++    + +  L FL+     + ++ ++R + G A      RH++ +  G  +SY  
Sbjct  14   LEGLSGYTSLHLDQLNFLVSQLVALTIAALYRTLLGPAKVSPKVRHVFGLLFGLWMSYFC  73

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPYC--GAITFLLAFGYLIGCHVYYMSGDAWKEGGID  418
            FG+ + LH        Y  +L   P    GA+ F  A  YL   H+Y    D     G+D
Sbjct  74   FGYQA-LHLAGLPAACYLVILTQNPSIMHGAVLFT-AILYLSMIHLYRQLFDD-SSFGLD  130

Query  419  ATGALMVITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGYCL  574
             +G LMVIT K+ S   S  DG+++ +E L E Q+   L   P+LLE+F Y L
Sbjct  131  ISGPLMVITQKVTSLAFSLHDGMVENDEKLTETQRSYALKKVPNLLEFFSYSL  183



>emb|CDW83355.1| UNKNOWN [Stylonychia lemnae]
Length=455

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 73/164 (45%), Gaps = 11/164 (7%)
 Frame = +2

Query  98   IGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGFSSNLHFLV  277
            IG     +R +LC     P+  I  L   G T RH +A  TG  L    F     LH   
Sbjct  2    IGKPEDQIRLILCLLIAYPLGWIMNLALRGKTARHTFATVTGIILQAYMFR-DEILHTFF  60

Query  278  PMLLGYGSMLIN---RPYCGAITFLLAFGYLIGCHVY--YMSGDAWKEGGIDATGALMVI  442
              L+ Y  +L+N   R     + F     YL   H+Y  Y++   W    +D T   M++
Sbjct  61   MSLITY--LLMNVFPRQTQHKVVFAFTLAYLSASHIYRMYVNFGGWD---LDITTYTMIL  115

Query  443  TLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            T K+ +    Y+DG LK+++L   Q + ++++ P+  EY  Y  
Sbjct  116  TAKLSALSFCYKDGGLKDQELIPDQIERKVISMPTPFEYLSYVF  159



>ref|XP_011196586.1| PREDICTED: lysophospholipid acyltransferase 1 [Bactrocera cucurbitae]
Length=695

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 84/172 (49%), Gaps = 14/172 (8%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +A   G+SV ++ FL+C     F A++  S++H   P   +   RHI+A+  G A  Y  
Sbjct  22   LADICGLSVDLINFLICQIGALFLASLFRSILH---PSRVSAHVRHIFALTVGLAFGYFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPYC-GAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG  + +H      + Y  +    P        L+A  YL+  H+     D +    +D 
Sbjct  79   FGPQA-IHIAGLPSVCYIVIRTQDPRVVQRNVMLVAMTYLLCIHLIRQIYD-YGSYSLDI  136

Query  422  TGALMVITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGYCL  574
            TG LM+IT K+ S   S  DG ++  +DL +AQ+ + +   PS LEYF Y L
Sbjct  137  TGPLMIITQKVTSLAFSIHDGFVRHHKDLTKAQQYHAIYKVPSALEYFSYVL  188



>ref|XP_001604606.2| PREDICTED: lysophospholipid acyltransferase 5 [Nasonia vitripennis]
Length=471

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 77/171 (45%), Gaps = 17/171 (10%)
 Frame = +2

Query  83   SMASAIGISVPVLRFLLCFAATIPVSLIHR--LVPGGATGRHIYAVATGAALSYLSFGFS  256
            S+A  +G     LR L+      P++LIHR  L     T +H Y  A G  + + ++G  
Sbjct  13   SLAELVGAPTDALRLLISILLGFPLALIHRRTLYGKSPTSQHYYFAACGLIIGFWNYGVD  72

Query  257  SNLHFLVPMLLGY------GSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGID  418
              +H +  + + Y      G  L++      +TF+   GYL+  +    +GD      I 
Sbjct  73   I-MHSMAALTVTYLTLKALGGTLVSV----ILTFIFNMGYLLIGYYATATGDY----DIK  123

Query  419  ATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGYC  571
             T    V+TL++I       DG  KEE L E QK   L  +PS LE  G+C
Sbjct  124  WTMPQCVLTLRLIGLAYDIHDGQKKEEKLSETQKLTALREQPSFLEMAGFC  174



>gb|KDR07796.1| Lysophospholipid acyltransferase 5 [Zootermopsis nevadensis]
Length=475

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 84/168 (50%), Gaps = 9/168 (5%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGA--TGRHIYAVATGAALSYLSFG  250
            +  +A ++G   P LR L+      P+++IHR    G     +H++ V +G ++ Y ++G
Sbjct  12   LSQLAYSLGAPEPALRLLVSVLIGYPLAIIHRHTLYGHLLQYQHLFFVVSGLSIGYFNYG  71

Query  251  FSSNLHFLVPMLLGYGSM-LINRPYCGAI-TFLLAFGYLIGCHVYYMSGDAWKEGGIDAT  424
            +   LH +  +L+ YG + +I       I  F+   GYL+    YYM+G   +   I  +
Sbjct  72   WEV-LHSVASVLVVYGVLKIIGGTLISVICIFIFTMGYLLAG--YYMTGT--ETYDIKWS  126

Query  425  GALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGY  568
                V+TL++I       DG   EE+L + QKK  L   PSLLE  GY
Sbjct  127  MPQCVLTLRLIGLAFDLFDGKKLEEELSQEQKKKALSKIPSLLEVAGY  174



>ref|XP_002908001.1| lysophospholipid acyltransferase, putative [Phytophthora infestans 
T30-4]
 gb|EEY61084.1| lysophospholipid acyltransferase, putative [Phytophthora infestans 
T30-4]
Length=456

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 94/186 (51%), Gaps = 29/186 (16%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +++ ++ ++G+    L ++LC  A  P++++++L+P GA+ +H++ V  G +++    G 
Sbjct  29   KVDELSVSLGLGSDQLCYVLCLFAAYPLAVVYKLLP-GASLKHVFDVVLGVSIAQFVLG-  86

Query  254  SSNLH-----FLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGD--AWKEGG  412
            S  +H     FL  +++ +G       +   I FL    Y+   H+Y +  D   W    
Sbjct  87   SGWVHSFISSFLTYLIVKFGP----SKHAPGIVFLFNMLYMSASHIYRLYVDYMGWT---  139

Query  413  IDATGALMVITLKIISCVMSYQDGLLKE-------------EDLREAQKKNRLLNRPSLL  553
            +D TG  M++ +K+ S   +Y DG++ +             + + E ++K  +   PSLL
Sbjct  140  LDFTGPQMLLVIKLTSFAYNYYDGVVDKTFEKKGAEMSPGIKKVYEGRQKLAIQEIPSLL  199

Query  554  EYFGYC  571
            E+FGY 
Sbjct  200  EFFGYV  205



>ref|XP_007197213.1| PREDICTED: lysophospholipid acyltransferase 1 isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=494

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 79/172 (46%), Gaps = 7/172 (4%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +  ++  +GI +  + F+ C  FA          L PG  +   RH++A   G       
Sbjct  19   LHPLSELLGIPLDQVNFVTCQLFALFAAFWFRSYLSPGKTSPDVRHVFATIFGIYFVIFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLI-NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG+ S +H  V +L+ YG M+  +       +F +A GYL  CH+  +    +     D 
Sbjct  79   FGWYS-VHLFVLVLMCYGIMVTASASNVHRYSFFVAMGYLTICHISRIYIFHYGILTTDF  137

Query  422  TGALMVITLKIISCVMSYQDGL-LKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            +G LM++T KI +      DGL  K EDL   Q +  +  +PS LEY  Y L
Sbjct  138  SGPLMIVTQKITTLAFQVHDGLGRKAEDLSTEQHRLAVKAKPSFLEYVSYLL  189



>ref|XP_007197214.1| PREDICTED: lysophospholipid acyltransferase 1 isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=472

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 79/172 (46%), Gaps = 7/172 (4%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +  ++  +GI +  + F+ C  FA          L PG  +   RH++A   G       
Sbjct  19   LHPLSELLGIPLDQVNFVTCQLFALFAAFWFRSYLSPGKTSPDVRHVFATIFGIYFVIFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLI-NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG+ S +H  V +L+ YG M+  +       +F +A GYL  CH+  +    +     D 
Sbjct  79   FGWYS-VHLFVLVLMCYGIMVTASASNVHRYSFFVAMGYLTICHISRIYIFHYGILTTDF  137

Query  422  TGALMVITLKIISCVMSYQDGL-LKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            +G LM++T KI +      DGL  K EDL   Q +  +  +PS LEY  Y L
Sbjct  138  SGPLMIVTQKITTLAFQVHDGLGRKAEDLSTEQHRLAVKAKPSFLEYVSYLL  189



>gb|EHB15193.1| Lysophospholipid acyltransferase 2, partial [Heterocephalus glaber]
Length=480

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 65/130 (50%), Gaps = 11/130 (8%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYL  361
            RH+ A   G  L++  FG+ + LHFLV   + Y  M++        YC    F+ A GYL
Sbjct  32   RHVVATLLGLYLAFFCFGWYA-LHFLVQSGISYCIMIVTGVESMHKYC----FVFALGYL  86

Query  362  IGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLN  538
              C +  +    + +   D +G +M+IT KI S      DG+  K+EDL  +Q+   +  
Sbjct  87   TVCQITRVYIFDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEDLTPSQRGLAVRR  146

Query  539  RPSLLEYFGY  568
             PSLLEY  Y
Sbjct  147  MPSLLEYVSY  156



>ref|XP_007476227.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X2 [Monodelphis 
domestica]
Length=517

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 64/130 (49%), Gaps = 11/130 (8%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYL  361
            RH+ A   G  LS   FG+ + LHFLV   + Y  M+I        YC    F+ A GYL
Sbjct  53   RHVVATLLGLYLSLFCFGWYA-LHFLVQSGISYSIMIIIGVENMHKYC----FVFALGYL  107

Query  362  IGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLN  538
              C +  +    + +   D +G +M+IT KI S      DG+  KEE+L  +Q+   +  
Sbjct  108  TVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKEEELTPSQRGLAVRR  167

Query  539  RPSLLEYFGY  568
             PSLLEY  Y
Sbjct  168  MPSLLEYLSY  177



>ref|XP_005404403.1| PREDICTED: lysophospholipid acyltransferase 2 [Chinchilla lanigera]
Length=517

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 65/130 (50%), Gaps = 11/130 (8%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYL  361
            RHI A   G  L++  FG+ + LHFLV   + Y  M+I        YC    F+ A GYL
Sbjct  53   RHIVATLLGLYLAFFCFGWYA-LHFLVQSGISYCIMIIIGVESMHKYC----FVFALGYL  107

Query  362  IGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLN  538
              C +  +    + +   D +G +M+IT KI S      DG+  K+EDL  +Q+   +  
Sbjct  108  TVCQITRVYIFDYGQYSADFSGPMMIITQKITSLAYEIHDGMFRKDEDLTPSQRGLAVRR  167

Query  539  RPSLLEYFGY  568
             PSLLEY  Y
Sbjct  168  MPSLLEYVSY  177



>ref|XP_007664636.1| PREDICTED: lysophospholipid acyltransferase 1 [Ornithorhynchus 
anatinus]
Length=461

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 69/136 (51%), Gaps = 5/136 (4%)
 Frame = +2

Query  179  PGGATG--RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSML-INRPYCGAITFLLA  349
            PG A+   RH +A   G       FG+ S +H  V ++L YG M+ ++       +F++A
Sbjct  25   PGNASSGVRHAFATIFGIYFLIFCFGWYS-IHIFVLVVLCYGIMVTVSTANIHRYSFVVA  83

Query  350  FGYLIGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGL-LKEEDLREAQKKN  526
             GYL  CH+  +    +     D +G LM++T KI +      DGL  + EDL   Q++ 
Sbjct  84   MGYLTMCHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGQRAEDLTSEQQQL  143

Query  527  RLLNRPSLLEYFGYCL  574
             + +RPS LEY  Y L
Sbjct  144  AVRSRPSFLEYSSYLL  159



>ref|XP_004368224.1| Membranebound O-acyltransferase domain containing protein 2, 
putative [Acanthamoeba castellanii str. Neff]
 gb|ELR25469.1| Membranebound O-acyltransferase domain containing protein 2, 
putative [Acanthamoeba castellanii str. Neff]
Length=504

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/188 (26%), Positives = 87/188 (46%), Gaps = 20/188 (11%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVP-------------GGATGRH  202
            M  P ++++  A+  +   +R+L   AA  P++L+ RL+P               A  +H
Sbjct  1    MHFPLVDALDRAVEQTS--VRYLFALAAVYPLALVFRLLPYPHHLAAAGAGRAWAAAVKH  58

Query  203  IYAVATGAALSYLSFGFSSNLHFLVPMLLGYG-SMLINRPYCGAITFLLAFGYLIGCHVY  379
            +++V     +   + G  S +H LV  L+ Y    L+         F+    YL   H++
Sbjct  59   LFSVVITIGICSFALGPYSWVHALVTTLVSYALHRLLPHGIAHKAVFMFCMAYLSFGHLW  118

Query  380  YMSGDAWKEGGIDATGALMVITLKIISCVMSYQDG---LLKEEDLREAQKKNRLLNRPSL  550
             M  + W    ++ T   M++T+K+ SC  +  DG      +E +R+ QK++ +   PSL
Sbjct  119  IMYTE-WLAWSLNWTTQQMLLTIKLTSCACNIYDGHQPAAAQEKMRDYQKRHAVKRMPSL  177

Query  551  LEYFGYCL  574
            LEY G+  
Sbjct  178  LEYLGFAF  185



>ref|XP_008893287.1| hypothetical protein PPTG_01659 [Phytophthora parasitica INRA-310]
 gb|ETI45132.1| hypothetical protein F443_10201 [Phytophthora parasitica P1569]
 gb|ETK85107.1| hypothetical protein L915_09979 [Phytophthora parasitica]
 gb|ETL38527.1| hypothetical protein L916_09890 [Phytophthora parasitica]
 gb|ETL91652.1| hypothetical protein L917_09806 [Phytophthora parasitica]
 gb|ETM44943.1| hypothetical protein L914_09861 [Phytophthora parasitica]
 gb|ETN21499.1| hypothetical protein PPTG_01659 [Phytophthora parasitica INRA-310]
 gb|ETO73758.1| hypothetical protein F444_10300 [Phytophthora parasitica P1976]
 gb|ETP14950.1| hypothetical protein F441_10142 [Phytophthora parasitica CJ01A1]
Length=492

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 93/185 (50%), Gaps = 27/185 (15%)
 Frame = +2

Query  74   EMESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSFGF  253
            +++ +++ +G+    L ++LC  A  P++++++L+P GA+ +H++ V  G +++    G 
Sbjct  29   KVDELSATLGLGSDQLCYVLCLFAAYPLAVVYKLLP-GASLKHVFDVVLGVSIAQFVLG-  86

Query  254  SSNLHFLVPMLLGYGSMLINR----PYCGAITFLLAFGYLIGCHVYYMSGD--AWKEGGI  415
            S  +H  +   L Y   LI +     +   I FL    Y+   H+Y +  D   W    +
Sbjct  87   SGWVHSFISSFLTY---LIVKFGPSKHAPGIVFLFNMLYMSASHIYRLYVDYMGWT---L  140

Query  416  DATGALMVITLKIISCVMSYQDGLLK-------------EEDLREAQKKNRLLNRPSLLE  556
            D TG  M++ +K+ S   +Y DG++              ++ + E ++K  +   PSLLE
Sbjct  141  DFTGPQMLLVIKLTSFAYNYYDGVVDKTFEKKGAEMSPGKKKVYEGRQKLAINEIPSLLE  200

Query  557  YFGYC  571
            +FGY 
Sbjct  201  FFGYV  205



>ref|XP_002080853.1| GD26012 [Drosophila simulans]
 gb|EDX06438.1| GD26012 [Drosophila simulans]
Length=1026

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 84/170 (49%), Gaps = 14/170 (8%)
 Frame = +2

Query  86   MASAIGISVPVLRFLLC-----FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +A  +G+SV ++ FL+C     F A++  S +H   P   +   RH +A++ G A  Y  
Sbjct  22   LADMVGLSVDLVNFLICQISALFLASLFRSTLH---PSKVSSKLRHTFALSIGLAFGYFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLINRPY-CGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG  + +H      + Y  +    P        L+A  YL+  H+     D +    +D 
Sbjct  79   FGQQA-IHIAGLPAICYIVIRTQDPRIVQRAVLLVAMCYLLCVHLMRQLYD-YGSYALDI  136

Query  422  TGALMVITLKIISCVMSYQDGLLK-EEDLREAQKKNRLLNRPSLLEYFGY  568
            TG LM+IT K+ S   S  DG ++ +E+L +AQ+ + +   PS LEYF Y
Sbjct  137  TGPLMIITQKVTSLAFSIHDGFVRGDEELTKAQQYHAIRKMPSALEYFSY  186



>ref|NP_524157.2| nessy, isoform A [Drosophila melanogaster]
 ref|NP_730390.1| nessy, isoform B [Drosophila melanogaster]
 ref|NP_788527.1| nessy, isoform C [Drosophila melanogaster]
 sp|Q9VVX5.1|MBOA5_DROME RecName: Full=Lysophospholipid acyltransferase 5; Short=LPLAT 
5; AltName: Full=1-acylglycerophosphocholine O-acyltransferase; 
AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; 
AltName: Full=1-acylglycerophosphoserine O-acyltransferase; 
AltName: Full=Lysophosphatidylcholine acyltransferase; 
Short=LPCAT; Short=Lyso-PC acyltransferase; AltName: Full=Lysophosphatidylethanolamine 
acyltransferase; Short=LPEAT; 
Short=Lyso-PE acyltransferase; AltName: Full=Lysophosphatidylserine 
acyltransferase; Short=LPSAT; Short=Lyso-PS acyltransferase; 
AltName: Full=Membrane-bound O-acyltransferase domain-containing 
protein 5; Short=O-acyltransferase domain-containing 
protein 5; AltName: Full=Protein nessy [Drosophila 
melanogaster]
 gb|AAF49181.1| nessy, isoform A [Drosophila melanogaster]
 gb|AAL48558.1| RE03440p [Drosophila melanogaster]
 gb|AAN11657.1| nessy, isoform B [Drosophila melanogaster]
 gb|AAO41223.1| nessy, isoform C [Drosophila melanogaster]
 gb|ACL86398.1| nes-PA, partial [synthetic construct]
 gb|ACL91051.1| nes-PA [synthetic construct]
Length=497

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 83/175 (47%), Gaps = 14/175 (8%)
 Frame = +2

Query  59   DMELPE---MESMASAIGISVPVLRFLLCFAATIPVSLIHRL---VPGGATGRHIYAVAT  220
            + +LP    M+ +AS +G+ V  LR LL   A  PV+ +++    V    T  H++    
Sbjct  5    EEDLPHNGLMDGIASGVGVPVEALRLLLTILAGYPVAALYQKFISVIADKTVHHMFFAGC  64

Query  221  GAALSYLSFGFSSNLHFLVPMLLGYGSMLINRPYCG---AITFLLAFGYLIGCHVYYMSG  391
            GA L Y ++G  +  H L+ +L  Y  +L+ R       AI F+    YL+  + Y  S 
Sbjct  65   GAGLCYFNYGLDT-YHSLIAILTTYFLVLLLRKKTQIFLAINFVFHMSYLLLGYFYTSSN  123

Query  392  DAWKEGGIDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLE  556
            D      I  T    ++ L++I       DGL +E +L + QK+  L   PSLLE
Sbjct  124  DY----DILWTMPHCILVLRMIGYGFDITDGLKEESELSKDQKETALKKPPSLLE  174



>ref|XP_004660118.1| PREDICTED: LOW QUALITY PROTEIN: lysophospholipid acyltransferase 
2 [Jaculus jaculus]
Length=520

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (49%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATG----RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C    +  ++  R+    +      RHI A   G  L++  F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRIYLHSSKTSSFIRHIVATLLGLYLAFFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C +  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMVIIGAESMHTYC----FVFALGYLTVCQITRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYVSY  180



>ref|XP_011228196.1| PREDICTED: lysophospholipid acyltransferase 2 [Ailuropoda melanoleuca]
Length=523

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 83/173 (48%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FA--ATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA  A I      R     +  RH+ A   G  L+   F
Sbjct  16   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLRSSKTSSFIRHVVATLLGLYLALFCF  75

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C +  +    + +  
Sbjct  76   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  130

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  131  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTSSQRGLAVRRMPSLLEYLSY  183



>gb|EGI62973.1| Membrane-bound O-acyltransferase domain-containing protein 2 
[Acromyrmex echinatior]
Length=482

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 71/151 (47%), Gaps = 6/151 (4%)
 Frame = +2

Query  128  LLCFAATIPVSLIHR-LVPGGAT-GRHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGS  301
            L  F A I  +L+   L P   T  +H+Y +  G AL Y  FG  + +H  +   L Y +
Sbjct  14   LTQFTALILATLLRSSLSPIATTPAKHVYGLTIGLALGYFCFGRQA-IHLAILPALCYIA  72

Query  302  MLINRPY-CGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQ  478
            M    P     +   +A  YL   H +    D +    +D TG LMVIT K+ S   S  
Sbjct  73   MRTQNPRNMQRVVLAIALIYLSCIHFHRQIYD-YGSYTLDITGPLMVITQKVTSLAFSIH  131

Query  479  DGLLK-EEDLREAQKKNRLLNRPSLLEYFGY  568
            DGL + EEDL   Q+   +   P++LEYF Y
Sbjct  132  DGLTRCEEDLTPMQRHQAVQKMPTILEYFSY  162



>ref|XP_008299182.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Stegastes partitus]
Length=510

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 79/174 (45%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + +  + F+ C  FA  + V     L P   +   RH+ A   G  L+   
Sbjct  15   LQPISEIINLPLDQVNFVACQLFALLMAVWFRLYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ S LHFLV   L Y  M+         YC    F++  GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFAGLEHMHKYC----FIVTLGYLILCQITRVYVFDYGMY  129

Query  410  GIDATGALMVITLKIISCVMSYQDGLLKEE-DLREAQKKNRLLNRPSLLEYFGY  568
              D TG +MVIT KI S      DGL K +  L  +QK   +   PSLLEY  Y
Sbjct  130  SADFTGPMMVITQKITSLAFEIHDGLTKRDSQLTPSQKYLAISRMPSLLEYLSY  183



>ref|XP_004019389.1| PREDICTED: lysophospholipid acyltransferase 1 [Ovis aries]
Length=605

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 86/192 (45%), Gaps = 18/192 (9%)
 Frame = +2

Query  35   LNGEVSSGDMELPEMESMASAIGISVPV-LRFLLCFAATIPVSLIHRLV--PGGATG--R  199
            L   +  G  E P     A  + +++PV + F+ C    +  +   RL   PG  +   R
Sbjct  115  LPPNLQEGGKENPHTGQRAKVLILTLPVQVNFVACQLFALCAAFWFRLYLSPGKTSPDVR  174

Query  200  HIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSML------INRPYCGAITFLLAFGYL  361
            H +A   G       FG+ S +H  V +L+ YG M+      I+R      +F +A GYL
Sbjct  175  HAFATIFGVYFVIFCFGWYS-VHLFVLVLMCYGIMVTASISNIHR-----YSFFVAMGYL  228

Query  362  IGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGL-LKEEDLREAQKKNRLLN  538
              CH+  +    +     D +G LM++T KI +      DGL  + EDL   Q +  +  
Sbjct  229  TVCHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSSEQHRLAVKA  288

Query  539  RPSLLEYFGYCL  574
            +PS LEY  Y L
Sbjct  289  KPSFLEYVSYLL  300



>ref|XP_005477146.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform X1 [Oreochromis niloticus]
 ref|XP_005477147.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform X2 [Oreochromis niloticus]
 ref|XP_005477148.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like isoform X3 [Oreochromis niloticus]
Length=505

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 79/174 (45%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + +  + F+ C  FA  + V     L P   +   RH+ A   G  L+   
Sbjct  15   LQPLSEIINLPLDQVNFVACQLFALLMAVWFRIYLHPSKTSPFIRHVVATLLGFYLALFC  74

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ S LHFLV   L Y  M+         YC    F++  GYLI C +  +    +   
Sbjct  75   FGWYS-LHFLVQSGLSYSVMVFAGLENMHKYC----FIVTLGYLILCQITRVYVFDYGMY  129

Query  410  GIDATGALMVITLKIISCVMSYQDGLLKEE-DLREAQKKNRLLNRPSLLEYFGY  568
              D TG +MVIT KI S      DGL K +  L  +QK   +   PSLLEY  Y
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLTKRDGQLTPSQKYLAISRMPSLLEYLSY  183



>ref|XP_001083917.2| PREDICTED: lysophospholipid acyltransferase 2 isoform 2 [Macaca 
mulatta]
 ref|XP_005576659.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X2 [Macaca 
fascicularis]
Length=401

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSY  180



>ref|XP_007969738.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X6 [Chlorocebus 
sabaeus]
Length=401

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSY  180



>ref|XP_007565592.1| PREDICTED: lysophospholipid acyltransferase 2 [Poecilia formosa]
Length=505

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 80/175 (46%), Gaps = 16/175 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++ ++  I + +  + F+ C  FA  + V     L P   +   RH+ A   G  L+   
Sbjct  15   LQPISEIIDLPLDQVNFVACQLFALLMAVWFRLYLHPSKTSPFIRHVVATLLGLYLALFC  74

Query  245  FGFSSNLHFLVPMLLGYGSMLIN-----RPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ S +HFLV   L YG M+         YC    F++  GYLI C +  +    +   
Sbjct  75   FGWYS-VHFLVQSGLSYGVMIFASLEHMHKYC----FIVTLGYLILCQITRVYVFDYGMY  129

Query  410  GIDATGALMVITLKIISCVMSYQDGLLK--EEDLREAQKKNRLLNRPSLLEYFGY  568
              D TG +MVIT KI S      DGL K  E  L  +QK   +   PSLLEY  Y
Sbjct  130  SADFTGPMMVITQKITSMAFEIHDGLSKRREGQLTPSQKYLAISRMPSLLEYLSY  184



>gb|AAD28257.1|AF128112_1 putative transmembrane protein nessy [Drosophila melanogaster]
Length=497

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 82/175 (47%), Gaps = 14/175 (8%)
 Frame = +2

Query  59   DMELPE---MESMASAIGISVPVLRFLLCFAATIPVSLIHRL---VPGGATGRHIYAVAT  220
            + +LP    M+ +AS +G+ V  LR LL   A  PV+ +++    V    T  H++    
Sbjct  5    EEDLPHNGLMDGIASGVGVPVEALRLLLTILAGYPVAALYQKFISVIADKTVHHMFFAGC  64

Query  221  GAALSYLSFGFSSNLHFLVPMLLGYGSMLINRPYCG---AITFLLAFGYLIGCHVYYMSG  391
            GA L Y ++G     H L+ +L  Y  +L+ R       AI F+    YL+  + Y  S 
Sbjct  65   GAGLCYFNYG-RDTYHSLIAILTTYFLVLLLRKKTQIFLAINFVFHMSYLLLGYFYTSSN  123

Query  392  DAWKEGGIDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLE  556
            D      I  T    ++ L++I       DGL +E +L + QK+  L   PSLLE
Sbjct  124  DY----DILWTMPHCILVLRMIGYGFDITDGLKEESELSKDQKETALKKPPSLLE  174



>dbj|BAH12219.1| unnamed protein product [Homo sapiens]
Length=401

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSY  180



>ref|XP_004401863.1| PREDICTED: lysophospholipid acyltransferase 2 [Odobenus rosmarus 
divergens]
Length=519

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 83/173 (48%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FA--ATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA  A I      R     +  RH+ A   G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLRSSKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C +  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQITRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTSSQRGLAVRRMPSLLEYLSY  180



>ref|XP_006898258.1| PREDICTED: lysophospholipid acyltransferase 2 [Elephantulus edwardii]
Length=520

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 83/172 (48%), Gaps = 13/172 (8%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L++  F
Sbjct  13   QPLSNALQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFVRHVVATLLGLYLAFFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGI  415
            G+ + LHFLV   + Y  M+I    N   C    F+ A GYL  C +  +    + +   
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGMENMHTC---CFVFALGYLTMCQISRVYIFDYGQYSA  128

Query  416  DATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
            D +G +MVIT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  129  DFSGPMMVITQKITSLAYEIHDGMFRKDEELTPSQRALAVRRMPSLLEYLSY  180



>ref|XP_004609428.1| PREDICTED: lysophospholipid acyltransferase 2 [Sorex araneus]
Length=522

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 83/173 (48%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FA--ATIPVSLIHRLVPGGATGRHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA  A +      R     +  RH+ A   G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAVWFRTYLRASKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHKYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLAYEIHDGMFRKDEELTPSQRGLAVRRMPSLLEYLSY  180



>ref|XP_005867334.1| PREDICTED: lysophospholipid acyltransferase 2 [Myotis brandtii]
Length=521

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 65/130 (50%), Gaps = 11/130 (8%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYL  361
            RH+ A   G  L+   FG+ + LHFLV   + Y  M+I        YC    F+ A GYL
Sbjct  43   RHVVATLLGLYLAVFCFGWYA-LHFLVQSGVSYCIMIIIGMEHMHKYC----FVFALGYL  97

Query  362  IGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLN  538
            I C +  +    + +   D +G +M++T KI S      DG+  K+EDL  +Q+   +  
Sbjct  98   IVCQITRVYIFDYGQYSADFSGPMMIMTQKITSLAYEIHDGMFRKDEDLTPSQRDLAVRR  157

Query  539  RPSLLEYFGY  568
             PSLLEY  Y
Sbjct  158  MPSLLEYLSY  167



>ref|NP_001087473.1| lysophosphatidylcholine acyltransferase 3 [Xenopus laevis]
 gb|AAH79981.1| MGC81123 protein [Xenopus laevis]
Length=467

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 83/168 (49%), Gaps = 9/168 (5%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHR--LVPGGATGRHIYAVATGAALSYLSFG  250
            +  +A A+G S P L+ +L      P++L  R  L     +  H++   TG  ++Y +FG
Sbjct  9    LNQVAEALGASEPALKLILSIFLGYPLALFQRYFLYKKEPSHIHLFNTVTGLGIAYFNFG  68

Query  251  FSSNLHFLVPMLLGYGSM-LINRPYCGAIT-FLLAFGYLIGCHVYYMSGDAWKEGGIDAT  424
             S   H L+ ++L +  + L+ R     +T F    GYL+ C  YY + + +    I  T
Sbjct  69   -SQLYHSLLCVVLNFLILRLMGRTITAVLTSFCFQMGYLL-CGYYYTATENYD---IKWT  123

Query  425  GALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGY  568
                V+TLK+I     Y DG  ++E L E QK+  +   PSL+E  G+
Sbjct  124  MPQCVLTLKLIGLTFDYYDGGKEQESLTEEQKRFAVPGVPSLIEVCGF  171



>ref|XP_009063331.1| hypothetical protein LOTGIDRAFT_129765 [Lottia gigantea]
 gb|ESO86086.1| hypothetical protein LOTGIDRAFT_129765 [Lottia gigantea]
Length=474

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 83/177 (47%), Gaps = 18/177 (10%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHRLVPGGATG----RHIYAVATGAALSYLS  244
            +  ++  IG+ +  + FL+C    + ++   R+V   +T     RH+  +  G +L+   
Sbjct  14   LTPLSETIGLPIDQVNFLVCQLVALILAFPFRIVLSPSTTSLTVRHVVQITLGVSLTLFC  73

Query  245  FGFS----SNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            FG+       L F+  +L+ YGS    + +     F+    YL   H++    D    GG
Sbjct  74   FGYQIWHLFMLSFVSYILMKYGS----KDWMHNAIFIYNMVYLSVTHIWRQIYDY---GG  126

Query  413  --IDATGALMVITLKIISCVMSYQDGLLKEED-LREAQKKNRLLNRPSLLEYFGYCL  574
              +D TG LM++T K+ S   S  DGL K+ + L + QK   +   PSLL ++ Y  
Sbjct  127  YTLDITGPLMIMTQKMSSMAFSLHDGLYKDNNKLTQDQKSQAIRKMPSLLSFYSYVF  183



>ref|XP_007446010.1| PREDICTED: lysophospholipid acyltransferase 1 [Lipotes vexillifer]
Length=494

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 79/172 (46%), Gaps = 7/172 (4%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +  ++  +GI +  + F+ C  FA          L PG  +   RH +A   G       
Sbjct  19   LHPLSELLGIPLDQVNFVACQLFALFAAFWFRSYLSPGKTSPDVRHAFATIFGIYFVIFC  78

Query  245  FGFSSNLHFLVPMLLGYGSMLI-NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGGIDA  421
            FG+ S +H  V +L+ YG M+  +       +F +A GYL  CH+  +    +     D 
Sbjct  79   FGWYS-VHLFVLVLMCYGIMVTASTSNVHRYSFFVAMGYLTICHISRIYIFHYGILTTDF  137

Query  422  TGALMVITLKIISCVMSYQDGL-LKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
            +G LM++T KI +      DGL  K EDL   Q++  +  +PS LEY  Y L
Sbjct  138  SGPLMIVTQKITTLAFQVHDGLGRKAEDLSTEQRRLAVKAKPSFLEYVSYLL  189



>ref|XP_007969727.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Chlorocebus 
sabaeus]
Length=520

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSY  180



>ref|XP_011242607.1| PREDICTED: lysophospholipid acyltransferase 1 isoform X1 [Mus 
musculus]
Length=307

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 82/177 (46%), Gaps = 17/177 (10%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHR--LVPGGATG--RHIYAVATGAALSYLS  244
            +  ++  +GI +  + F+ C    +  +   R  L PG A+   RH  A   G       
Sbjct  19   LHPLSQLLGIPLDQVNFVACQLFALSAAFWFRIYLHPGKASPEVRHTLATILGIYFVVFC  78

Query  245  FGFSSNLHFLVPMLLGYGSML------INRPYCGAITFLLAFGYLIGCHVYYMSGDAWKE  406
            FG+ + +H  V +L+ YG M+      I+R      +F +A GYL  CH+  +    +  
Sbjct  79   FGWYA-VHLFVLVLMCYGVMVTASVSNIHR-----YSFFVAMGYLTICHISRIYIFHYGI  132

Query  407  GGIDATGALMVITLKIISCVMSYQDGL-LKEEDLREAQKKNRLLNRPSLLEYFGYCL  574
               D +G LM++T KI +      DGL  K EDL   Q +  +  +PSLLEY  Y L
Sbjct  133  LTTDFSGPLMIVTQKITTLAFQVHDGLGRKAEDLSAEQHRLAVKAKPSLLEYLSYHL  189



>ref|XP_009440252.1| PREDICTED: lysophospholipid acyltransferase 2 [Pan troglodytes]
Length=520

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 82/174 (47%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            ++  ++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L+   
Sbjct  12   LQPFSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFC  71

Query  245  FGFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + + 
Sbjct  72   FGWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQY  126

Query  410  GIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
              D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  127  SADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSY  180



>gb|ELK29149.1| Lysophospholipid acyltransferase 2 [Myotis davidii]
Length=572

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 65/130 (50%), Gaps = 11/130 (8%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYL  361
            RH+ A   G  L+   FG+ + LHFLV   + Y  M+I        YC    F+ A GYL
Sbjct  109  RHVVATLLGLYLAVFCFGWYA-LHFLVQSGVSYCIMIIIGMEHMHKYC----FVFALGYL  163

Query  362  IGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLN  538
            + C +  +    + +   D +G +M++T KI S      DG+  K+EDL  +Q+   +  
Sbjct  164  VVCQITRVYIFDYGQYSADFSGPMMIMTQKITSLAYEIHDGMFRKDEDLTPSQRDLAVRR  223

Query  539  RPSLLEYFGY  568
             PSLLEY  Y
Sbjct  224  MPSLLEYLSY  233



>ref|XP_683208.1| PREDICTED: lysophospholipid acyltransferase 5 [Danio rerio]
Length=465

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 85/173 (49%), Gaps = 9/173 (5%)
 Frame = +2

Query  62   MELPEMESMASAIGISVPVLRFLLCFAATIPVSLIHR--LVPGGATGRHIYAVATGAALS  235
            M  P ME +A  +    P +R +L      P +L +R  L    +T  H++   TG AL+
Sbjct  1    MAAPFMEKLAEYLDSPEPAVRLILSILIGYPFALAYRWFLFHQSSTVLHLFHTITGLALA  60

Query  236  YLSFGFSSNLHFLVPMLLGYGSM-LINRPY-CGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
              +FG S   H L+ +++ +  + L+ R   C   +F+    YL+  + YY + D   E 
Sbjct  61   TFNFG-SQVYHSLLCVVIQFLLLRLMGRTVTCVLTSFIFQMIYLLTGY-YYTATD---EY  115

Query  410  GIDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGY  568
             I  T    V+TLK+I   + Y DG   +  L   QKK+ L + PSLLE FG+
Sbjct  116  DIKWTMPHCVLTLKLIGLALDYYDGGKDQSKLSAEQKKSALGSTPSLLEVFGF  168



>ref|XP_007053245.1| PREDICTED: membrane-bound O-acyltransferase domain-containing 
protein 2-like [Chelonia mydas]
Length=519

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 83/174 (48%), Gaps = 15/174 (9%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLS  244
            +E +++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L+   
Sbjct  11   LEPLSNAVRLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFVRHVVATLLGLYLALFC  70

Query  245  FGFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            FG+ + LHF+V   + Y  M+I        YC    F+ A GYL  C +  +    + + 
Sbjct  71   FGWYA-LHFVVQSGISYYIMIIIGVENMHKYC----FVFALGYLTMCQITRVYIFDYGQY  125

Query  410  GIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
              D +G +M+IT KI S      DG+  KEE+L  +Q+   +   PSLLEY  Y
Sbjct  126  SADFSGPMMIITQKITSLAYEIHDGMFRKEEELTPSQRCLAVRRMPSLLEYLSY  179



>gb|EPQ08440.1| Lysophospholipid acyltransferase 2 [Myotis brandtii]
Length=560

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 65/130 (50%), Gaps = 11/130 (8%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYL  361
            RH+ A   G  L+   FG+ + LHFLV   + Y  M+I        YC    F+ A GYL
Sbjct  107  RHVVATLLGLYLAVFCFGWYA-LHFLVQSGVSYCIMIIIGMEHMHKYC----FVFALGYL  161

Query  362  IGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLN  538
            I C +  +    + +   D +G +M++T KI S      DG+  K+EDL  +Q+   +  
Sbjct  162  IVCQITRVYIFDYGQYSADFSGPMMIMTQKITSLAYEIHDGMFRKDEDLTPSQRDLAVRR  221

Query  539  RPSLLEYFGY  568
             PSLLEY  Y
Sbjct  222  MPSLLEYLSY  231



>ref|XP_006106384.1| PREDICTED: lysophospholipid acyltransferase 2 [Myotis lucifugus]
Length=484

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 65/130 (50%), Gaps = 11/130 (8%)
 Frame = +2

Query  197  RHIYAVATGAALSYLSFGFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYL  361
            RH+ A   G  L+   FG+ + LHFLV   + Y  M+I        YC    F+ A GYL
Sbjct  90   RHVVATLLGLYLAVFCFGWYA-LHFLVQSGVSYCIMIIIGMEHMHKYC----FVFALGYL  144

Query  362  IGCHVYYMSGDAWKEGGIDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLN  538
            I C +  +    + +   D +G +M++T KI S      DG+  K+EDL  +Q+   +  
Sbjct  145  IVCQITRVYIFDYGQYSADFSGPMMIMTQKITSLAYEIHDGMFRKDEDLTPSQRDLAVRR  204

Query  539  RPSLLEYFGY  568
             PSLLEY  Y
Sbjct  205  MPSLLEYLSY  214



>ref|XP_005576658.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Macaca 
fascicularis]
Length=520

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSY  180



>ref|XP_010377990.1| PREDICTED: lysophospholipid acyltransferase 2 [Rhinopithecus 
roxellana]
Length=520

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSY  180



>ref|XP_002042667.1| GM14886 [Drosophila sechellia]
 gb|EDW46594.1| GM14886 [Drosophila sechellia]
Length=496

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 81/175 (46%), Gaps = 14/175 (8%)
 Frame = +2

Query  59   DMELPE---MESMASAIGISVPVLRFLLCFAATIPVSLIHR---LVPGGATGRHIYAVAT  220
            + +LP    M+ +AS +G+ V  LR LL   A  PV+  ++    V    T  H++    
Sbjct  5    EEDLPHNGLMDVIASGVGVPVEALRLLLTILAGYPVAAFYQKFIAVIADKTVHHMFFAGC  64

Query  221  GAALSYLSFGFSSNLHFLVPMLLGYGSMLINRPYCG---AITFLLAFGYLIGCHVYYMSG  391
            GA L Y ++G     H L+ +L  Y  +L+ R       AI F+    YL+  + Y  S 
Sbjct  65   GAGLCYFNYG-RDTYHSLIAILTTYFLVLLLRKKTQIFLAINFIFHMSYLLLGYFYTSSN  123

Query  392  DAWKEGGIDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLE  556
            D      I  T    ++ L++I       DGL +E +L + QK+  L   PSLLE
Sbjct  124  DY----DILWTMPHCILVLRMIGYGFDITDGLKEESELSKDQKETALKEPPSLLE  174



>ref|NP_001088865.1| lysophosphatidylcholine acyltransferase 3 [Xenopus laevis]
 gb|AAH88668.1| LOC496208 protein [Xenopus laevis]
Length=467

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 82/173 (47%), Gaps = 19/173 (11%)
 Frame = +2

Query  77   MESMASAIGISVPVLRFLLCFAATIPVSLIHR--LVPGGATGRHIYAVATGAALSYLSFG  250
            ++ +A A+G S P L+ +L      P++L  R  L     +  H++   TG  ++Y +FG
Sbjct  9    LKPVAEALGASEPALKLILSILLGYPLALFQRYFLFKKEPSHIHLFNTVTGLGIAYFNFG  68

Query  251  FS-------SNLHFLVPMLLGYGSMLINRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEG  409
            +          L+FL+  L+G     ++  +C  + +LL       C  YY + + +   
Sbjct  69   YQLYHSLLCVVLNFLILRLMGRTITAVSTSFCFQMGYLL-------CGYYYTATENYD--  119

Query  410  GIDATGALMVITLKIISCVMSYQDGLLKEEDLREAQKKNRLLNRPSLLEYFGY  568
             I  T    V+TLK+I     Y DG  ++E + E QK+  +   PSL+E  G+
Sbjct  120  -IKWTMPQCVLTLKLIGLTFDYYDGGKEKESVTEEQKRFAVPGVPSLMEVCGF  171



>ref|XP_003908301.1| PREDICTED: lysophospholipid acyltransferase 2 isoform X1 [Papio 
anubis]
Length=520

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSY  180



>dbj|BAC85105.1| unnamed protein product [Homo sapiens]
Length=520

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSY  180



>ref|NP_620154.2| lysophospholipid acyltransferase 2 [Homo sapiens]
 sp|Q6ZWT7.2|MBOA2_HUMAN RecName: Full=Lysophospholipid acyltransferase 2; Short=LPLAT 
2; AltName: Full=1-acylglycerophosphate O-acyltransferase; 
AltName: Full=1-acylglycerophosphoethanolamine O-acyltransferase; 
AltName: Full=Lysophosphatidic acid acyltransferase; Short=LPAAT; 
Short=Lyso-PA acyltransferase; AltName: Full=Lysophosphatidylethanolamine 
acyltransferase; Short=LPEAT; Short=Lyso-PE 
acyltransferase; AltName: Full=Membrane-bound O-acyltransferase 
domain-containing protein 2; Short=O-acyltransferase 
domain-containing protein 2 [Homo sapiens]
 dbj|BAF93900.1| lysophospholipid acyltransferase [Homo sapiens]
 gb|AAI57828.1| Membrane bound O-acyltransferase domain containing 2 [Homo sapiens]
 gb|AAI46872.1| Membrane bound O-acyltransferase domain containing 2 [Homo sapiens]
Length=520

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 15/173 (9%)
 Frame = +2

Query  80   ESMASAIGISVPVLRFLLC--FAATIPVSLIHRLVPGGATG--RHIYAVATGAALSYLSF  247
            + +++A+ + +  + F++C  FA    +     L     +   RH+ A   G  L+   F
Sbjct  13   QPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVATLLGLYLALFCF  72

Query  248  GFSSNLHFLVPMLLGYGSMLI-----NRPYCGAITFLLAFGYLIGCHVYYMSGDAWKEGG  412
            G+ + LHFLV   + Y  M+I        YC    F+ A GYL  C V  +    + +  
Sbjct  73   GWYA-LHFLVQSGISYCIMIIIGVENMHNYC----FVFALGYLTVCQVTRVYIFDYGQYS  127

Query  413  IDATGALMVITLKIISCVMSYQDGLL-KEEDLREAQKKNRLLNRPSLLEYFGY  568
             D +G +M+IT KI S      DG+  K+E+L  +Q+   +   PSLLEY  Y
Sbjct  128  ADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSY  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750