BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F16

Length=814
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK68824.1|  Unknown protein                                         329   6e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    327   2e-108   
gb|AEW46688.1|  polyubiquitin                                           325   2e-108   Ulva linza
gb|AFW66442.1|  putative ubiquitin family protein                       325   2e-108   
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   325   3e-108   Camelina sativa [gold-of-pleasure]
gb|AEZ49160.1|  polyubiquitin                                           327   3e-108   Wolffia australiana
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           332   3e-108   Eucalyptus grandis [rose gum]
ref|XP_003626479.1|  Ubiquitin-like protein                             327   3e-108   
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                325   3e-108   Erythranthe guttata [common monkey flower]
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             325   3e-108   Elaeis guineensis
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             326   4e-108   
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      325   4e-108   Setaria italica
emb|CAH59739.1|  polyubiquitin                                          325   4e-108   Plantago major [cart-track plant]
gb|AET06143.1|  ubiquitin                                               325   4e-108   Papaver somniferum
gb|KJB36627.1|  hypothetical protein B456_006G167800                    325   4e-108   Gossypium raimondii
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             325   4e-108   
ref|XP_002317213.1|  polyubiquitin family protein                       324   4e-108   Populus trichocarpa [western balsam poplar]
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          324   4e-108   Sorghum bicolor [broomcorn]
dbj|BAC57955.1|  polyubiquitin                                          324   5e-108   Tripolium pannonicum [sea starwort]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             324   5e-108   
gb|ACJ85618.1|  unknown                                                 324   5e-108   Medicago truncatula
ref|NP_567286.1|  ubiquitin 11                                          324   5e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AFK41706.1|  unknown                                                 324   5e-108   Medicago truncatula
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   324   5e-108   Citrus sinensis [apfelsine]
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             330   5e-108   
gb|AAP31578.1|  ubiquitin                                               324   5e-108   Hevea brasiliensis [jebe]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             324   5e-108   Citrus clementina [clementine]
gb|AAO43307.1|  putative polyubiquitin                                  325   6e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             324   6e-108   Citrus clementina [clementine]
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   324   6e-108   Citrus sinensis [apfelsine]
emb|CBI22349.3|  unnamed protein product                                327   6e-108   Vitis vinifera
gb|ACD31680.1|  ubiquitin                                               327   8e-108   Gossypium hirsutum [American cotton]
ref|XP_003627152.1|  Ubiquitin                                          325   8e-108   
ref|XP_003590494.1|  Ubiquitin                                          327   8e-108   
gb|AAQ84316.1|  fiber polyubiquitin                                     323   8e-108   Gossypium barbadense [Egyptian cotton]
gb|KJB62484.1|  hypothetical protein B456_009G418900                    323   1e-107   Gossypium raimondii
gb|AAC35858.1|  polyubiquitin                                           325   1e-107   Capsicum chinense [bonnet pepper]
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             324   1e-107   Brachypodium distachyon [annual false brome]
gb|AFK43392.1|  unknown                                                 323   1e-107   Medicago truncatula
gb|AGZ15412.1|  fiber polyubiquitin                                     323   2e-107   Phaseolus vulgaris [French bean]
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   323   2e-107   Brassica rapa
gb|AGV54749.1|  ubiquitin 11                                            324   2e-107   Phaseolus vulgaris [French bean]
gb|ABY60454.1|  putative polyubiquitin                                  325   2e-107   Adonis aestivalis var. palaestina
gb|ACJ85643.1|  unknown                                                 323   2e-107   Medicago truncatula
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  323   2e-107   Piloderma croceum F 1598
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 322   2e-107   Dacryopinax primogenitus
ref|XP_006685644.1|  ubiquitin                                          322   2e-107   Yamadazyma tenuis ATCC 10573
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    322   2e-107   
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  322   3e-107   Hypholoma sublateritium FD-334 SS-4
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   322   3e-107   Piloderma croceum F 1598
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             325   3e-107   
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            324   3e-107   Phaseolus vulgaris [French bean]
ref|XP_011110054.1|  hypothetical protein H072_4094                     322   3e-107   
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      325   3e-107   Brassica rapa
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             323   3e-107   Brachypodium distachyon [annual false brome]
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             325   3e-107   
emb|CAA40323.1|  polyubiquitin protein                                  326   3e-107   Helianthus annuus
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             325   3e-107   
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      325   3e-107   
emb|CAA48140.1|  ubiquitin                                              325   3e-107   Antirrhinum majus [garden snapdragon]
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             325   3e-107   Capsella rubella
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                325   4e-107   Erythranthe guttata [common monkey flower]
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           325   4e-107   Brassica rapa
ref|XP_007512209.1|  polyubiquitin                                      327   4e-107   Bathycoccus prasinos
ref|XP_007014924.1|  Polyubiquitin 3                                    325   4e-107   Theobroma cacao [chocolate]
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         325   4e-107   Jatropha curcas
dbj|BAJ85978.1|  predicted protein                                      325   4e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             325   4e-107   
emb|CAH59740.1|  polyubiquitin                                          325   4e-107   Plantago major [cart-track plant]
prf||1604470A  poly-ubiquitin                                           323   4e-107
gb|AHC00631.1|  polyubiquitin                                           325   4e-107   Ganoderma lucidum
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          325   5e-107   Sorghum bicolor [broomcorn]
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             325   5e-107   
gb|ABD96088.1|  polyubiquitin                                           323   5e-107   Malus domestica [apple tree]
gb|AAM64530.1|  ubiquitin homolog                                       322   5e-107   Arabidopsis thaliana [mouse-ear cress]
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     322   5e-107   Rhodotorula toruloides
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             325   5e-107   
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             325   5e-107   Citrus clementina [clementine]
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             322   5e-107   
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           325   5e-107   Fragaria vesca subsp. vesca
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  322   5e-107   Pisolithus microcarpus 441
gb|ABK94002.1|  unknown                                                 325   5e-107   Populus trichocarpa [western balsam poplar]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             325   5e-107   Citrus clementina [clementine]
ref|NP_851029.1|  polyubiquitin 3                                       325   5e-107   Arabidopsis thaliana [mouse-ear cress]
emb|CDP08569.1|  unnamed protein product                                325   5e-107   Coffea canephora [robusta coffee]
ref|NP_849292.1|  polyubiquitin 14                                      324   5e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      325   5e-107   Citrus sinensis [apfelsine]
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             325   5e-107   
gb|AFW66439.1|  putative ubiquitin family protein                       324   5e-107   
gb|KJB81823.1|  hypothetical protein B456_013G163500                    324   5e-107   Gossypium raimondii
gb|AES89866.2|  polyubiquitin 3                                         324   5e-107   Medicago truncatula
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      324   5e-107   Oryza brachyantha
gb|AFY06654.1|  polyubiquitin                                           323   6e-107   Carica papaya [mamon]
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           324   6e-107   Nelumbo nucifera [Indian lotus]
emb|CBY46745.1|  polyubiquitin 10 protein                               325   6e-107   Lepidium appelianum [hairy whitetop]
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             324   6e-107   Citrus clementina [clementine]
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            320   6e-107   Phaseolus vulgaris [French bean]
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      324   6e-107   Glycine max [soybeans]
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         325   7e-107   
gb|EPS72031.1|  polyubiquitin                                           323   7e-107   Genlisea aurea
emb|CAA54603.1|  pentameric polyubiquitin                               325   7e-107   Nicotiana tabacum [American tobacco]
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         324   7e-107   Jatropha curcas
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      325   8e-107   Brachypodium distachyon [annual false brome]
gb|AES89865.2|  polyubiquitin 3                                         323   8e-107   Medicago truncatula
gb|EWZ40370.1|  ubiquitin C                                             321   8e-107   Fusarium oxysporum Fo47
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           324   8e-107   Elaeis guineensis
gb|KJB14874.1|  hypothetical protein B456_002G147600                    325   8e-107   Gossypium raimondii
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      328   8e-107   Camelina sativa [gold-of-pleasure]
gb|KDB11907.1|  ubiquitin                                               324   9e-107   Ustilaginoidea virens
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            324   9e-107   Phaseolus vulgaris [French bean]
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             321   1e-106   Selaginella moellendorffii
ref|XP_001783045.1|  predicted protein                                  321   1e-106   
gb|AAB95250.1|  ubiquitin                                               323   1e-106   Arabidopsis thaliana [mouse-ear cress]
gb|KJB62487.1|  hypothetical protein B456_009G418900                    324   1e-106   Gossypium raimondii
ref|XP_001755431.1|  predicted protein                                  321   1e-106   
gb|ADO60140.1|  ubiquitin                                               320   1e-106   Beauveria bassiana
emb|CDP08567.1|  unnamed protein product                                326   1e-106   Coffea canephora [robusta coffee]
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   323   1e-106   Amanita muscaria Koide BX008
emb|CCT70325.1|  UBI4-Ubiquitin                                         323   1e-106   Fusarium fujikuroi IMI 58289
dbj|BAL61087.1|  polyubiquitin                                          321   1e-106   Dianthus caryophyllus [carnation]
gb|ADD52202.1|  ubiquitin                                               326   1e-106   Catharanthus roseus [chatas]
gb|ABI84246.1|  polyubiquitin 10                                        319   1e-106   Arachis hypogaea [goober]
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  320   1e-106   Paxillus rubicundulus Ve08.2h10
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    323   1e-106   Linum usitatissimum
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                323   1e-106   Serpula lacrymans var. lacrymans S7.3
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                326   2e-106   
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      323   2e-106   Camelina sativa [gold-of-pleasure]
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             327   2e-106   Phaseolus vulgaris [French bean]
gb|AFK47245.1|  unknown                                                 320   2e-106   Medicago truncatula
ref|XP_001764949.1|  predicted protein                                  323   2e-106   
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              320   2e-106   Pseudocercospora fijiensis CIRAD86
gb|AAQ07453.1|  ubiquitin                                               326   2e-106   Musa acuminata AAA Group [Cavendish banana]
gb|AAO43308.1|  putative polyubiquitin                                  321   2e-106   Arabidopsis thaliana [mouse-ear cress]
emb|CCL99875.1|  predicted protein                                      323   2e-106   Fibroporia radiculosa
gb|AIS71924.1|  polyubiquitin                                           320   2e-106   Mangifera indica
ref|XP_001931824.1|  ubiquitin                                          320   2e-106   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    323   2e-106   Phoenix dactylifera
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                324   2e-106   
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    323   2e-106   Populus euphratica
ref|XP_719867.1|  hypothetical protein CaO19.6771                       320   2e-106   Candida albicans SC5314
ref|XP_002872109.1|  predicted protein                                  325   2e-106   
ref|XP_006381473.1|  polyubiquitin family protein                       323   2e-106   
ref|XP_001828882.1|  ubiquitin C                                        323   2e-106   Coprinopsis cinerea okayama7#130
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  320   3e-106   Naumovozyma dairenensis CBS 421
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  323   3e-106   Botryobasidium botryosum FD-172 SS1
gb|KIR63773.1|  polyubiquitin                                           323   3e-106   Cryptococcus gattii CA1873
ref|XP_001555417.1|  polyubiquitin                                      323   3e-106   Botrytis cinerea B05.10
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             323   3e-106   Exserohilum turcica Et28A
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 323   3e-106   Scleroderma citrinum Foug A
gb|KJB62485.1|  hypothetical protein B456_009G418900                    323   3e-106   Gossypium raimondii
gb|EPX74297.1|  ubiquitin                                               320   3e-106   Schizosaccharomyces octosporus yFS286
gb|KIY45417.1|  ubiquitin                                               323   3e-106   Fistulina hepatica ATCC 64428
gb|KIY53974.1|  polyubiquitin                                           323   3e-106   Fistulina hepatica ATCC 64428
gb|AIY27743.1|  polyubiquitin Ubi10                                     323   3e-106   Betula luminifera [liang ye hua]
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         325   3e-106   Elaeis guineensis
emb|CEP60563.1|  LALA0S01e13784g1_1                                     320   3e-106   Lachancea lanzarotensis
ref|XP_003030030.1|  polyubiquitin                                      322   3e-106   Schizophyllum commune H4-8
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    320   3e-106   Parastagonospora nodorum SN15
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   322   3e-106   Sphaerobolus stellatus SS14
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      322   3e-106   Camelina sativa [gold-of-pleasure]
gb|KIR29996.1|  polyubiquitin                                           323   3e-106   Cryptococcus gattii VGII LA55
ref|XP_001598085.1|  polyubiquitin                                      322   3e-106   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_007763327.1|  polyubiquitin                                      322   4e-106   Coniophora puteana RWD-64-598 SS2
ref|NP_001105376.1|  polyubiquitin                                      325   4e-106   
ref|XP_003082269.1|  polyubiquitin (ISS)                                322   4e-106   
ref|XP_007339454.1|  ubiquitin                                          322   4e-106   
gb|AAX40652.1|  polyubiquitin                                           325   4e-106   Oryza sativa Japonica Group [Japonica rice]
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                325   4e-106   Erythranthe guttata [common monkey flower]
gb|KEH31155.1|  polyubiquitin 3                                         325   4e-106   Medicago truncatula
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                325   4e-106   Erythranthe guttata [common monkey flower]
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    325   4e-106   Setaria italica
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             325   4e-106   Eutrema salsugineum [saltwater cress]
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    325   4e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002508175.1|  ubiquitin                                          325   5e-106   Micromonas commoda
emb|CDP05795.1|  unnamed protein product                                325   5e-106   Coffea canephora [robusta coffee]
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      325   5e-106   Nelumbo nucifera [Indian lotus]
gb|ABU40645.1|  polyubiquitin                                           325   5e-106   Triticum aestivum [Canadian hard winter wheat]
gb|AAB68045.1|  polyubiquitin                                           325   5e-106   Fragaria x ananassa
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    325   5e-106   Nicotiana sylvestris
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      325   5e-106   Tarenaya hassleriana [spider flower]
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    325   5e-106   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             325   5e-106   
gb|AAL09741.1|  AT4g05320/C17L7_240                                     325   5e-106   Arabidopsis thaliana [mouse-ear cress]
emb|CEF99839.1|  Ubiquitin conserved site                               323   5e-106   Ostreococcus tauri
ref|NP_568397.1|  ubiquitin 4                                           325   5e-106   Arabidopsis thaliana [mouse-ear cress]
gb|KJB81825.1|  hypothetical protein B456_013G163500                    325   5e-106   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      325   5e-106   Nicotiana sylvestris
ref|NP_001174480.1|  Os05g0504766                                       325   5e-106   
ref|XP_001420612.1|  predicted protein                                  325   5e-106   Ostreococcus lucimarinus CCE9901
gb|ACS68205.1|  ubiquitin 10.2                                          325   5e-106   Brassica napus [oilseed rape]
gb|AAY86773.1|  polyubiquitin                                           325   5e-106   Noccaea caerulescens
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      325   5e-106   Nelumbo nucifera [Indian lotus]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        325   5e-106   
emb|CBY46746.1|  polyubiquitin 10 protein                               325   5e-106   Lepidium campestre [bastard cress]
gb|AAP80689.1|  polyubiquitin                                           320   5e-106   Griffithsia japonica
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         325   5e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             325   5e-106   
ref|NP_001148453.1|  LOC100282068                                       325   5e-106   Zea mays [maize]
ref|XP_007366816.1|  polyubiquitin                                      322   5e-106   Dichomitus squalens LYAD-421 SS1
ref|NP_849300.4|  polyubiquitin 10                                      325   5e-106   Arabidopsis thaliana [mouse-ear cress]
gb|AAB36545.1|  ubiquitin-like protein                                  325   6e-106   Phaseolus vulgaris [French bean]
gb|AIS40894.1|  polyubiquitin                                           327   6e-106   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      325   6e-106   Nelumbo nucifera [Indian lotus]
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      325   6e-106   Nicotiana tomentosiformis
gb|KJB13592.1|  hypothetical protein B456_002G083000                    325   6e-106   Gossypium raimondii
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         325   6e-106   Nicotiana tomentosiformis
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    325   6e-106   Camelina sativa [gold-of-pleasure]
ref|XP_002953480.1|  polyubiquitin                                      322   6e-106   Volvox carteri f. nagariensis
gb|AGM32540.1|  polyubiquitin-B-like isoform                            320   6e-106   Coptotermes formosanus
gb|AGV54228.1|  polyubiquitin-like protein                              324   6e-106   Phaseolus vulgaris [French bean]
dbj|GAA27344.2|  polyubiquitin-A                                        321   6e-106   Clonorchis sinensis [oriental liver fluke]
ref|XP_002891806.1|  predicted protein                                  325   6e-106   
gb|AAB95252.1|  ubiquitin                                               324   6e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    324   6e-106   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             324   6e-106   Capsella rubella
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      322   7e-106   Camelina sativa [gold-of-pleasure]
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   319   7e-106   Serendipita vermifera MAFF 305830
gb|KHJ83418.1|  ubiquitin family protein                                318   7e-106   Oesophagostomum dentatum [nodule worm]
ref|XP_003052575.1|  predicted protein                                  322   7e-106   [Nectria] haematococca mpVI 77-13-4
gb|EMS65864.1|  Polyubiquitin                                           325   7e-106   Triticum urartu
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  318   8e-106   Trichophyton benhamiae CBS 112371
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                325   9e-106   Pyrus x bretschneideri [bai li]
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           321   9e-106   Nicotiana tomentosiformis
ref|XP_002551324.1|  ubiquitin                                          321   1e-105   Candida tropicalis MYA-3404
gb|KJB81824.1|  hypothetical protein B456_013G163500                    324   1e-105   Gossypium raimondii
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      324   1e-105   Nicotiana tomentosiformis
gb|KJB62483.1|  hypothetical protein B456_009G418900                    324   1e-105   Gossypium raimondii
gb|EGA57707.1|  Ubi4p                                                   319   1e-105   Saccharomyces cerevisiae FostersB
ref|NP_001053957.1|  Os04g0628100                                       324   1e-105   
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             321   1e-105   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          318   1e-105   Bombus terrestris [large earth bumblebee]
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          318   1e-105   Coptotermes formosanus
gb|KDR10312.1|  Ubiquitin                                               318   1e-105   Zootermopsis nevadensis
ref|XP_006495477.1|  PREDICTED: polyubiquitin 3-like                    316   1e-105   Citrus sinensis [apfelsine]
gb|ETN78467.1|  ubiquitin family protein                                318   1e-105   Necator americanus
ref|XP_006372519.1|  polyubiquitin family protein                       321   1e-105   Populus trichocarpa [western balsam poplar]
dbj|GAA55031.1|  ubiquitin C                                            318   1e-105   Clonorchis sinensis [oriental liver fluke]
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     318   1e-105   Ancylostoma ceylanicum
gb|KJB69254.1|  hypothetical protein B456_011G016600                    315   1e-105   Gossypium raimondii
ref|XP_001755307.1|  predicted protein                                  321   1e-105   
gb|AAO42469.1|  putative polyubiquitin                                  320   2e-105   Arabidopsis lyrata [lyrate rockcress]
gb|ABF06579.2|  polyubiquitin                                           315   2e-105   Gladiolus grandiflorus
ref|XP_003619702.1|  Ubiquitin-like protein                             318   2e-105   
dbj|GAK65396.1|  ubiquitin                                              322   2e-105   Moesziomyces antarcticus
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    318   2e-105   Candida albicans
gb|ACA58351.1|  ubiquitin-like protein                                  316   2e-105   Sandersonia aurantiaca [Chinese-lantern lily]
gb|EPS29015.1|  hypothetical protein PDE_03961                          320   2e-105   Penicillium oxalicum 114-2
ref|XP_001830230.1|  ubiquitin                                          320   2e-105   Coprinopsis cinerea okayama7#130
ref|XP_001210780.1|  ubiquitin                                          320   2e-105   Aspergillus terreus NIH2624
gb|EZF98642.1|  polyubiquitin                                           318   2e-105   Trichophyton rubrum MR1459
gb|KEZ40313.1|  Polyubiquitin                                           320   2e-105   Scedosporium apiospermum
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  320   2e-105   Zygosaccharomyces bailii ISA1307
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     320   2e-105   Aspergillus fischeri NRRL 181
gb|AAV65292.1|  polyubiquitin                                           320   2e-105   Aspergillus fumigatus
ref|XP_001227036.1|  polyubiquitin                                      320   2e-105   Chaetomium globosum CBS 148.51
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                323   2e-105   Serpula lacrymans var. lacrymans S7.3
ref|XP_002839703.1|  hypothetical protein                               320   2e-105   Tuber melanosporum Mel28
gb|AAZ32851.1|  pentameric polyubiquitin                                316   2e-105   Medicago sativa [alfalfa]
ref|XP_003619701.1|  Ubiquitin-like protein                             320   2e-105   
ref|XP_009412006.1|  PREDICTED: polyubiquitin 11-like                   317   2e-105   
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 323   2e-105   Pleurotus ostreatus PC15
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    326   2e-105   
ref|XP_002419618.1|  ubiquitin, putative                                320   2e-105   Candida dubliniensis CD36
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             323   2e-105   Serpula lacrymans var. lacrymans S7.9
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           325   2e-105   Nicotiana sylvestris
gb|AEH41483.1|  ubiquitin                                               320   3e-105   Endocarpon pusillum
ref|XP_002494205.1|  Ubiquitin                                          320   3e-105   Komagataella phaffii GS115
gb|KIW56414.1|  polyubiquitin                                           320   3e-105   Exophiala xenobiotica
gb|EEH07231.1|  ubiquitin                                               320   3e-105   Histoplasma capsulatum G186AR
gb|AAC67552.1|  polyubiquitin                                           323   3e-105   Saccharum hybrid cultivar H32-8560
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  323   3e-105   Plicaturopsis crispa FD-325 SS-3
gb|EEH20847.2|  polyubiquitin                                           320   3e-105   Paracoccidioides brasiliensis Pb03
gb|AFC36452.1|  ubiquitin                                               317   3e-105   Anoectochilus roxburghii
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  323   3e-105   Galerina marginata CBS 339.88
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    317   3e-105   Sordaria macrospora k-hell
gb|ACB87916.1|  polyubiquitin 1                                         317   3e-105   Malus domestica [apple tree]
gb|AFP44113.1|  ubiquitin                                               316   3e-105   Lycoris longituba
gb|EJU00136.1|  ubiquitin                                               323   3e-105   Dacryopinax primogenitus
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  322   3e-105   Plicaturopsis crispa FD-325 SS-3
ref|XP_001880135.1|  ubiquitin                                          323   3e-105   
gb|AFR98116.1|  polyubiquitin                                           323   3e-105   
ref|XP_002791169.1|  ubiquitin                                          320   3e-105   
gb|EUC59758.1|  polyubiquitin                                           323   3e-105   
dbj|BAK61744.1|  ubiquitin                                              317   3e-105   
dbj|BAP70433.1|  Ubiquitin                                              320   3e-105   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  323   3e-105   
ref|XP_010756991.1|  polyubiquitin                                      320   3e-105   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         320   3e-105   
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      325   3e-105   
gb|EEQ88150.1|  ubiquitin                                               320   3e-105   
gb|AAO43309.1|  putative polyubiquitin                                  318   3e-105   
ref|XP_002888365.1|  polyubiquitin                                      325   3e-105   
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                325   3e-105   
gb|AGT38457.1|  polyubiquitin                                           326   3e-105   
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    322   3e-105   
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                322   3e-105   
ref|XP_003196661.1|  ATP-dependent protein binding protein              322   3e-105   
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          325   4e-105   
gb|ACX46987.1|  ubiquitin                                               325   4e-105   
gb|AAL91103.1|  ubiquitin                                               318   4e-105   
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         325   4e-105   
ref|XP_007864655.1|  ubiquitin                                          322   4e-105   
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                325   4e-105   
gb|AAD03343.1|  ubiquitin                                               325   4e-105   
gb|AAB95251.1|  ubiquitin                                               325   4e-105   
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      325   4e-105   
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             325   4e-105   
tpd|FAA00317.1|  TPA: polyubiquitin                                     320   4e-105   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  320   4e-105   
dbj|BAK03691.1|  predicted protein                                      325   4e-105   
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             322   4e-105   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        317   4e-105   
ref|XP_004341200.1|  polyubiquitin, putative                            317   4e-105   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    322   4e-105   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  322   4e-105   
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   325   4e-105   
dbj|BAK02501.1|  predicted protein                                      325   4e-105   
gb|AAO43306.1|  putative polyubiquitin                                  320   4e-105   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    320   4e-105   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    322   4e-105   
dbj|BAJ91912.1|  predicted protein                                      325   4e-105   
emb|CCG34086.1|  Polyubiquitin                                          320   4e-105   
emb|CAA40324.1|  hexaubiquitin protein                                  325   4e-105   
ref|NP_001045980.1|  Os02g0161900                                       325   4e-105   
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    325   4e-105   
ref|NP_849299.4|  polyubiquitin 10                                      325   4e-105   
ref|XP_659604.1|  hypothetical protein AN2000.2                         320   4e-105   
emb|CAB81074.1|  polyubiquitin (ubq10)                                  325   4e-105   
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           325   5e-105   
dbj|BAH71115.1|  ACYPI006410                                            317   5e-105   
gb|KJB81827.1|  hypothetical protein B456_013G163500                    325   5e-105   
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           325   5e-105   
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    325   5e-105   
gb|KIY97628.1|  ubiquitin C                                             320   5e-105   
gb|KJB13590.1|  hypothetical protein B456_002G083000                    325   5e-105   
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      325   5e-105   
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             325   5e-105   
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           325   5e-105   
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                325   5e-105   
gb|AAC16012.1|  polyubiquitin                                           325   5e-105   
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           325   5e-105   
gb|ACN40936.1|  unknown                                                 325   5e-105   
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           325   5e-105   
ref|XP_007049060.1|  Polyubiquitin 10                                   325   5e-105   
ref|XP_005644220.1|  polyubiquitin                                      319   6e-105   
gb|EMS24129.1|  ubiquitin C                                             317   6e-105   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      325   6e-105   
gb|AFW70219.1|  polyubiquitin-like protein                              326   6e-105   
emb|CAA52290.1|  polyubiquitin                                          322   6e-105   
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      319   6e-105   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   317   6e-105   
gb|EJD76734.1|  polyubiquitin, variant 2                                320   7e-105   
dbj|GAA87419.1|  polyubiquitin                                          319   7e-105   
gb|AFD53810.1|  ubiquitin                                               317   7e-105   
ref|XP_001246797.1|  polyubiquitin                                      319   8e-105   
emb|CCO30833.1|  Polyubiquitin                                          323   8e-105   
ref|XP_002888394.1|  hexaubiquitin protein                              325   8e-105   
ref|XP_002842034.1|  hypothetical protein                               319   9e-105   
ref|XP_001538486.1|  polyubiquitin                                      319   9e-105   
gb|ACJ85658.1|  unknown                                                 316   9e-105   
emb|CCA16073.1|  polyubiquitin putative                                 327   1e-104   
ref|XP_007808982.1|  ubiquitin                                          320   1e-104   
gb|AAA82978.1|  polyubiquitin                                           321   1e-104   
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          324   1e-104   
gb|AFW66445.1|  ubiquitin2                                              326   1e-104   
gb|AIZ74335.1|  polyubiquitin 3                                         316   1e-104   
dbj|BAK61751.1|  ubiquitin                                              315   1e-104   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             321   1e-104   
ref|XP_005831810.1|  ubiquitin                                          315   1e-104   
ref|XP_001777816.1|  predicted protein                                  321   1e-104   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    326   1e-104   
dbj|BAL61084.1|  polyubiqutin                                           321   1e-104   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             321   1e-104   
gb|ABV22331.1|  ubiquitin                                               318   2e-104   
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    323   2e-104   
gb|AAL91109.1|  ubiquitin                                               318   2e-104   
ref|XP_004365491.1|  polyubiquitin 5                                    315   2e-104   
emb|CAJ41447.1|  polyubiquitin                                          318   2e-104   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         318   2e-104   
emb|CDI53149.1|  probable Polyubiquitin protein                         318   2e-104   
ref|NP_013061.1|  ubiquitin                                             321   2e-104   
gb|ACT82769.1|  polyubiquitin                                           313   2e-104   
gb|ELR08709.1|  polyubiquitin                                           320   2e-104   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  321   2e-104   
tpd|FAA00316.1|  TPA: polyubiquitin                                     320   2e-104   
ref|XP_011388891.1|  putative ubiquitin                                 323   2e-104   
ref|XP_453980.1|  hypothetical protein                                  320   2e-104   
gb|EFN76024.1|  Ubiquitin                                               315   2e-104   
gb|ESA16475.1|  hypothetical protein GLOINDRAFT_345541                  315   2e-104   
ref|XP_011275993.1|  ubiquitin C                                        320   2e-104   
gb|AAR32784.1|  polyubiquitin                                           315   2e-104   
dbj|BAO38900.1|  ubiquitin                                              320   3e-104   
ref|XP_007861169.1|  polyubiquitin                                      323   3e-104   
ref|XP_567862.1|  ATP-dependent protein binding protein                 323   3e-104   
gb|AAO43310.1|  putative polyubiquitin                                  315   3e-104   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             320   3e-104   
ref|NP_983342.1|  ACL062Cp                                              320   3e-104   
tpd|FAA00319.1|  TPA: polyubiquitin                                     323   3e-104   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           325   3e-104   
ref|XP_958803.1|  ubiquitin                                             317   3e-104   
ref|XP_003290908.1|  ubiquitin                                          315   3e-104   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              325   3e-104   
ref|XP_007307433.1|  polyubiquitin                                      323   3e-104   
ref|XP_002171731.1|  ubiquitin                                          320   3e-104   
emb|CAA51679.1|  ubiquitin                                              325   3e-104   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   323   3e-104   
ref|XP_002627625.1|  ubiquitin                                          320   3e-104   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      325   3e-104   
gb|ABD32351.2|  Ubiquitin                                               325   3e-104   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      320   3e-104   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                325   3e-104   
gb|ADD24466.1|  Ubiquitin                                               315   3e-104   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    325   3e-104   
gb|KFY77115.1|  hypothetical protein V499_03430                         320   3e-104   
ref|NP_595409.1|  ubiquitin                                             320   3e-104   
ref|XP_008034069.1|  ubiquitin 10.1                                     323   3e-104   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       320   3e-104   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           325   3e-104   
ref|XP_003608276.1|  Ubiquitin                                          325   3e-104   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           325   3e-104   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          325   4e-104   
ref|XP_003627151.1|  Ubiquitin                                          325   4e-104   
ref|XP_003607670.1|  Ubiquitin                                          325   4e-104   
emb|CAD27944.1|  polyubiquitin-like                                     314   4e-104   
gb|AAO43305.1|  putative polyubiquitin                                  318   4e-104   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                320   4e-104   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      325   4e-104   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                325   4e-104   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                325   4e-104   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    325   4e-104   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    325   4e-104   
ref|XP_002674746.1|  polyubiquitin                                      314   5e-104   
ref|XP_001018501.1|  Ubiquitin family protein                           314   5e-104   
ref|XP_002771956.1|  polyubiquitin, putative                            314   5e-104   
gb|KIZ01427.1|  ubiquitin C                                             320   5e-104   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    318   5e-104   
gb|KFY10578.1|  hypothetical protein V492_04946                         321   6e-104   
gb|EWS74283.1|  polyubiquitin                                           314   6e-104   
ref|XP_001766873.1|  predicted protein                                  318   6e-104   
emb|CDP91931.1|  Protein Bm3564, isoform e                              319   6e-104   
ref|XP_008816966.1|  polyubiquitin                                      317   6e-104   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     324   6e-104   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           325   6e-104   
ref|XP_003142560.1|  ubiquitin C II                                     320   6e-104   
gb|AAC13691.1|  poly-ubiquitin                                          319   6e-104   
gb|AAY33920.2|  polyubiquitin                                           319   7e-104   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    319   7e-104   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      324   7e-104   
gb|AFQ60003.1|  polyubiquitin                                           315   7e-104   
pir||T02358  ubiquitin homolog T8F5.13 - Arabidopsis thaliana           317   8e-104
gb|AGH70140.1|  ubiquitin family protein                                312   8e-104   
emb|CAC94926.1|  putative ubiquitin                                     314   9e-104   
gb|KIY97324.1|  ubiquitin C                                             311   9e-104   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           324   1e-103   
ref|XP_001774326.1|  predicted protein                                  321   1e-103   
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    323   1e-103   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             321   1e-103   
ref|XP_001018499.1|  Ubiquitin family protein                           313   1e-103   
gb|EMS60894.1|  Polyubiquitin                                           321   1e-103   
ref|NP_176714.4|  ubiquitin 13                                          316   1e-103   
ref|XP_011298607.1|  PREDICTED: polyubiquitin isoform X1                318   1e-103   
gb|AAQ94569.1|  ubiquitin C                                             313   1e-103   
ref|XP_001897032.1|  polyubiquitin precursor                            319   1e-103   
ref|XP_001486573.1|  ubiquitin                                          321   2e-103   
gb|AAO43304.1|  putative polyubiquitin                                  316   2e-103   
ref|XP_460488.1|  DEHA2F02816p                                          321   2e-103   
gb|EXX74854.1|  ubiquitin                                               312   2e-103   
gb|ABI53721.1|  polyubiquitin                                           320   2e-103   
gb|AAO43303.1|  putative polyubiquitin                                  316   2e-103   
gb|AFQ02685.1|  polyubiquitin                                           318   2e-103   
ref|XP_003331105.1|  polyubiquitin-A                                    325   2e-103   
emb|CAA72799.1|  polyubiquitin precursor                                318   2e-103   
gb|EJD76736.1|  polyubiquitin, variant 1                                318   2e-103   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      325   2e-103   
ref|XP_002870459.1|  polyubiquitin                                      323   2e-103   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       313   2e-103   
ref|XP_003607659.1|  Ubiquitin                                          313   2e-103   
gb|KHN45015.1|  Polyubiquitin-A                                         325   3e-103   
gb|ACH45547.1|  putative ubiquitin C variant 1                          311   3e-103   
ref|XP_006306291.1|  hypothetical protein CARUB_v10012156mg             320   3e-103   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         325   3e-103   
gb|KHN74847.1|  Polyubiquitin-A                                         318   3e-103   
tpg|DAA34473.1|  TPA: ubiquitin                                         313   3e-103   
ref|XP_002498336.1|  ZYRO0G07854p                                       320   3e-103   
gb|EIE87024.1|  polyubiquitin                                           312   3e-103   
gb|KIJ26545.1|  hypothetical protein M422DRAFT_216245                   323   3e-103   
sp|P23324.2|UBIQP_EUPEU  RecName: Full=Polyubiquitin; Contains: R...    312   3e-103   
ref|XP_001947010.1|  PREDICTED: polyubiquitin-G                         317   3e-103   
ref|XP_010669246.1|  PREDICTED: polyubiquitin-like                      320   3e-103   
emb|CBY16339.1|  unnamed protein product                                310   3e-103   
gb|AFW66438.1|  putative ubiquitin family protein                       316   4e-103   
ref|XP_008796191.1|  PREDICTED: polyubiquitin-like                      315   4e-103   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              313   4e-103   
ref|XP_005650632.1|  hexaubiquitin protein                              320   4e-103   
dbj|BAF00213.1|  polyubiquitin 4 UBQ4                                   316   4e-103   
dbj|BAB63443.1|  ubiquitin 2                                            311   4e-103   
ref|XP_002676592.1|  polyubiquitin                                      315   4e-103   
ref|XP_001018498.1|  Ubiquitin family protein                           314   4e-103   
gb|EWS73799.1|  polyubiquitin                                           314   4e-103   
ref|XP_002553736.1|  KLTH0E05852p                                       318   5e-103   



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   329 bits (843),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 180/204 (88%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP P + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   297 bits (760),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   327 bits (837),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   317 bits (812),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  546
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  234


 Score =   204 bits (520),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/105 (98%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  387
            IQKESTLHLVLRLRGGMQIFVKT TGKTITLE ESSDTIDNVKAK
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKAK  257



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   325 bits (833),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLR  522
            FAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLR  226



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   325 bits (832),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   279 bits (714),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKE  492
            FAGKQLEDGRTLADYNIQKE
Sbjct  197  FAGKQLEDGRTLADYNIQKE  216



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   325 bits (833),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   304 bits (778),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   327 bits (837),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = +1

Query  70   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  249
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  20   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  79

Query  250  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  429
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  80   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  430  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*x  609
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +    
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  610  lrsrtrrEFPPDQQXAYXSPGKQLE  684
             + + +   PPDQQ    + GKQLE
Sbjct  200  AKIQDKEGIPPDQQRLIFA-GKQLE  223


 Score =   316 bits (810),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  546
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  254


 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/109 (99%), Positives = 108/109 (99%), Gaps = 0/109 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  173  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  232

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  399
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVKAKIQDK
Sbjct  233  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKAKIQDK  281


 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = +1

Query  286  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  465
            RL+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  75

Query  466  LADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xlrsrtrrEFPPD  645
            LADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     + + +   PPD
Sbjct  76   LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  135

Query  646  QQXAYXSPGKQLE  684
            QQ    + GKQLE
Sbjct  136  QQRLIFA-GKQLE  147



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   332 bits (851),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +1

Query  40   DYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  219
            D  +FS L +KMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  34   DLSKFSSLRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQ  93

Query  220  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  399
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  94   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  153

Query  400  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRL  579
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +
Sbjct  154  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  213

Query  580  KAltqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            ++   +     + + +   PPDQQ    + GKQLE
Sbjct  214  ESSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  247


 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  121  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  180

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  181  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  240

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  241  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKA  300

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  301  KIQDKEGIPPDQQRLIFA-GKQLE  323


 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  197  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  256

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  257  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  316

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  317  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  376

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  377  KIQDKEGIPPDQQRLIFA-GKQLE  399


 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  273  MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  332

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  333  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  392

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  393  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  424



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   327 bits (837),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = +1

Query  67   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246
            +KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   IKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  166

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*  606
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +   
Sbjct  167  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  226

Query  607  xlrsrtrrEFPPDQQXAYXSPGKQLE  684
              + + +   PPDQQ    + GKQLE
Sbjct  227  KAKIQDKEGIPPDQQRLIFA-GKQLE  251


 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  244

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  245  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   325 bits (832),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   304 bits (779),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  229



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   325 bits (832),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   306 bits (784),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   326 bits (835),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKA  585
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  247


 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%), Gaps = 0/101 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  375
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   325 bits (832),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   325 bits (832),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   305 bits (781),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  540
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+  F
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGLTGF  232



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   325 bits (832),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   325 bits (832),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   325 bits (832),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GR  690
            + + +   PPDQQ    + GKQLE GR
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLEDGR  206


 Score =   295 bits (756),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 148/149 (99%), Gaps = 0/149 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRL  519
            FAGKQLEDGRTLADYNIQKESTLHLVLR 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRF  225



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   324 bits (831),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   304 bits (778),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   324 bits (831),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   302 bits (773),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   324 bits (831),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   304 bits (779),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   324 bits (831),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   324 bits (831),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (776),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   324 bits (831),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (776),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   324 bits (831),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   324 bits (831),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (776),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 185/216 (86%), Gaps = 2/216 (1%)
 Frame = +1

Query  37   CDYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  216
             + FR +IL  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  15   SNLFR-TILSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  73

Query  217  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  396
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  74   QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  133

Query  397  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWR  576
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   
Sbjct  134  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  193

Query  577  LKAltqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            +++   +     + + +   PPDQQ    + GKQLE
Sbjct  194  VESSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  228


 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  102  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  161

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  162  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  221

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  222  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  281

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  282  KIQDKEGIPPDQQRLIFA-GKQLE  304


 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  178  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  297

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  298  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  357

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  358  KIQDKEGIPPDQQRLIFA-GKQLE  380


 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  254  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  313

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  314  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  373

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  374  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  405



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   324 bits (831),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   324 bits (831),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   325 bits (833),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  201  KIQDKEGIPPDQQRLIFA-GKQLE  223


 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +1

Query  241  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  420
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  421  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqli  600
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   + 
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  601  t*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
                + + +   PPDQQ    + GKQLE
Sbjct  121  NVKAKIQDKEGIPPDQQRLIFA-GKQLE  147



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   324 bits (831),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (772),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   324 bits (831),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   327 bits (837),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 181/209 (87%), Gaps = 2/209 (1%)
 Frame = +1

Query  67   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  26   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  85

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  86   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  145

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*  606
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +   
Sbjct  146  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  205

Query  607  xlrsrtrrEFPPDQQXAYXSPGKQLE-GR  690
              + + +   PPDQQ    + GKQLE GR
Sbjct  206  KAKIQDKEGIPPDQQRLIFA-GKQLEDGR  233


 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  104  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  163

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  164  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  223

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKA  585
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++
Sbjct  224  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  274


 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/112 (99%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  180  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  239

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  408
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+
Sbjct  240  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGI  635
            +TLTGKTITLEVESSDTIDNV AKIQDKEG+
Sbjct  261  KTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   327 bits (837),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 181/210 (86%), Gaps = 2/210 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GRPYP  699
            + + +   PPDQQ    + GKQLE GR  P
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLEDGRTLP  285


 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLPDYNIQKESTLHLVLRLRGG  304



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   325 bits (834),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   316 bits (810),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  546
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  234


 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 117/152 (77%), Gaps = 35/152 (23%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTIT                              
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTIT------------------------------  242

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
                 LEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  243  -----LEDGRTLADYNIQKESTLHLVLRLRGG  269



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   327 bits (837),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GR  690
            + + +   PPDQQ    + GKQLE GR
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLEDGR  206


 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/146 (100%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLV  510
            FAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLV  222



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   323 bits (829),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 182/224 (81%), Gaps = 1/224 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLEGRPYPXPTTISRKEVXPFTL  744
            + + +   PPDQQ    + GKQLE         I ++   P  L
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLEDGRTLADYNIQKESTLPLVL  223


 Score =   298 bits (763),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTL LVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLPLVLRLRGG  228



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   323 bits (829),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   325 bits (832),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  96

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  216

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  217  KIQDKEGIPPDQQRLIFA-GKQLE  239


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  113  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  172

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  173  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  232

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  233  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  264


 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +1

Query  193  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  372
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  373  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*  552
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  120

Query  553  PARLLPWRLKAltqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
              + +   +++   +     + + +   PPDQQ    + GKQLE
Sbjct  121  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  163



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   324 bits (831),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 181/216 (84%), Gaps = 1/216 (0%)
 Frame = +1

Query  37   CDYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  216
            CD   F      MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  13   CDLEDFLECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  72

Query  217  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  396
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  73   QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  132

Query  397  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWR  576
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   
Sbjct  133  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  192

Query  577  LKAltqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            +++   +     + + +   PPDQQ    + GKQLE
Sbjct  193  VESSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  227


 Score =   304 bits (779),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/161 (96%), Positives = 156/161 (97%), Gaps = 2/161 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  101  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  160

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  161  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  220

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--MQIFVKP  549
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  MQ  + P
Sbjct  221  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLNP  261



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   323 bits (828),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris]
Length=229

 Score =   323 bits (828),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 183/224 (82%), Gaps = 1/224 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLEGRPYPXPTTISRKEVXPFTL  744
            + + +   PPDQQ    + GKQLE         I ++   P  L
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLEDGCTLADYNIQKEFTLPLVL  223


 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/153 (95%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDG TLADYNIQKE TL LVL  RGG 
Sbjct  197  FAGKQLEDGCTLADYNIQKEFTLPLVLCFRGGF  229



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   323 bits (827),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + + + PPDQQ    + GKQLE
Sbjct  181  KIQDKEDIPPDQQRLIFA-GKQLE  203


 Score =   298 bits (764),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   324 bits (831),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = +1

Query  67   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  39   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  98

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  99   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  158

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*  606
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +   
Sbjct  159  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  218

Query  607  xlrsrtrrEFPPDQQXAYXSPGKQLE  684
              + + +   PPDQQ    + GKQLE
Sbjct  219  KAKIQDKEGIPPDQQRLIFA-GKQLE  243


 Score =   302 bits (773),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  117  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  176

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  177  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  236

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  237  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   325 bits (832),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  12   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  71

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  72   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  131

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  132  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  191

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  192  KIQDKEGIPPDQQRLIFA-GKQLE  214


 Score =   321 bits (823),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  88   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  147

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  148  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  207

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  208  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  267

Query  613  rsrtrrEFPPDQQ  651
            + + +   PPDQQ
Sbjct  268  KIQDKEGIPPDQQ  280


 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/118 (100%), Positives = 118/118 (100%), Gaps = 0/118 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  164  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  223

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  426
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  224  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281


 Score =   197 bits (501),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = +1

Query  268  TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  447
            TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  60

Query  448  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xlrsrtr  627
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     + + +
Sbjct  61   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  120

Query  628  rEFPPDQQXAYXSPGKQLE  684
               PPDQQ    + GKQLE
Sbjct  121  EGIPPDQQRLIFA-GKQLE  138



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   323 bits (827),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   323 bits (827),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (772),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   322 bits (826),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   322 bits (826),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   322 bits (826),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   322 bits (826),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (771),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   322 bits (826),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (772),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  229



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKES  495
            FAGKQLEDGRTLADYNIQKE+
Sbjct  273  FAGKQLEDGRTLADYNIQKEN  293



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   324 bits (830),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   ++    +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   320 bits (820),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQ  651
            + + +   PPDQQ
Sbjct  257  KIQDKEGIPPDQQ  269



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   322 bits (826),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (771),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   322 bits (825),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   304 bits (778),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   323 bits (827),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   304 bits (778),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 155/161 (96%), Positives = 156/161 (97%), Gaps = 2/161 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--MQIFVKP  549
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  MQ  + P
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGALMQWCLNP  237



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (772),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/151 (100%), Positives = 151/151 (100%), Gaps = 0/151 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  525
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   326 bits (836),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GR  690
            + + +   PPDQQ    + GKQLE GR
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLEDGR  206


 Score =   326 bits (836),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GR  690
            + + +   PPDQQ    + GKQLE GR
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLEDGR  282


 Score =   317 bits (812),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKA  585
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  323


 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/106 (100%), Positives = 106/106 (100%), Gaps = 0/106 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  390
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  334



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   305 bits (780),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = +1

Query  70   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  249
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  82   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  141

Query  250  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  429
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  142  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  430  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*x  609
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +    
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  261

Query  610  lrsrtrrEFPPDQQXAYXSPGKQLE  684
             + + +   PPDQQ    + GKQLE
Sbjct  262  AKIQDKEGIPPDQQRLIFA-GKQLE  285


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  159  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  218

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  219  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  278

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  279  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310


 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 161/212 (76%), Gaps = 11/212 (5%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  253  IQKESTLHLVLR--------LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  408
              + +  H             R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  61   FARNA--HTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  118

Query  409  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAl  588
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++ 
Sbjct  119  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  178

Query  589  tqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
              +     + + +   PPDQQ    + GKQLE
Sbjct  179  DTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  209



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   325 bits (832),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  68   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  127

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  128  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  187

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  188  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  247

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  248  KIQDKEGIPPDQQRLIFA-GKQLE  270


 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 169/195 (87%), Gaps = 1/195 (1%)
 Frame = +1

Query  100  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  279
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  280  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  459
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  460  RTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xlrsrtrrEFP  639
            RTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     + + +   P
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  180

Query  640  PDQQXAYXSPGKQLE  684
            PDQQ    + GKQLE
Sbjct  181  PDQQRLIFA-GKQLE  194


 Score =   303 bits (777),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  144  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  203

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  204  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  263

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  264  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  295



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQEKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   325 bits (833),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (833),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   304 bits (779),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  305



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   304 bits (779),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  128  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  187

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  188  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  247

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  248  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  307

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  308  KIQDKEGIPPDQQRLIFA-GKQLE  330


 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  204  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  263

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  264  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  323

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  324  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355


 Score =   303 bits (775),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 178/255 (70%), Gaps = 52/255 (20%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  177
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  178  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  279
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  280  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  459
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  460  RTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xlrsrtrrEFP  639
            RTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     + + +   P
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240

Query  640  PDQQXAYXSPGKQLE  684
            PDQQ    + GKQLE
Sbjct  241  PDQQRLIFA-GKQLE  254



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   325 bits (833),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (833),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   310 bits (795),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  540
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIL  308



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GR  690
            + + +   PPDQQ    + GKQLE GR
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLEDGR  206


 Score =   317 bits (812),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  546
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  234


 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/110 (99%), Positives = 110/110 (100%), Gaps = 0/110 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  402
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK+
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKE  629
            +TLTGKTITLEVESSDTIDNV AKIQDK+
Sbjct  234  KTLTGKTITLEVESSDTIDNVKAKIQDKK  262



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>prf||1604470A poly-ubiquitin
Length=272

 Score =   323 bits (829),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  44   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  103

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  104  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  163

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  164  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  223

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  224  KIQDKEGIPPDQQRLIFA-GKQLE  246


 Score =   303 bits (775),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  120  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  179

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  180  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  239

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  240  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   260 bits (664),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +1

Query  175  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  354
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  355  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  534
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  121

Query  535  IFVKP*PARLLPWRLKAltqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            IFVK    + +   +++   +     + + +   PPDQQ    + GKQLE
Sbjct  122  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  170



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   325 bits (833),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 181/210 (86%), Gaps = 1/210 (0%)
 Frame = +1

Query  55   SILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  234
            S+L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  9    SLLAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  68

Query  235  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  414
            TL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  69   TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  128

Query  415  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltq  594
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   
Sbjct  129  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  188

Query  595  lit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            +     + + +   PPDQQ    + GKQLE
Sbjct  189  IDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  217


 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  91   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  150

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  151  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  210

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  211  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  270

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  271  KIQDKEGIPPDQQRLIFA-GKQLE  293


 Score =   302 bits (774),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  167  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  226

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  227  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  286

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  287  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   324 bits (830),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   323 bits (828),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  222  KIQDKEGIPPDQQRLIFA-GKQLE  244


 Score =   303 bits (775),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  269


 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = +1

Query  178  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  357
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  358  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  537
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  538  FVKP*PARLLPWRLKAltqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            FVK    + +   +++   +     + + +   PPDQQ    + GKQLE
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  168



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   322 bits (825),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   322 bits (825),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   322 bits (825),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   322 bits (824),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   P DQQ    + GKQLE
Sbjct  181  KIQDKEGIPLDQQRLIFA-GKQLE  203


 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   324 bits (830),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   322 bits (826),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  19   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  78

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  79   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  138

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  139  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  198

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  199  KIQDKEGIPPDQQRLIFA-GKQLE  221


 Score =   302 bits (773),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  95   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  154

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  155  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  215  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = +1

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*  606
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +   
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  120

Query  607  xlrsrtrrEFPPDQQXAYXSPGKQLE  684
              + + +   PPDQQ    + GKQLE
Sbjct  121  KAKIQDKEGIPPDQQRLIFA-GKQLE  145



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   304 bits (778),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   324 bits (831),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   324 bits (831),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   324 bits (831),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 174/204 (85%), Gaps = 9/204 (4%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++         
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDIQDKEG-  255

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
                    PPDQQ    + GKQLE
Sbjct  256  -------IPPDQQRLIFA-GKQLE  271


 Score =   281 bits (718),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 144/152 (95%), Gaps = 8/152 (5%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD        IQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGIPPDQQRLI  264

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  296



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   324 bits (831),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   324 bits (831),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   324 bits (831),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   324 bits (831),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQL+
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLD  279


 Score =   302 bits (773),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   323 bits (827),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  36   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  95

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  96   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  155

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  156  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  215

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  216  KIQDKEGIPPDQQRLIFA-GKQLE  238


 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  112  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  171

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  172  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  231

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  232  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   195 bits (495),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = +1

Query  229  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  408
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  409  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAl  588
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++ 
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  589  tqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
              +     + + +   PPDQQ    + GKQLE
Sbjct  132  DTIDNVKTKIQDKEGIPPDQQRLIFA-GKQLE  162



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   304 bits (778),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   325 bits (832),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  183

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  184  KIQDKEGIPPDQQRLIFA-GKQLE  206


 Score =   325 bits (832),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  80   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  139

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  140  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  200  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  259

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  260  KIQDKEGIPPDQQRLIFA-GKQLE  282


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  156  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  215

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  216  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  275

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  276  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  307


 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 105/131 (80%), Gaps = 1/131 (1%)
 Frame = +1

Query  292  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  471
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  472  DYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xlrsrtrrEFPPDQQ  651
            DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     + + +   PPDQQ
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  120

Query  652  XAYXSPGKQLE  684
                + GKQLE
Sbjct  121  RLIFA-GKQLE  130



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007154494.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26488.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=193

 Score =   320 bits (820),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   ++    +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQ  651
            + + +   PPDQQ
Sbjct  181  KIQDKEGIPPDQQ  193



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   325 bits (833),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  29   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  88

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  89   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  148

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  149  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  208

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  209  KIQDKEGIPPDQQRLIFA-GKQLE  231


 Score =   325 bits (833),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  105  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  164

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  165  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  224

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  225  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  284

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  285  KIQDKEGIPPDQQRLIFA-GKQLE  307


 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  181  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  240

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  241  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  300

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  301  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = +1

Query  256  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  435
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  436  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xlr  615
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     +
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  133

Query  616  srtrrEFPPDQQXAYXSPGKQLE  684
             + +   PPDQQ    + GKQLE
Sbjct  134  IQDKEGIPPDQQRLIFA-GKQLE  155



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   323 bits (828),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  46   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  105

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  106  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  165

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  166  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  225

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  226  KIQDKEGIPPDQQRLIFA-GKQLE  248


 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  122  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  181

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  182  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  241

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  242  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  273


 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 147/173 (85%), Gaps = 1/173 (1%)
 Frame = +1

Query  166  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  345
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  346  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  525
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  526  GMQIFVKP*PARLLPWRLKAltqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            GMQIFVK    + +   +++   +     + + +   PPDQQ    + GKQLE
Sbjct  121  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  172



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   325 bits (834),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (834),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKA  585
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  323


 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  411
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIP  638
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIP
Sbjct  310  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   324 bits (831),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   324 bits (831),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   325 bits (834),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 179/205 (87%), Gaps = 1/205 (0%)
 Frame = +1

Query  70   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  249
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  36   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  95

Query  250  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  429
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  96   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  430  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*x  609
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +    
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  610  lrsrtrrEFPPDQQXAYXSPGKQLE  684
             + + +   PPDQQ    + GKQLE
Sbjct  216  AKIQDKEGIPPDQQRLIFA-GKQLE  239


 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  113  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  172

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  173  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  232

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  233  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  292

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  293  KIQDKEGIPPDQQRLIFA-GKQLE  315


 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  189  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  248

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  249  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  308

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  309  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   323 bits (828),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  546
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  234


 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  348
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  244



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   321 bits (823),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   324 bits (830),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   324 bits (830),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (772),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   325 bits (834),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  222  KIQDKEGIPPDQQRLIFA-GKQLE  244


 Score =   325 bits (834),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  297

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  298  KIQDKEGIPPDQQRLIFA-GKQLE  320


 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/151 (100%), Positives = 151/151 (100%), Gaps = 0/151 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  194  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  253

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  254  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  313

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  525
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  314  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 143/204 (70%), Gaps = 36/204 (18%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  145

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  146  KIQDKEGIPPDQQRLIFA-GKQLE  168



>ref|XP_010493589.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=430

 Score =   328 bits (841),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 181/211 (86%), Gaps = 1/211 (0%)
 Frame = +1

Query  52   FSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  231
             +IL  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  41   LAILSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  100

Query  232  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  411
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  101  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  160

Query  412  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAlt  591
            PDQQRLIFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++  
Sbjct  161  PDQQRLIFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  220

Query  592  qlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
             +     + + +   PPDQQ    + GKQLE
Sbjct  221  TIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  250


 Score =   325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  200  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  259

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  260  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  319

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  320  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  379

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  380  KIQDKEGIPPDQQRLIFA-GKQLE  402


 Score =   323 bits (828),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYN
Sbjct  124  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGHTLADYN  183

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  184  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  243

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  244  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  303

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  304  KIQDKEGIPPDQQRLIFA-GKQLE  326


 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  276  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  335

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  336  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  395

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  396  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  427



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   324 bits (830),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   324 bits (830),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   324 bits (830),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   ++    +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   321 bits (822),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   321 bits (822),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   304 bits (778),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   321 bits (822),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   297 bits (761),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/151 (99%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  525
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227



>gb|ADO60140.1| ubiquitin [Beauveria bassiana]
Length=215

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/139 (97%), Positives = 139/139 (100%), Gaps = 0/139 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQK  489
            FAGKQLEDGRTL+DYNIQK
Sbjct  197  FAGKQLEDGRTLSDYNIQK  215



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   326 bits (835),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 181/214 (85%), Gaps = 1/214 (0%)
 Frame = +1

Query  43   YFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  222
            Y  F     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  44   YLVFCFSSHKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  103

Query  223  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  402
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  104  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  163

Query  403  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLK  582
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   ++
Sbjct  164  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  223

Query  583  Altqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            +   +     + + +   PPDQQ    + GKQLE
Sbjct  224  SSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  256


 Score =   323 bits (829),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 185/221 (84%), Gaps = 6/221 (3%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  130  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  189

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  190  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  249

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  250  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  309

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GRPYP----XPTTISR  720
            + + +   PPDQQ    + GKQLE GR        P T+SR
Sbjct  310  KIQDKEGIPPDQQRLIFA-GKQLEDGRTLADYNITPLTMSR  349



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   302 bits (773),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  53   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  112

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  113  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  172

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  173  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  232

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  233  KIQDKEGIPPDQQRLIFA-GKQLE  255


 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  129  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  188

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  189  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  248

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  249  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280


 Score =   262 bits (669),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 154/204 (75%), Gaps = 25/204 (12%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDN                        LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDN------------------------LEDGRTLSDYN  36

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  156

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  157  KIQDKEGIPPDQQRLIFA-GKQLE  179



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   321 bits (822),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   300 bits (767),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/222 (77%), Positives = 184/222 (83%), Gaps = 7/222 (3%)
 Frame = +1

Query  37   CDYFRFSILFL------KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  198
            C+  + S L L       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  CNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  199  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  378
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  254

Query  379  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PA  558
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    
Sbjct  255  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  314

Query  559  RLLPWRLKAltqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            + +   +++   +     + + +   PPDQQ    + GKQLE
Sbjct  315  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLILA-GKQLE  355


 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  77   MQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 175/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
             AGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  LAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   319 bits (818),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQ  648
            + + +   PPDQ
Sbjct  181  KIQDKEGIPPDQ  192



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  222  KIQDKEGIPPDQQRLIFA-GKQLE  244


 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKA  585
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  288


 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = +1

Query  178  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  357
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  358  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  537
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  538  FVKP*PARLLPWRLKAltqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            FVK    + +   +++   +     + + +   PPDQQ    + GKQLE
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  168


 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%), Gaps = 0/112 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  194  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  253

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  408
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  254  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGI  635
            +TLTGKTITLEVESSDTIDNV AKIQDKEGI
Sbjct  275  KTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GR  690
            + + +   PPDQQ    + GKQLE GR
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLEDGR  206


 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GR  690
            + + +   PPDQQ    + GKQLE GR
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLEDGR  282


 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/147 (98%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVL  513
            FAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVF  299



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = +1

Query  67   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*  606
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +   
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  180

Query  607  xlrsrtrrEFPPDQQXAYXSPGKQLE  684
              + + +   PPDQQ    + GKQLE
Sbjct  181  KAKIQDKEGIPPDQQRLIFA-GKQLE  205


 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  79   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  138

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  139  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  198

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  199  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  258

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  259  KIQDKEGIPPDQQRLIFA-GKQLE  281


 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  155  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  214

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  215  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  274

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  275  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  334

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  335  KIQDKEGIPPDQQRLIFA-GKQLE  357


 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  231  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  290

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  291  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  350

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  351  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = +1

Query  43   YFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  222
            + RF I  LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  40   FHRF-ISPLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  98

Query  223  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  402
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  99   EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  158

Query  403  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLK  582
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   ++
Sbjct  159  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  218

Query  583  Altqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            +   +     + + +   PPDQQ    + GKQLE
Sbjct  219  SSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  251


 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  244

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  245  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  304

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  305  KIQDKEGIPPDQQRLIFA-GKQLE  327


 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  201  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  260

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  261  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  320

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  321  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  380

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  381  KIQDKEGIPPDQQRLIFA-GKQLE  403


 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  277  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  336

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  337  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  396

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  397  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429



>gb|AFK47245.1| unknown [Medicago truncatula]
Length=233

 Score =   320 bits (821),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLV  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   296 bits (757),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+FAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADNNIQKESTLHLVLRLRGG  228



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (825),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   305 bits (782),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/156 (97%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  540
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM+I 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMEII  308


 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTIT  342
            IQKESTLHLVLRLRGGM+I   TL  K IT
Sbjct  289  IQKESTLHLVLRLRGGMEIIEDTLASKIIT  318



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   320 bits (821),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 179/204 (88%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +  ++++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   321 bits (822),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLI  140

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  201  KIQDKEGIPPDQQRLIFA-GKQLE  223


 Score =   296 bits (759),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  217  FAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +1

Query  241  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  420
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  421  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqli  600
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   + 
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  601  t*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
                + + +   PPDQQ    + GKQLE
Sbjct  121  NVKAKIQDKEWIPPDQQRLIFA-GKQLE  147



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  8    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  67

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  68   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  127

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  128  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  187

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  188  KIQDKEGIPPDQQRLIFA-GKQLE  210


 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  84   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  143

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  144  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  203

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  204  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  263

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  264  KIQDKEGIPPDQQRLIFA-GKQLE  286


 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  160  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  219

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  220  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  279

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  280  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312



>gb|AIS71924.1| polyubiquitin [Mangifera indica]
Length=229

 Score =   320 bits (820),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLH VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHRVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/131 (100%), Positives = 131/131 (100%), Gaps = 0/131 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRT  465
            FAGKQLEDGRT
Sbjct  197  FAGKQLEDGRT  207



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   320 bits (820),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   304 bits (778),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  214

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  215  KIQDKEGIPPDQQRLIFA-GKQLE  237


 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  111  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  170

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  171  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  230

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  231  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  290

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  291  KIQDKEGIPPDQQRLIFA-GKQLE  313


 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  187  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  246

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  247  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  306

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  307  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 105/131 (80%), Gaps = 1/131 (1%)
 Frame = +1

Query  292  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  471
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  472  DYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xlrsrtrrEFPPDQQ  651
            DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     + + +   PPDQQ
Sbjct  92   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  151

Query  652  XAYXSPGKQLE  684
                + GKQLE
Sbjct  152  RLIFA-GKQLE  161



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   320 bits (820),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   299 bits (765),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  78   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  137

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  138  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  197

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  257

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  258  KIQDKEGIPPDQQRLIFA-GKQLE  280


 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  154  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  213

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  214  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  273

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  274  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  333

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  334  KIQDKEGVPPDQQRLIFA-GKQLE  356


 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  181

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  182  KIQDKEGIPPDQQRLIFA-GKQLE  204


 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  230  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  289

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+PPDQQRLI
Sbjct  290  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQRLI  349

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  350  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK      +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (772),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (772),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   320 bits (820),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   322 bits (824),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   319 bits (817),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   320 bits (819),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   298 bits (764),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (771),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  75   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  134

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  135  IQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  194

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  195  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  254

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  255  KIQDKEGIPPDQQRLIFA-GKQLE  277


 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  151  MQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  210

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  211  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  270

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKA  585
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++
Sbjct  271  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  321


 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 170/204 (83%), Gaps = 3/204 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+    + +   +++   +     
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKA  178

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  179  KIQDKEGIPPDQQRLIFA-GKQLE  201


 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  227  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  286

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  384
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  287  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   304 bits (779),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   320 bits (819),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   302 bits (773),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>ref|XP_001797032.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
 gb|EAT86498.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
Length=234

 Score =   320 bits (819),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   298 bits (764),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   313 bits (803),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/158 (99%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  546
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVK  310


 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKT  321
            IQKESTLHLVLRLRGGMQIFVKT
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKT  311



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (770),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   322 bits (824),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 183/217 (84%), Gaps = 2/217 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  53   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  112

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  113  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  173  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  232

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GRPYPXPTTISR  720
            + + +   PPDQQ    + GKQLE G   P    ++R
Sbjct  233  KIQDKEGIPPDQQRLIFA-GKQLEDGVHAPLGAPLAR  268


 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 145/171 (85%), Gaps = 1/171 (1%)
 Frame = +1

Query  172  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  351
            +GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  352  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  70   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129

Query  532  QIFVKP*PARLLPWRLKAltqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            QIFVK    + +   +++   +     + + +   PPDQQ    + GKQLE
Sbjct  130  QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  179



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (770),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLVFA-GKQLE  279


 Score =   324 bits (831),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLV  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   304 bits (778),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  381



>ref|XP_004956019.1| PREDICTED: polyubiquitin 4-like [Setaria italica]
Length=381

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   324 bits (831),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  132

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  133  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  192

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  193  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  252

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  253  KIQDKEGIPPDQQRLIFA-GKQLE  275


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  149  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  208

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  209  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  268

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  269  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  328

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  329  KIQDKEGIPPDQQRLIFA-GKQLE  351


 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 174/200 (87%), Gaps = 1/200 (1%)
 Frame = +1

Query  85   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  264
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  265  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  444
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  445  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xlrsrt  624
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     + + 
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  180

Query  625  rrEFPPDQQXAYXSPGKQLE  684
            +   PPDQQ    + GKQLE
Sbjct  181  KEGIPPDQQRLIFA-GKQLE  199


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  225  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  284

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  285  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  344

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  345  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  376



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   324 bits (831),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   324 bits (831),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   324 bits (831),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   322 bits (826),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (826),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   323 bits (828),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  214

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  215  KIQDKEGIPPDQQRLIFA-GKQLE  237


 Score =   323 bits (828),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  111  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  170

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  171  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  230

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  231  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  290

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  291  KIQDKEGIPPDQQRLIFA-GKQLE  313


 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  187  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  246

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  247  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  306

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  307  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   304 bits (779),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   324 bits (830),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   324 bits (830),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAP80689.1| polyubiquitin [Griffithsia japonica]
Length=246

 Score =   320 bits (819),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = +1

Query  61   LFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  240
            LF+ MQIFVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  14   LFIVMQIFVKTLTGKTITLEVESSDTIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTL  73

Query  241  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  420
            +DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQ
Sbjct  74   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKTKIQDKEGIPPDQ  133

Query  421  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqli  600
            QRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   + 
Sbjct  134  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIE  193

Query  601  t*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
                + + +   PPDQQ    + GKQLE
Sbjct  194  NVKTKIQDKEGIPPDQQRLIFA-GKQLE  220


 Score =   294 bits (753),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  94   MQIFVKTLTGKTITLEVESSDTIENVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  153

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQQRLI
Sbjct  154  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKTKIQDKEGIPPDQQRLI  213

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  214  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  245



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   322 bits (825),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   319 bits (817),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   301 bits (772),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  103  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  162

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  163  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  222

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  223  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  282

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  283  KIQDKEGIPPDQQRLIFA-GKQLE  305


 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  179  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  238

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  239  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  298

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  299  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  358

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  359  KIQDKEGIPPDQQRLIFA-GKQLE  381


 Score =   305 bits (780),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  255  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  314

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  315  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  374

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  375  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  406


 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 145/189 (77%), Gaps = 4/189 (2%)
 Frame = +1

Query  118  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  297
            +V  S  ++ V A++ D +      Q   FA KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  45   QVFVSHMVEGVDARLLDVQKGHKGAQ--CFA-KQLEDGRTLADYNIQKESTLHLVLRLRG  101

Query  298  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  477
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  102  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  161

Query  478  NIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xlrsrtrrEFPPDQQXA  657
            NIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     + + +   PPDQQ  
Sbjct  162  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  221

Query  658  YXSPGKQLE  684
              + GKQLE
Sbjct  222  IFA-GKQLE  229



>gb|AIS40894.1| polyubiquitin [Kalanchoe fedtschenkoi]
Length=470

 Score =   327 bits (839),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 184/215 (86%), Gaps = 3/215 (1%)
 Frame = +1

Query  46   FRFSI--LFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  219
            FR +I  L  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  3    FRKAINSLLPKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  62

Query  220  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  399
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  63   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  122

Query  400  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRL  579
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +
Sbjct  123  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  182

Query  580  KAltqlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
            ++   +     + + +   PPDQQ    + GKQLE
Sbjct  183  ESSDTIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  216


 Score =   325 bits (832),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  90   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  149

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  150  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  209

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  210  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  269

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  270  KIQDKEGIPPDQQRLIFA-GKQLE  292


 Score =   325 bits (832),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  166  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  225

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  226  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  285

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  286  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  345

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  346  KIQDKEGIPPDQQRLIFA-GKQLE  368


 Score =   325 bits (832),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  242  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  301

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  302  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  361

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  362  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  421

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  422  KIQDKEGIPPDQQRLIFA-GKQLE  444


 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  318  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  377

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  437

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  438  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  469



>ref|XP_010275241.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=383

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            +   +   PPDQQ    + GKQLE
Sbjct  181  KILDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (824),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKILDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   322 bits (824),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKILDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   304 bits (779),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  537
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG ++
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGFRM  383



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKE+TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   322 bits (825),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (825),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (772),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>gb|AGM32540.1| polyubiquitin-B-like isoform, partial [Coptotermes formosanus]
Length=257

 Score =   320 bits (820),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   ++A   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GR  690
            + + +   PPDQQ    + GKQLE GR
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLEDGR  206


 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKA  585
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   ++A
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEA  247


 Score =   202 bits (513),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 105/105 (100%), Gaps = 0/105 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  387
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAK
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAK  257



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>dbj|GAA27344.2| polyubiquitin-A [Clonorchis sinensis]
Length=288

 Score =   321 bits (823),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  61   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  120

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  121  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  180

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   ++A   +     
Sbjct  181  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  240

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  241  KIQDKEGIPPDQQRLIFA-GKQLE  263


 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  137  MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  196

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  197  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  256

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  257  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  288


 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 103/131 (79%), Gaps = 1/131 (1%)
 Frame = +1

Query  292  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  471
            R  MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  58   RTAMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  117

Query  472  DYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xlrsrtrrEFPPDQQ  651
            DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     + + +   PPDQQ
Sbjct  118  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQ  177

Query  652  XAYXSPGKQLE  684
                + GKQLE
Sbjct  178  RLIFA-GKQLE  187



>ref|XP_002891806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  79   MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  138

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  139  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  198

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  199  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNLKT  258

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  259  KIQDKEGIPPDQQRLIFA-GKQLE  281


 Score =   322 bits (825),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  155  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  214

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+K KIQDKEGIPPDQQRLI
Sbjct  215  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNLKTKIQDKEGIPPDQQRLI  274

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  275  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  334

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  335  KIQDKEGIPPDQQRLIFA-GKQLE  357


 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDN+K KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  231  MQIFVKTLTGKTITLEVESSDTIDNLKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  290

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  291  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  350

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  351  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382


 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 171/204 (84%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQI+ KTLT KTITL+VESSDTI+NVKAKIQD EGIP DQQRLIF+GK L+DGRTLADY+
Sbjct  3    MQIYAKTLTEKTITLDVESSDTINNVKAKIQDIEGIPLDQQRLIFSGKLLDDGRTLADYS  62

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKES LHL LRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  63   IQKESILHLALRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  122

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  123  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  182

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  183  KIQDKEGIPPDQQRLIFA-GKQLE  205



>gb|AAB95252.1| ubiquitin [Arabidopsis thaliana]
Length=380

 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADY+IQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYDIQKESTLHLVLRLRGG  380



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   322 bits (824),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (824),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KIM22018.1| hypothetical protein M408DRAFT_333137 [Serendipita vermifera 
MAFF 305830]
Length=229

 Score =   319 bits (817),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   297 bits (761),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KHJ83418.1| ubiquitin family protein, partial [Oesophagostomum dentatum]
Length=216

 Score =   318 bits (815),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 180/207 (87%), Gaps = 2/207 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   ++A   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE-GR  690
            + + +   PPDQQ    + GKQLE GR
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLEDGR  206


 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKE  492
            FAGKQLEDGRTL+DYNIQKE
Sbjct  197  FAGKQLEDGRTLSDYNIQKE  216



>ref|XP_003052575.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU46862.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|ENH62031.1| Polyubiquitin [Fusarium oxysporum f. sp. cubense race 1]
 gb|EWG38736.1| polyubiquitin [Fusarium verticillioides 7600]
 gb|EWY88137.1| ubiquitin C [Fusarium oxysporum FOSC 3-a]
 gb|EWZ87537.1| ubiquitin C [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA41161.1| ubiquitin C [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK33938.1| ubiquitin C [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK99281.1| ubiquitin C [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL44710.1| ubiquitin C [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL88175.1| ubiquitin C [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM08998.1| ubiquitin C [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXM34538.1| ubiquitin C [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|KIL89583.1| polyubiquitin [Fusarium avenaceum]
Length=305

 Score =   322 bits (824),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   322 bits (824),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|EMS65864.1| Polyubiquitin [Triticum urartu]
Length=405

 Score =   325 bits (833),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   325 bits (833),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   325 bits (833),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 156/160 (98%), Gaps = 2/160 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--MQIFVK  546
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  M  +V+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGHVMHRYVR  388



>ref|XP_003010029.1| polyubiquitin UbiD/Ubi4, putative [Arthroderma benhamiae CBS 
112371]
 ref|XP_003170928.1| ubiquitin [Microsporum gypseum CBS 118893]
 ref|XP_003232289.1| polyubiquitin [Trichophyton rubrum CBS 118892]
 gb|EFE29389.1| polyubiquitin UbiD/Ubi4, putative [Arthroderma benhamiae CBS 
112371]
 gb|EFR03920.1| ubiquitin [Microsporum gypseum CBS 118893]
 gb|EGD90914.1| polyubiquitin [Trichophyton rubrum CBS 118892]
 gb|EGD97992.1| polyubiquitin [Trichophyton tonsurans CBS 112818]
 gb|EGE04992.1| ubiquitin [Trichophyton equinum CBS 127.97]
 gb|EZF26278.1| polyubiquitin [Trichophyton rubrum MR850]
 gb|EZF31874.1| polyubiquitin [Trichophyton interdigitale H6]
 gb|EZF45312.1| polyubiquitin [Trichophyton rubrum CBS 100081]
 gb|EZF56062.1| polyubiquitin [Trichophyton rubrum CBS 288.86]
 gb|EZF66560.1| polyubiquitin [Trichophyton rubrum CBS 289.86]
 gb|EZF77169.1| polyubiquitin [Trichophyton soudanense CBS 452.61]
 gb|EZF87859.1| polyubiquitin [Trichophyton rubrum MR1448]
 gb|EZG09817.1| polyubiquitin [Trichophyton rubrum CBS 735.88]
 gb|EZG20358.1| polyubiquitin [Trichophyton rubrum CBS 202.88]
 gb|KDB20983.1| polyubiquitin [Trichophyton interdigitale MR816]
 gb|KDB37038.1| polyubiquitin [Trichophyton rubrum D6]
Length=229

 Score =   318 bits (816),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   297 bits (761),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   325 bits (832),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  201  KIQDKEGIPPDQQRLIFA-GKQLE  223


 Score =   325 bits (832),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  276

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  277  KIQDKEGIPPDQQRLIFA-GKQLE  299


 Score =   325 bits (832),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  173  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  232

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  233  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  292

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  293  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  352

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  353  KIQDKEGIPPDQQRLIFA-GKQLE  375


 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  249  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  308

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  309  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  368

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  369  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  400



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   321 bits (823),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   321 bits (823),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002551324.1| ubiquitin [Candida tropicalis MYA-3404]
 gb|EER30626.1| ubiquitin [Candida tropicalis MYA-3404]
Length=299

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 183/219 (84%), Gaps = 1/219 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLEGRPYPXPTTISRKEV  729
            + + +   PPDQQ    + GKQLE         IS+K +
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLEDGRTLSDYNISKKNL  294


 Score =   320 bits (819),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTL  501
            FAGKQLEDGRTL+DYNI K++ L
Sbjct  273  FAGKQLEDGRTLSDYNISKKNLL  295



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   322 bits (826),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTL  501
            FAGKQLEDGRTLADYNIQKE+ L
Sbjct  349  FAGKQLEDGRTLADYNIQKENPL  371



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYN
Sbjct  77   MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB62483.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=381

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  333  KIQDKEGIPPDQQRLIFA-GKQLE  355


 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   304 bits (778),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|EGA57707.1| Ubi4p [Saccharomyces cerevisiae FostersB]
Length=248

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGK LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKXLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   312 bits (800),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKA  585
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  247


 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  360
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  248



>ref|NP_001053957.1| Os04g0628100 [Oryza sativa Japonica Group]
 dbj|BAF15871.1| Os04g0628100 [Oryza sativa Japonica Group]
Length=392

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  88   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  147

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  148  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  207

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  208  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  267

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  268  KIQDKEGIPPDQQRLIFA-GKQLE  290


 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  164  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  223

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  224  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  283

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  284  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  343

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  344  KIQDKEGIPPDQQRLIFA-GKQLE  366


 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 181/211 (86%), Gaps = 2/211 (1%)
 Frame = +1

Query  52   FSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  231
             S LF +MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  6    LSCLF-QMQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  64

Query  232  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  411
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  65   RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  124

Query  412  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAlt  591
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++  
Sbjct  125  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  184

Query  592  qlit*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
             +     + + +   PPDQQ    + GKQLE
Sbjct  185  TIDNVKAKIQDKEGIPPDQQRLIFA-GKQLE  214


 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  240  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  299

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  300  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  359

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  360  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  392



>ref|XP_002980153.1| hypothetical protein SELMODRAFT_271419 [Selaginella moellendorffii]
 ref|XP_002991828.1| hypothetical protein SELMODRAFT_162003 [Selaginella moellendorffii]
 gb|EFJ07090.1| hypothetical protein SELMODRAFT_162003 [Selaginella moellendorffii]
 gb|EFJ19023.1| hypothetical protein SELMODRAFT_271419 [Selaginella moellendorffii]
Length=306

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003402310.1| PREDICTED: polyubiquitin-B-like isoform 1 [Bombus terrestris]
 ref|XP_003402311.1| PREDICTED: polyubiquitin-B-like isoform 2 [Bombus terrestris]
 ref|XP_003402312.1| PREDICTED: polyubiquitin-B-like isoform 3 [Bombus terrestris]
Length=229

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   ++A   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   296 bits (757),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|AGM32487.1| polyubiquitin-B-like isoform 1 [Coptotermes formosanus]
Length=230

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   ++A   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   296 bits (757),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KDR10312.1| Ubiquitin [Zootermopsis nevadensis]
Length=230

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   ++A   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   296 bits (757),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_006495477.1| PREDICTED: polyubiquitin 3-like, partial [Citrus sinensis]
Length=164

 Score =   316 bits (809),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  546
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  158


 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKT  336
            IQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKT  164


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 47/69 (68%), Gaps = 7/69 (10%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIPPGPAXGLSFAGKAA--*RTAVP*XDYNI  716
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIPP     L FAGK     RT     DYNI
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR-LIFAGKQLEDGRTLA---DYNI  61

Query  717  PERGPPFHL  743
             ++    HL
Sbjct  62   -QKESTLHL  69


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 47/69 (68%), Gaps = 7/69 (10%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIPPGPAXGLSFAGKAA--*RTAVP*XDYNI  716
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIPP     L FAGK     RT     DYNI
Sbjct  82   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR-LIFAGKQLEDGRTLA---DYNI  137

Query  717  PERGPPFHL  743
             ++    HL
Sbjct  138  -QKESTLHL  145



>gb|ETN78467.1| ubiquitin family protein [Necator americanus]
Length=229

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   ++A   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   296 bits (757),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_006372519.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP50316.1| polyubiquitin family protein [Populus trichocarpa]
Length=305

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>dbj|GAA55031.1| ubiquitin C [Clonorchis sinensis]
Length=228

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   ++A   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   296 bits (757),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|EYC42800.1| hypothetical protein Y032_0517g2809 [Ancylostoma ceylanicum]
Length=230

 Score =   318 bits (815),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   ++A   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   296 bits (757),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KJB69254.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=162

 Score =   315 bits (808),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  546
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  158


 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKT  321
            IQKESTLHLVLRLRGGMQIFVKT
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKT  159


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 47/69 (68%), Gaps = 7/69 (10%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIPPGPAXGLSFAGKAA--*RTAVP*XDYNI  716
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIPP     L FAGK     RT     DYNI
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR-LIFAGKQLEDGRTLA---DYNI  61

Query  717  PERGPPFHL  743
             ++    HL
Sbjct  62   -QKESTLHL  69


 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 47/69 (68%), Gaps = 7/69 (10%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIPPGPAXGLSFAGKAA--*RTAVP*XDYNI  716
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIPP     L FAGK     RT     DYNI
Sbjct  82   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR-LIFAGKQLEDGRTLA---DYNI  137

Query  717  PERGPPFHL  743
             ++    HL
Sbjct  138  -QKESTLHL  145



>ref|XP_001755307.1| predicted protein [Physcomitrella patens]
 gb|EDQ79787.1| predicted protein [Physcomitrella patens]
Length=305

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AAO42469.1| putative polyubiquitin [Arabidopsis lyrata]
Length=289

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 174/204 (85%), Gaps = 9/204 (4%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  68   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  127

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  128  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  187

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++         
Sbjct  188  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSEIQDKEG-  246

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
                    PPDQQ    + GKQLE
Sbjct  247  -------IPPDQQRLIFA-GKQLE  262


 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 169/195 (87%), Gaps = 1/195 (1%)
 Frame = +1

Query  100  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  279
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  280  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  459
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  460  RTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xlrsrtrrEFP  639
            RTLADYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     + + +   P
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  180

Query  640  PDQQXAYXSPGKQLE  684
            PDQQ    + GKQLE
Sbjct  181  PDQQRLIFA-GKQLE  194


 Score =   279 bits (713),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/152 (94%), Positives = 144/152 (95%), Gaps = 8/152 (5%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  144  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  203

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS+        IQDKEGIPPDQQRLI
Sbjct  204  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSE--------IQDKEGIPPDQQRLI  255

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  287



>gb|ABF06579.2| polyubiquitin, partial [Gladiolus grandiflorus]
Length=162

 Score =   315 bits (808),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  546
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  158


 Score =   173 bits (438),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/86 (100%), Positives = 86/86 (100%), Gaps = 0/86 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTG  330
            IQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTG  162


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 47/69 (68%), Gaps = 7/69 (10%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIPPGPAXGLSFAGKAA--*RTAVP*XDYNI  716
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIPP     L FAGK     RT     DYNI
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR-LIFAGKQLEDGRTLA---DYNI  61

Query  717  PERGPPFHL  743
             ++    HL
Sbjct  62   -QKESTLHL  69


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 47/69 (68%), Gaps = 7/69 (10%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIPPGPAXGLSFAGKAA--*RTAVP*XDYNI  716
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIPP     L FAGK     RT     DYNI
Sbjct  82   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR-LIFAGKQLEDGRTLA---DYNI  137

Query  717  PERGPPFHL  743
             ++    HL
Sbjct  138  -QKESTLHL  145



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/160 (99%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +1

Query  67   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  50   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  109

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  110  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  169

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  546
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  170  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  209


 Score =   224 bits (572),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  128  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  187

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  411
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  188  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240


 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 47/69 (68%), Gaps = 7/69 (10%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIPPGPAXGLSFAGKAA--*RTAVP*XDYNI  716
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIPP     L FAGK     RT     DYNI
Sbjct  57   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR-LIFAGKQLEDGRTLA---DYNI  112

Query  717  PERGPPFHL  743
             ++    HL
Sbjct  113  -QKESTLHL  120


 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 47/69 (68%), Gaps = 7/69 (10%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIPPGPAXGLSFAGKAA--*RTAVP*XDYNI  716
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIPP     L FAGK     RT     DYNI
Sbjct  133  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR-LIFAGKQLEDGRTLA---DYNI  188

Query  717  PERGPPFHL  743
             ++    HL
Sbjct  189  -QKESTLHL  196


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIP  638
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIP
Sbjct  209  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240



>dbj|GAK65396.1| ubiquitin [Pseudozyma antarctica]
Length=334

 Score =   322 bits (824),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = +1

Query  61   LFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  240
            L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  26   LLQAMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  85

Query  241  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  420
            +DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  86   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  145

Query  421  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqli  600
            QRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   + 
Sbjct  146  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  205

Query  601  t*xlrsrtrrEFPPDQQXAYXSPGKQLE  684
                + + +   PPDQQ    + GKQLE
Sbjct  206  NVKAKIQDKEGIPPDQQRLIFA-GKQLE  232


 Score =   321 bits (822),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  106  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  165

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  166  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  225

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  226  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  285

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  286  KIQDKEGIPPDQQRLIFA-GKQLE  308


 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  182  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  241

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  242  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  301

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  302  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  333



>sp|P0CG73.1|UBI1P_CANAX RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Candida albicans]
 gb|AAA84868.1| ubiquitin precursor [Candida albicans]
Length=229

 Score =   318 bits (814),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLR RGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRSRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|ACA58351.1| ubiquitin-like protein [Sandersonia aurantiaca]
Length=189

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  546
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK  158


 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  411
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 47/69 (68%), Gaps = 7/69 (10%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIPPGPAXGLSFAGKAA--*RTAVP*XDYNI  716
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIPP     L FAGK     RT     DYNI
Sbjct  6    KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR-LIFAGKQLEDGRTLA---DYNI  61

Query  717  PERGPPFHL  743
             ++    HL
Sbjct  62   -QKESTLHL  69


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 47/69 (68%), Gaps = 7/69 (10%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIPPGPAXGLSFAGKAA--*RTAVP*XDYNI  716
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIPP     L FAGK     RT     DYNI
Sbjct  82   KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR-LIFAGKQLEDGRTLA---DYNI  137

Query  717  PERGPPFHL  743
             ++    HL
Sbjct  138  -QKESTLHL  145


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  543  ETLTGKTITLEVESSDTIDNVXAKIQDKEGIP  638
            +TLTGKTITLEVESSDTIDNV AKIQDKEGIP
Sbjct  158  KTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189



>gb|EPS29015.1| hypothetical protein PDE_03961 [Penicillium oxalicum 114-2]
Length=295

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   291 bits (745),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 168/204 (82%), Gaps = 11/204 (5%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDG          +STLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDG----------QSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  246

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  247  KIQDKEGIPPDQQRLIFA-GKQLE  269


 Score =   270 bits (690),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 142/152 (93%), Gaps = 10/152 (7%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDG       
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG-------  205

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
               +STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  206  ---QSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  262

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  263  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  294



>ref|XP_001830230.1| ubiquitin [Coprinopsis cinerea okayama7#130]
 gb|EAU91601.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=305

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   301 bits (770),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_001210780.1| ubiquitin [Aspergillus terreus NIH2624]
 ref|XP_001526489.1| hypothetical protein LELG_03047 [Lodderomyces elongisporus NRRL 
YB-4239]
 ref|XP_001820269.1| ubiquitin [Aspergillus oryzae RIB40]
 ref|XP_002151173.1| polyubiquitin UbiD/Ubi4, putative [Talaromyces marneffei ATCC 
18224]
 ref|XP_002374148.1| polyubiquitin UbiD/Ubi4, putative [Aspergillus flavus NRRL3357]
 ref|XP_002341866.1| polyubiquitin UbiD/Ubi4, putative [Talaromyces stipitatus ATCC 
10500]
 ref|XP_004198602.1| Piso0_001982 [Millerozyma farinosa CBS 7064]
 ref|XP_004201781.1| Piso0_001982 [Millerozyma farinosa CBS 7064]
 ref|XP_007805939.1| Polyubiquitin [Endocarpon pusillum Z07020]
 dbj|BAE58267.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EAU39340.1| ubiquitin [Aspergillus terreus NIH2624]
 gb|EDK44868.1| hypothetical protein LELG_03047 [Lodderomyces elongisporus NRRL 
YB-4239]
 gb|EEA20173.1| polyubiquitin UbiD/Ubi4, putative [Talaromyces marneffei ATCC 
18224]
 gb|EED24479.1| polyubiquitin UbiD/Ubi4, putative [Talaromyces stipitatus ATCC 
10500]
 gb|EED55366.1| polyubiquitin UbiD/Ubi4, putative [Aspergillus flavus NRRL3357]
 emb|CCE82265.1| Piso0_001982 [Millerozyma farinosa CBS 7064]
 emb|CCE88475.1| Piso0_001982 [Millerozyma farinosa CBS 7064]
 gb|EIT80910.1| ubiquitin and ubiquitin-like protein [Aspergillus oryzae 3.042]
 gb|ERF68447.1| Polyubiquitin [Endocarpon pusillum Z07020]
 dbj|GAD99061.1| polyubiquitin UbiD/Ubi4, putative [Byssochlamys spectabilis No. 
5]
 gb|EYE99873.1| ubiquitin [Aspergillus ruber CBS 135680]
 gb|KDE79183.1| ubiquitin and ubiquitin-like protein [Aspergillus oryzae 100-8]
 gb|KGQ04805.1| Polyubiquitin [Beauveria bassiana D1-5]
Length=305

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  257  KIQDKEGIPPDQQRLIFA-GKQLE  279


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|EZF98642.1| polyubiquitin [Trichophyton rubrum MR1459]
Length=229

 Score =   318 bits (814),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 176/204 (86%), Gaps = 1/204 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIF+GKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFSGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKP*PARLLPWRLKAltqlit*xl  612
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVK    + +   +++   +     
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  rsrtrrEFPPDQQXAYXSPGKQLE  684
            + + +   PPDQQ    + GKQLE
Sbjct  181  KIQDKEGIPPDQQRLIFA-GKQLE  203


 Score =   297 bits (761),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1646677518220