BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F15

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB36913.1|  hypothetical protein B456_006G182500                    270   2e-84   Gossypium raimondii
gb|KJB36915.1|  hypothetical protein B456_006G182500                    270   2e-84   Gossypium raimondii
gb|KHG18994.1|  hypothetical protein F383_24520                         266   8e-83   Gossypium arboreum [tree cotton]
ref|XP_004492444.1|  PREDICTED: LIMR family protein At5g01460-like      266   9e-83   Cicer arietinum [garbanzo]
ref|XP_009796831.1|  PREDICTED: LIMR family protein At5g01460           266   1e-82   Nicotiana sylvestris
ref|XP_009614616.1|  PREDICTED: LIMR family protein At5g01460           265   1e-82   Nicotiana tomentosiformis
gb|KCW86115.1|  hypothetical protein EUGRSUZ_B02811                     263   1e-82   Eucalyptus grandis [rose gum]
ref|XP_011077557.1|  PREDICTED: LIMR family protein At5g01460           265   2e-82   Sesamum indicum [beniseed]
ref|XP_007026706.1|  LMBR1-like membrane protein isoform 2              265   2e-82   
emb|CDY68816.1|  BnaAnng28470D                                          255   2e-82   Brassica napus [oilseed rape]
ref|XP_007026705.1|  LMBR1-like membrane protein isoform 1              265   2e-82   
emb|CDY27961.1|  BnaC05g43630D                                          265   3e-82   Brassica napus [oilseed rape]
ref|XP_006429390.1|  hypothetical protein CICLE_v10011517mg             265   3e-82   Citrus clementina [clementine]
ref|XP_008367161.1|  PREDICTED: LIMR family protein At5g01460           265   3e-82   Malus domestica [apple tree]
ref|XP_004246766.1|  PREDICTED: LIMR family protein At5g01460           264   3e-82   Solanum lycopersicum
ref|XP_008243726.1|  PREDICTED: LIMR family protein At5g01460           264   4e-82   Prunus mume [ume]
ref|XP_007205059.1|  hypothetical protein PRUPE_ppa004457mg             264   4e-82   Prunus persica
ref|XP_002873012.1|  LMBR1 integral membrane family protein             264   5e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_002280330.1|  PREDICTED: LIMR family protein At5g01460           263   6e-82   Vitis vinifera
emb|CDY64938.1|  BnaA05g37080D                                          263   6e-82   Brassica napus [oilseed rape]
ref|XP_006365594.1|  PREDICTED: LIMR family protein At5g01460-like      263   7e-82   Solanum tuberosum [potatoes]
ref|XP_009377765.1|  PREDICTED: LIMR family protein At5g01460           263   9e-82   Pyrus x bretschneideri [bai li]
ref|XP_008355714.1|  PREDICTED: LOW QUALITY PROTEIN: LIMR family ...    263   1e-81   Malus domestica [apple tree]
ref|XP_010451983.1|  PREDICTED: LIMR family protein At5g01460-like      263   1e-81   Camelina sativa [gold-of-pleasure]
gb|KCW86112.1|  hypothetical protein EUGRSUZ_B02811                     263   1e-81   Eucalyptus grandis [rose gum]
ref|XP_010044098.1|  PREDICTED: LIMR family protein At5g01460           263   2e-81   Eucalyptus grandis [rose gum]
gb|KHN05546.1|  LIMR family protein                                     263   2e-81   Glycine soja [wild soybean]
ref|XP_010553121.1|  PREDICTED: LIMR family protein At5g01460           262   2e-81   Tarenaya hassleriana [spider flower]
ref|XP_009146971.1|  PREDICTED: LIMR family protein At3g08930-like      262   2e-81   Brassica rapa
ref|XP_003552245.1|  PREDICTED: LIMR family protein At5g01460-like      262   2e-81   Glycine max [soybeans]
ref|XP_010490562.1|  PREDICTED: LOW QUALITY PROTEIN: LIMR family ...    262   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_003529151.1|  PREDICTED: LIMR family protein At5g01460-like      262   3e-81   Glycine max [soybeans]
gb|KFK24650.1|  hypothetical protein AALP_AA8G007300                    262   3e-81   Arabis alpina [alpine rockcress]
ref|XP_010424827.1|  PREDICTED: LIMR family protein At5g01460-like      261   3e-81   
ref|XP_007133897.1|  hypothetical protein PHAVU_010G001200g             261   3e-81   Phaseolus vulgaris [French bean]
ref|NP_195766.1|  LMBR1-like membrane protein                           261   4e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287547.1|  hypothetical protein CARUB_v10000756mg             261   4e-81   Capsella rubella
ref|XP_010095237.1|  hypothetical protein L484_008245                   263   4e-81   
ref|XP_010543204.1|  PREDICTED: LIMR family protein At5g01460           261   4e-81   Tarenaya hassleriana [spider flower]
gb|KCW86114.1|  hypothetical protein EUGRSUZ_B02811                     260   6e-81   Eucalyptus grandis [rose gum]
ref|XP_004302541.1|  PREDICTED: LIMR family protein At5g01460           261   7e-81   Fragaria vesca subsp. vesca
ref|XP_010486441.1|  PREDICTED: LIMR family protein At3g08930           260   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006299427.1|  hypothetical protein CARUB_v10015588mg             260   1e-80   Capsella rubella
ref|XP_006398614.1|  hypothetical protein EUTSA_v10013023mg             263   1e-80   
ref|XP_007140346.1|  hypothetical protein PHAVU_008G104400g             260   1e-80   Phaseolus vulgaris [French bean]
ref|XP_002882590.1|  hypothetical protein ARALYDRAFT_478196             260   1e-80   
ref|NP_566338.2|  LMBR1-like membrane protein                           260   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464511.1|  PREDICTED: LIMR family protein At3g08930-like      260   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010466717.1|  PREDICTED: LIMR family protein At3g08930-like      260   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_011019120.1|  PREDICTED: LIMR family protein At5g01460-like      260   2e-80   Populus euphratica
ref|XP_004506746.1|  PREDICTED: LIMR family protein At5g01460-like      260   2e-80   
ref|XP_006407732.1|  hypothetical protein EUTSA_v10020541mg             259   2e-80   Eutrema salsugineum [saltwater cress]
ref|XP_002308217.1|  LMBR1 integral membrane family protein             259   2e-80   Populus trichocarpa [western balsam poplar]
gb|KEH23159.1|  LIMR family protein                                     259   3e-80   Medicago truncatula
ref|XP_011095010.1|  PREDICTED: LIMR family protein At5g01460-like      259   4e-80   Sesamum indicum [beniseed]
ref|XP_011006556.1|  PREDICTED: LIMR family protein At5g01460           259   5e-80   Populus euphratica
gb|KFK38280.1|  hypothetical protein AALP_AA3G093600                    258   5e-80   Arabis alpina [alpine rockcress]
emb|CDP06485.1|  unnamed protein product                                258   6e-80   Coffea canephora [robusta coffee]
ref|XP_003520496.1|  PREDICTED: LIMR family protein At3g08930-like      258   9e-80   Glycine max [soybeans]
ref|XP_002528095.1|  conserved hypothetical protein                     258   9e-80   Ricinus communis
gb|EYU41891.1|  hypothetical protein MIMGU_mgv1a004832mg                258   1e-79   Erythranthe guttata [common monkey flower]
gb|EYU26666.1|  hypothetical protein MIMGU_mgv1a004810mg                258   1e-79   Erythranthe guttata [common monkey flower]
ref|XP_002323579.1|  LMBR1 integral membrane family protein             257   2e-79   
ref|XP_010262857.1|  PREDICTED: LIMR family protein At5g01460           257   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_008449896.1|  PREDICTED: LIMR family protein At5g01460           257   2e-79   Cucumis melo [Oriental melon]
ref|XP_010253885.1|  PREDICTED: LIMR family protein At5g01460           256   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_009135079.1|  PREDICTED: LIMR family protein At3g08930           256   5e-79   Brassica rapa
gb|KDP24450.1|  hypothetical protein JCGZ_25014                         253   5e-78   Jatropha curcas
ref|XP_006848221.1|  hypothetical protein AMTR_s00029p00244850          253   1e-77   Amborella trichopoda
gb|AAF07832.1|AC010871_8  unknown protein                               251   2e-77   Arabidopsis thaliana [mouse-ear cress]
gb|KHN42506.1|  LIMR family protein                                     250   9e-77   Glycine soja [wild soybean]
ref|XP_010676736.1|  PREDICTED: LIMR family protein At5g01460           250   1e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008794237.1|  PREDICTED: LIMR family protein Os06g0128200-...    248   9e-76   Phoenix dactylifera
gb|EPS57824.1|  hypothetical protein M569_16993                         247   1e-75   Genlisea aurea
ref|XP_010920999.1|  PREDICTED: LIMR family protein Os06g0128200-...    243   5e-74   Elaeis guineensis
ref|XP_010937920.1|  PREDICTED: LIMR family protein Os06g0128200 ...    239   8e-73   
ref|XP_010937919.1|  PREDICTED: LIMR family protein Os06g0128200 ...    239   2e-72   Elaeis guineensis
ref|XP_008789162.1|  PREDICTED: LIMR family protein Os06g0128200        238   6e-72   Phoenix dactylifera
ref|XP_004964404.1|  PREDICTED: LIMR family protein Os06g0128200-...    234   1e-70   Setaria italica
dbj|BAD44783.1|  LMBR1 integral membrane family protein-like            231   3e-70   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056670.1|  Os06g0128200                                       232   1e-69   
ref|XP_006655738.1|  PREDICTED: LIMR family protein Os06g0128200-...    231   3e-69   Oryza brachyantha
ref|XP_004148616.1|  PREDICTED: LIMR family protein At3g08930-like      231   3e-69   Cucumis sativus [cucumbers]
ref|XP_009416300.1|  PREDICTED: LIMR family protein Os06g0128200-...    228   4e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008659355.1|  PREDICTED: LIMR family protein Os06g0128200-...    228   5e-68   Zea mays [maize]
ref|NP_001130482.1|  uncharacterized protein LOC100191580               227   6e-68   Zea mays [maize]
ref|XP_009406919.1|  PREDICTED: LIMR family protein Os06g0128200        227   6e-68   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ85289.1|  predicted protein                                      224   8e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008811686.1|  PREDICTED: LIMR family protein At5g01460-like      222   8e-66   Phoenix dactylifera
ref|XP_002960259.1|  hypothetical protein SELMODRAFT_75198              221   9e-66   
ref|XP_003557109.1|  PREDICTED: LIMR family protein Os06g0128200        221   9e-66   Brachypodium distachyon [annual false brome]
ref|XP_010907860.1|  PREDICTED: LIMR family protein At3g08930-like      218   2e-64   
ref|XP_009392724.1|  PREDICTED: LIMR family protein Os06g0128200-...    215   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT25406.1|  hypothetical protein F775_32767                         218   4e-63   
ref|XP_001773045.1|  predicted protein                                  200   1e-57   
gb|EMS64825.1|  hypothetical protein TRIUR3_30387                       196   9e-57   Triticum urartu
ref|XP_007026707.1|  LMBR1-like membrane protein isoform 3              190   3e-55   
ref|XP_002973109.1|  hypothetical protein SELMODRAFT_99001              194   4e-55   
ref|XP_008370146.1|  PREDICTED: LIMR family protein At5g01460           181   6e-55   
ref|XP_002976753.1|  hypothetical protein SELMODRAFT_416712             192   3e-54   
ref|XP_006850689.1|  hypothetical protein AMTR_s00034p00237580          173   2e-51   
gb|AFW75355.2|  hypothetical protein ZEAMMB73_153382                    174   4e-48   
ref|XP_001755027.1|  predicted protein                                  167   2e-45   
ref|XP_002994496.1|  hypothetical protein SELMODRAFT_138681             154   2e-41   
gb|KIZ02019.1|  hypothetical protein MNEG_5943                          151   6e-41   Monoraphidium neglectum
gb|KHN35580.1|  LIMR family protein                                     150   4e-39   Glycine soja [wild soybean]
ref|XP_002505039.1|  predicted protein                                  146   8e-38   Micromonas commoda
ref|XP_005651518.1|  hypothetical protein COCSUDRAFT_12091              145   2e-37   Coccomyxa subellipsoidea C-169
ref|XP_004506743.1|  PREDICTED: LIMR family protein At3g08930-like      134   1e-35   Cicer arietinum [garbanzo]
gb|EMS68850.1|  hypothetical protein TRIUR3_08571                       130   5e-35   Triticum urartu
ref|XP_007514490.1|  predicted protein                                  139   7e-35   Bathycoccus prasinos
ref|XP_001689531.1|  predicted protein                                  136   4e-34   Chlamydomonas reinhardtii
ref|XP_001420900.1|  predicted protein                                  134   2e-33   Ostreococcus lucimarinus CCE9901
emb|CEG00030.1|  LMBR1-like membrane protein                            132   1e-32   Ostreococcus tauri
ref|XP_003082521.1|  LMBR1 integral membrane family protein-like ...    132   2e-32   
ref|XP_003060576.1|  predicted protein                                  129   1e-31   Micromonas pusilla CCMP1545
ref|XP_005850504.1|  hypothetical protein CHLNCDRAFT_140333             129   2e-31   Chlorella variabilis
ref|XP_002956676.1|  hypothetical protein VOLCADRAFT_67279              127   9e-31   Volvox carteri f. nagariensis
sp|D8TFA8.2|LMBD3_SELML  RecName: Full=LIMR family protein SELMOD...    126   1e-30   Selaginella moellendorffii
ref|XP_011396246.1|  LIMR family protein                                126   4e-30   Auxenochlorella protothecoides
gb|KHN07715.1|  LIMR family protein                                     124   9e-30   Glycine soja [wild soybean]
gb|KDD72048.1|  hypothetical protein H632_c3953p0                     99.4    9e-23   Helicosporidium sp. ATCC 50920
gb|EFA76425.1|  LMBR1-like conserved region-containing protein          103   3e-22   Heterostelium album PN500
dbj|GAM23900.1|  hypothetical protein SAMD00019534_070750               100   2e-21   Acytostelium subglobosum LB1
ref|XP_003287659.1|  hypothetical protein DICPUDRAFT_54958            95.9    1e-19   Dictyostelium purpureum
ref|XP_629046.1|  LMBR1-like conserved region-containing protein      95.1    3e-19   Dictyostelium discoideum AX4
ref|XP_008621503.1|  hypothetical protein SDRG_17049                  94.0    8e-19   Saprolegnia diclina VS20
ref|XP_005840131.1|  hypothetical protein GUITHDRAFT_100864           92.0    1e-18   Guillardia theta CCMP2712
ref|XP_638976.2|  LMBR1-like conserved region-containing protein      92.4    2e-18   Dictyostelium discoideum AX4
ref|XP_004359754.1|  LMBR1-like conserved region-containing protein   91.7    4e-18   Cavenderia fasciculata
gb|EWM27274.1|  lmbr1-like conserved region-containing protein        90.1    2e-17   Nannochloropsis gaditana
ref|XP_002289422.1|  predicted protein                                87.8    1e-16   Thalassiosira pseudonana CCMP1335
gb|EJK48296.1|  hypothetical protein THAOC_32924                      83.2    2e-16   Thalassiosira oceanica
ref|XP_002976757.1|  hypothetical protein SELMODRAFT_416719           85.5    2e-16   
gb|KDO27861.1|  hypothetical protein SPRG_07134                       86.3    4e-16   Saprolegnia parasitica CBS 223.65
gb|KDO15964.1|  hypothetical protein SPRG_18504                       85.9    4e-16   Saprolegnia parasitica CBS 223.65
ref|XP_009534763.1|  hypothetical protein PHYSODRAFT_522442           85.5    6e-16   Phytophthora sojae
gb|ETI42239.1|  hypothetical protein F443_12595                       85.1    1e-15   Phytophthora parasitica P1569
gb|ETM42134.1|  hypothetical protein L914_12160                       84.7    1e-15   Phytophthora parasitica
ref|XP_008908935.1|  hypothetical protein PPTG_13236                  84.7    1e-15   Phytophthora parasitica INRA-310
ref|XP_002998528.1|  conserved hypothetical protein                   84.7    1e-15   Phytophthora infestans T30-4
gb|ETL35650.1|  hypothetical protein L916_12240                       84.7    2e-15   Phytophthora parasitica
ref|XP_002184914.1|  predicted protein                                82.8    6e-15   Phaeodactylum tricornutum CCAP 1055/1
gb|AFA52586.1|  hypothetical protein                                  82.8    6e-15   Vaucheria litorea
ref|XP_009824354.1|  hypothetical protein H257_02425                  82.0    1e-14   Aphanomyces astaci
ref|XP_008864006.1|  hypothetical protein H310_02320                  81.3    2e-14   Aphanomyces invadans
ref|XP_001023371.1|  LMBR1-like conserved region family protein       77.8    6e-13   
ref|XP_006681112.1|  hypothetical protein BATDEDRAFT_26994            75.5    2e-12   Batrachochytrium dendrobatidis JAM81
gb|EWS72349.1|  LMBR1-like motif protein                              72.8    1e-11   Tetrahymena thermophila SB210
ref|XP_001022216.1|  LMBR1-like conserved region family protein       72.0    4e-11   
emb|CCA16794.1|  conserved hypothetical protein                       71.2    5e-11   Albugo laibachii Nc14
ref|XP_009311191.1|  LMBR1-like conserved region-containing protein   70.9    6e-11   Trypanosoma grayi
ref|XP_002675706.1|  predicted protein                                70.1    9e-11   Naegleria gruberi strain NEG-M
ref|XP_002994279.1|  hypothetical protein SELMODRAFT_432210           68.9    1e-10   
ref|XP_001434867.1|  hypothetical protein                             69.3    2e-10   Paramecium tetraurelia strain d4-2
emb|CCI42339.1|  unnamed protein product                              68.9    2e-10   Albugo candida
gb|EPZ34343.1|  LMBR1-like membrane protein domain-containing pro...  68.9    2e-10   Rozella allomycis CSF55
gb|EJK53353.1|  hypothetical protein THAOC_27231                      63.9    3e-10   Thalassiosira oceanica
gb|EAR82938.2|  LMBR1-like motif protein                              67.4    8e-10   Tetrahymena thermophila SB210
gb|EWS72757.1|  LMBR1-like motif protein                              67.4    8e-10   Tetrahymena thermophila SB210
gb|ESL06057.1|  hypothetical protein TRSC58_06275                     66.2    2e-09   Trypanosoma rangeli SC58
ref|XP_001454539.1|  hypothetical protein                             65.9    2e-09   Paramecium tetraurelia strain d4-2
ref|XP_001683871.1|  conserved hypothetical protein                   65.9    3e-09   Leishmania major strain Friedlin
gb|EPY41028.1|  LMBR1 domain-containing protein 1                     62.8    1e-08   Angomonas deanei
gb|ESS63933.1|  hypothetical protein TCDM_08087                       61.2    2e-08   Trypanosoma cruzi Dm28c
gb|EPY30284.1|  LMBR1 domain-containing protein 1                     62.4    2e-08   Angomonas deanei
gb|EJY83178.1|  hypothetical protein OXYTRI_19202                     62.8    2e-08   Oxytricha trifallax
ref|XP_003861450.1|  hypothetical protein, conserved                  62.4    3e-08   Leishmania donovani
ref|XP_001466149.1|  conserved hypothetical protein                   62.4    3e-08   Leishmania infantum JPCM5
ref|XP_001030601.1|  LMBR1-like conserved region family protein       62.4    4e-08   
emb|CDW90192.1|  UNKNOWN                                              62.4    4e-08   Stylonychia lemnae
gb|EKG03049.1|  hypothetical protein TCSYLVIO_005913                  62.0    4e-08   Trypanosoma cruzi
ref|XP_004032364.1|  lmbr1-like conserved region family protein, ...  62.0    5e-08   Ichthyophthirius multifiliis
ref|XP_817833.1|  hypothetical protein                                60.8    1e-07   Trypanosoma cruzi strain CL Brener
ref|XP_001453733.1|  hypothetical protein                             60.1    2e-07   Paramecium tetraurelia strain d4-2
ref|XP_001456478.1|  hypothetical protein                             59.7    2e-07   Paramecium tetraurelia strain d4-2
ref|XP_002681314.1|  hypothetical protein NAEGRDRAFT_77239            58.9    5e-07   Naegleria gruberi strain NEG-M
ref|XP_001737470.1|  hypothetical protein                             56.6    7e-07   Entamoeba dispar SAW760
ref|XP_804397.1|  hypothetical protein                                57.4    2e-06   Trypanosoma cruzi strain CL Brener
ref|XP_010699689.1|  hypothetical protein LPMP_251190                 57.4    2e-06   Leishmania panamensis
ref|XP_651078.2|  hypothetical protein                                57.0    2e-06   Entamoeba histolytica HM-1:IMSS
ref|XP_004185620.1|  hypothetical protein EIN_114180                  57.0    2e-06   Entamoeba invadens IP1
gb|EKF30814.1|  hypothetical protein MOQ_005363                       57.0    2e-06   Trypanosoma cruzi marinkellei
ref|XP_001565618.1|  conserved hypothetical protein                   56.6    2e-06   Leishmania braziliensis MHOM/BR/75/M2904
emb|CDW87933.1|  UNKNOWN                                              56.2    3e-06   Stylonychia lemnae
ref|XP_001737702.1|  hypothetical protein                             55.8    4e-06   Entamoeba dispar SAW760
ref|XP_843733.1|  hypothetical protein                                52.8    6e-05   Trypanosoma brucei brucei TREU927
emb|CCC46884.1|  conserved hypothetical protein                       52.0    9e-05   Trypanosoma vivax Y486
ref|XP_001299832.1|  LMBR1-like conserved region family protein       52.0    1e-04   Trichomonas vaginalis G3
ref|XP_003876171.1|  conserved hypothetical protein                   51.6    1e-04   Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_001914219.1|  hypothetical protein                             50.1    1e-04   Entamoeba histolytica HM-1:IMSS
ref|XP_011131383.1|  putative LMBR1-like protein                      51.2    2e-04   Gregarina niphandrodes
emb|CBH09775.1|  hypothetical protein, conserved                      50.8    2e-04   Trypanosoma brucei gambiense DAL972
gb|EFA76389.1|  hypothetical protein PPL_10154                        51.2    2e-04   Heterostelium album PN500
gb|KFG61160.1|  putative LMBR1 family region protein                  49.7    6e-04   Toxoplasma gondii RUB
gb|KFH03574.1|  putative LMBR1 family region protein                  49.7    6e-04   Toxoplasma gondii VAND
gb|ESS30088.1|  putative LMBR1 family region protein                  49.7    6e-04   Toxoplasma gondii VEG
gb|EPR58493.1|  putative LMBR1 family region protein                  49.7    6e-04   Toxoplasma gondii GT1
gb|EPT32058.1|  LMBR1 family region protein, putative                 49.7    6e-04   Toxoplasma gondii ME49
emb|CCC89640.1|  unnamed protein product                              49.3    7e-04   Trypanosoma congolense IL3000
gb|KFH14581.1|  putative LMBR1 family region protein                  49.3    9e-04   Toxoplasma gondii MAS



>gb|KJB36913.1| hypothetical protein B456_006G182500 [Gossypium raimondii]
 gb|KJB36917.1| hypothetical protein B456_006G182500 [Gossypium raimondii]
Length=510

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCV+VFL N+YLLVNYQHPDDANQAYFPKFVVVFGLS+AAISILML
Sbjct  1    MGDFNLALVIVAIVVCVLVFLFNVYLLVNYQHPDDANQAYFPKFVVVFGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMKELWLA+YI++AVLVFF+IPFAMFFYEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKELWLAVYIIDAVLVFFVIPFAMFFYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVCALLLGILYGL GKVDFTVRHL
Sbjct  121  KRIKSALLWVVTTAIVCALLLGILYGLAGKVDFTVRHL  158



>gb|KJB36915.1| hypothetical protein B456_006G182500 [Gossypium raimondii]
Length=506

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCV+VFL N+YLLVNYQHPDDANQAYFPKFVVVFGLS+AAISILML
Sbjct  1    MGDFNLALVIVAIVVCVLVFLFNVYLLVNYQHPDDANQAYFPKFVVVFGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMKELWLA+YI++AVLVFF+IPFAMFFYEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKELWLAVYIIDAVLVFFVIPFAMFFYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVCALLLGILYGL GKVDFTVRHL
Sbjct  121  KRIKSALLWVVTTAIVCALLLGILYGLAGKVDFTVRHL  158



>gb|KHG18994.1| hypothetical protein F383_24520 [Gossypium arboreum]
Length=510

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCV+VFL N+YLLVNYQHPDDANQAYFPKFVVVFGLS+AAISILML
Sbjct  1    MGDFNLALVIVAIVVCVLVFLFNVYLLVNYQHPDDANQAYFPKFVVVFGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACR +IYNGACNLTLPMKELWLA+YI++AVLVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRQAIYNGACNLTLPMKELWLAVYIIDAVLVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVCALLLGILYGL GKVDFTVRHL
Sbjct  121  KRIKSALLWVVTTAIVCALLLGILYGLAGKVDFTVRHL  158



>ref|XP_004492444.1| PREDICTED: LIMR family protein At5g01460-like [Cicer arietinum]
Length=509

 Score =   266 bits (679),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVFL+N+YLLVNYQHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFLVNVYLLVNYQHPDDVNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLA+YI++A+LVFFIIPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAVYIIDAILVFFIIPFAMFYYEGDQDKSIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+LCWV  TAIVCAL+LGILYG+VGKVDFTVRHL
Sbjct  121  KRIKSALCWVVTTAIVCALVLGILYGVVGKVDFTVRHL  158



>ref|XP_009796831.1| PREDICTED: LIMR family protein At5g01460 [Nicotiana sylvestris]
Length=508

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVC++VFL NIYLLVNYQHPDDANQAYFPKFVVV GLS+AAISILML
Sbjct  1    MGDFNLALVIVAIVVCILVFLFNIYLLVNYQHPDDANQAYFPKFVVVLGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLAIYI +AVLVFFIIPFAMF+YEGDQDK++G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAIYIADAVLVFFIIPFAMFYYEGDQDKTIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS++CWV  TAIVCALLLGILYGL GK DFTVRHL
Sbjct  121  KRIKSAMCWVVTTAIVCALLLGILYGLAGKADFTVRHL  158



>ref|XP_009614616.1| PREDICTED: LIMR family protein At5g01460 [Nicotiana tomentosiformis]
Length=508

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVC++VFL NIYLL+NYQHPDDANQAYFPKFVVV GLS+AAISILML
Sbjct  1    MGDFNLALVIVAIVVCILVFLFNIYLLINYQHPDDANQAYFPKFVVVLGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLAIYI +AVLVFF+IPFAMF+YEGDQDK++G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAIYIADAVLVFFVIPFAMFYYEGDQDKTIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+LCWV  TAIVCALLLGILYGL GK DFTVRHL
Sbjct  121  KRIKSALCWVVTTAIVCALLLGILYGLAGKADFTVRHL  158



>gb|KCW86115.1| hypothetical protein EUGRSUZ_B02811 [Eucalyptus grandis]
Length=427

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA VVCV+VFL N+YLLVNYQHPDDANQAYFPK VVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAAVVCVLVFLFNVYLLVNYQHPDDANQAYFPKVVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLAIYIV+AVLVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAIYIVDAVLVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  T IVCAL+LGILYGL+GKVDFTVRHL
Sbjct  121  KRIKSALIWVVTTGIVCALVLGILYGLIGKVDFTVRHL  158



>ref|XP_011077557.1| PREDICTED: LIMR family protein At5g01460 [Sesamum indicum]
Length=509

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAI+VCV+VF+ N+YLLVNYQHPDDANQAYFPKFVVV GLS+AAISILML
Sbjct  1    MGDFNLALVIVAIIVCVLVFIFNVYLLVNYQHPDDANQAYFPKFVVVLGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLAIYIV+AVLVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAIYIVDAVLVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV +TA+VCALLLGILYGLVGKVDFTVRHL
Sbjct  121  KRLKSALIWVILTAVVCALLLGILYGLVGKVDFTVRHL  158



>ref|XP_007026706.1| LMBR1-like membrane protein isoform 2 [Theobroma cacao]
 gb|EOY07208.1| LMBR1-like membrane protein isoform 2 [Theobroma cacao]
Length=512

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAI+VCV+VFL N+YLLVNYQHPDDANQAYFPKFVVVFGLS+AAISILML
Sbjct  1    MGDFNLALVIVAIIVCVLVFLFNVYLLVNYQHPDDANQAYFPKFVVVFGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACR++IYNGAC LTLPMK+LWLA+YIV+AVLVFFIIPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRNAIYNGACKLTLPMKDLWLAVYIVDAVLVFFIIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVCALLLGILYGLVGKVDFTVRHL
Sbjct  121  KRIKSALLWVVTTAIVCALLLGILYGLVGKVDFTVRHL  158



>emb|CDY68816.1| BnaAnng28470D, partial [Brassica napus]
Length=202

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ ++YLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSVYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLA+YIV+A+LVFF+IPFAMFFYEGDQ+K++G
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAVYIVDAILVFFVIPFAMFFYEGDQEKTMG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALLWVVSTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_007026705.1| LMBR1-like membrane protein isoform 1 [Theobroma cacao]
 gb|EOY07207.1| LMBR1-like membrane protein isoform 1 [Theobroma cacao]
Length=510

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAI+VCV+VFL N+YLLVNYQHPDDANQAYFPKFVVVFGLS+AAISILML
Sbjct  1    MGDFNLALVIVAIIVCVLVFLFNVYLLVNYQHPDDANQAYFPKFVVVFGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACR++IYNGAC LTLPMK+LWLA+YIV+AVLVFFIIPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRNAIYNGACKLTLPMKDLWLAVYIVDAVLVFFIIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVCALLLGILYGLVGKVDFTVRHL
Sbjct  121  KRIKSALLWVVTTAIVCALLLGILYGLVGKVDFTVRHL  158



>emb|CDY27961.1| BnaC05g43630D [Brassica napus]
Length=509

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMKELWLA+YIV+A+LVFF+IPFAMFFYEGDQDKSLG
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKELWLAVYIVDAILVFFVIPFAMFFYEGDQDKSLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKSSL WV  TA+VCAL+LGILYG++GKVDFTVRHL
Sbjct  121  KRIKSSLLWVVSTAVVCALVLGILYGVIGKVDFTVRHL  158



>ref|XP_006429390.1| hypothetical protein CICLE_v10011517mg [Citrus clementina]
 ref|XP_006481038.1| PREDICTED: LIMR family protein At5g01460-like [Citrus sinensis]
 gb|ESR42630.1| hypothetical protein CICLE_v10011517mg [Citrus clementina]
Length=510

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCV+VF+ N+YLLVNYQHPDDANQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVVCVLVFIFNVYLLVNYQHPDDANQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLA+YI++AVLVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAVYILDAVLVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV +TAIVCAL+LGILYGLVGKVDFTVRHL
Sbjct  121  KRIKSALIWVIMTAIVCALVLGILYGLVGKVDFTVRHL  158



>ref|XP_008367161.1| PREDICTED: LIMR family protein At5g01460 [Malus domestica]
Length=508

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAI++C+IVF+ N+YLLVNYQHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIILCIIVFVFNVYLLVNYQHPDDKNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLAIYI++AVLVFFIIPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAIYILDAVLVFFIIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRI S+L WVAVTA+VCAL+LGILYGLVGKVDFTVRHL
Sbjct  121  KRIGSALLWVAVTAVVCALVLGILYGLVGKVDFTVRHL  158



>ref|XP_004246766.1| PREDICTED: LIMR family protein At5g01460 [Solanum lycopersicum]
Length=509

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVC++VF++N+YLL+NYQHPDDANQAYFPKFVVVFGLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVVCILVFVVNVYLLINYQHPDDANQAYFPKFVVVFGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQAC+H+IYNGACNLTLPMK+LWLAIYIV+A+LVFF+IPFAMF+YEGDQDK++ 
Sbjct  61   PADVANRQACQHAIYNGACNLTLPMKQLWLAIYIVDAILVFFVIPFAMFYYEGDQDKTIA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS++CWV VTAIVCALLLGILYGL GK DFTVRHL
Sbjct  121  KRLKSAMCWVLVTAIVCALLLGILYGLAGKADFTVRHL  158



>ref|XP_008243726.1| PREDICTED: LIMR family protein At5g01460 [Prunus mume]
Length=508

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAI++CVIVF+ N+YLLVNYQHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIILCVIVFVFNVYLLVNYQHPDDKNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK++WLAIYI++AVLVFFIIPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDMWLAIYILDAVLVFFIIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRI+S+L WV VTAIVCAL+LGILYGLVGKVDFTVRHL
Sbjct  121  KRIRSALLWVVVTAIVCALVLGILYGLVGKVDFTVRHL  158



>ref|XP_007205059.1| hypothetical protein PRUPE_ppa004457mg [Prunus persica]
 gb|EMJ06258.1| hypothetical protein PRUPE_ppa004457mg [Prunus persica]
Length=508

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAI++CVIVF+ N+YLLVNYQHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIILCVIVFVFNVYLLVNYQHPDDKNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK++WLAIYI++AVLVFFIIPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDMWLAIYILDAVLVFFIIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRI+S+L WV VTAIVCAL+LGILYGLVGKVDFTVRHL
Sbjct  121  KRIRSALLWVVVTAIVCALVLGILYGLVGKVDFTVRHL  158



>ref|XP_002873012.1| LMBR1 integral membrane family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49271.1| LMBR1 integral membrane family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCV+VF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVLVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRHSIYNGACNLTLPMKELWLA+YIV+AVLVFFIIPFAMFFYEGDQDK+LG
Sbjct  61   PADVANRHACRHSIYNGACNLTLPMKELWLAVYIVDAVLVFFIIPFAMFFYEGDQDKALG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_002280330.1| PREDICTED: LIMR family protein At5g01460 [Vitis vinifera]
 emb|CBI30389.3| unnamed protein product [Vitis vinifera]
Length=509

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCV+VFL NIYLLVNYQHPDDANQAYFPKFVVV GLS+AAISILML
Sbjct  1    MGDFNLALVIVAIVVCVLVFLFNIYLLVNYQHPDDANQAYFPKFVVVLGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACN TLPM++LWLAIYIV+AVLVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNFTLPMRDLWLAIYIVDAVLVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVCAL+LGILYGLVGKVDFTVRHL
Sbjct  121  KRIKSALLWVITTAIVCALVLGILYGLVGKVDFTVRHL  158



>emb|CDY64938.1| BnaA05g37080D [Brassica napus]
Length=509

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMKELWL++YIV+A+LVFF+IPFAMFFYEGDQDKSLG
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKELWLSVYIVDAILVFFVIPFAMFFYEGDQDKSLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKSSL WV  TA+VCAL+LGILYG++GKVDFTVRHL
Sbjct  121  KRIKSSLLWVVSTAVVCALVLGILYGVIGKVDFTVRHL  158



>ref|XP_006365594.1| PREDICTED: LIMR family protein At5g01460-like [Solanum tuberosum]
Length=509

 Score =   263 bits (673),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVC++VF+ N+YLL+NYQHPDDANQAYFPKFVVVFGLS+AAISILML
Sbjct  1    MGDFNLALVIVAIVVCILVFIFNVYLLINYQHPDDANQAYFPKFVVVFGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQAC+H+IYNGACNLTLPMK+LWLAIYIV+A+LVFF+IPFAMF+YEGDQDK++ 
Sbjct  61   PADVANRQACQHAIYNGACNLTLPMKQLWLAIYIVDAILVFFVIPFAMFYYEGDQDKTIA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS++CWV VTAIVCALLLGILYGL GK DFTVRHL
Sbjct  121  KRLKSAMCWVLVTAIVCALLLGILYGLAGKADFTVRHL  158



>ref|XP_009377765.1| PREDICTED: LIMR family protein At5g01460 [Pyrus x bretschneideri]
Length=507

 Score =   263 bits (672),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIV+C+IVF+ N+YLLVNYQHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVLCIIVFVFNVYLLVNYQHPDDKNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLAIYI++AVLVFFIIPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAIYILDAVLVFFIIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRI S+L WV VTAIVCAL+LGILYGLVGKVDFT+RHL
Sbjct  121  KRIGSALLWVGVTAIVCALVLGILYGLVGKVDFTIRHL  158



>ref|XP_008355714.1| PREDICTED: LOW QUALITY PROTEIN: LIMR family protein At5g01460-like 
[Malus domestica]
Length=508

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIV+C+IVF+ N+YLLVNYQHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVLCIIVFVFNVYLLVNYQHPDDKNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLAIYI++AVLVFFIIPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAIYILDAVLVFFIIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRI S+L WV VTAIVCAL+LGILYGLVGKVDFT+RHL
Sbjct  121  KRIGSALLWVGVTAIVCALVLGILYGLVGKVDFTIRHL  158



>ref|XP_010451983.1| PREDICTED: LIMR family protein At5g01460-like [Camelina sativa]
Length=509

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLALLIVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALLIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRHSIYNGACNLTLPMK+LWLA+YI++AVLVFFIIPFAMFFYEGDQDKSLG
Sbjct  61   PADVANRHACRHSIYNGACNLTLPMKDLWLAVYIIDAVLVFFIIPFAMFFYEGDQDKSLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>gb|KCW86112.1| hypothetical protein EUGRSUZ_B02811 [Eucalyptus grandis]
Length=516

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA VVCV+VFL N+YLLVNYQHPDDANQAYFPK VVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAAVVCVLVFLFNVYLLVNYQHPDDANQAYFPKVVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLAIYIV+AVLVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAIYIVDAVLVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  T IVCAL+LGILYGL+GKVDFTVRHL
Sbjct  121  KRIKSALIWVVTTGIVCALVLGILYGLIGKVDFTVRHL  158



>ref|XP_010044098.1| PREDICTED: LIMR family protein At5g01460 [Eucalyptus grandis]
 gb|KCW86113.1| hypothetical protein EUGRSUZ_B02811 [Eucalyptus grandis]
Length=509

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA VVCV+VFL N+YLLVNYQHPDDANQAYFPK VVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAAVVCVLVFLFNVYLLVNYQHPDDANQAYFPKVVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLAIYIV+AVLVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAIYIVDAVLVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  T IVCAL+LGILYGL+GKVDFTVRHL
Sbjct  121  KRIKSALIWVVTTGIVCALVLGILYGLIGKVDFTVRHL  158



>gb|KHN05546.1| LIMR family protein [Glycine soja]
Length=509

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VVCVIVFL+N+YLLVNYQHPDDANQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAVVVCVIVFLVNVYLLVNYQHPDDANQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGAC+LTLPMK+LWLA+YI++AVLVFF+IPFAMFFYEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACSLTLPMKDLWLAVYILDAVLVFFVIPFAMFFYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L W+  TAIVCAL+LGILYGLVGKVDFTVRHL
Sbjct  121  KRIKSALLWMVTTAIVCALVLGILYGLVGKVDFTVRHL  158



>ref|XP_010553121.1| PREDICTED: LIMR family protein At5g01460 [Tarenaya hassleriana]
Length=509

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCV+VF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVLVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLAIYIV+AVLVFF+IPFAMFFYEGDQDKS+G
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAIYIVDAVLVFFVIPFAMFFYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVCAL+LGILYGL+GKVDF+VRHL
Sbjct  121  KRIKSALLWVITTAIVCALVLGILYGLIGKVDFSVRHL  158



>ref|XP_009146971.1| PREDICTED: LIMR family protein At3g08930-like [Brassica rapa]
Length=509

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMKELWLA+YIV+A+LVFF+IPFAMFFYEGDQDKSLG
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKELWLAVYIVDAILVFFVIPFAMFFYEGDQDKSLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKSSL WV  TA+VCAL+LGILYG++GKVDF VRHL
Sbjct  121  KRIKSSLLWVVSTAVVCALVLGILYGVIGKVDFNVRHL  158



>ref|XP_003552245.1| PREDICTED: LIMR family protein At5g01460-like [Glycine max]
Length=509

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VVCVIVFL+N+YLLVNYQHPDDANQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAVVVCVIVFLVNVYLLVNYQHPDDANQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGAC+LTLPMK+LWLA+YI++AVLVFF+IPFAMFFYEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACSLTLPMKDLWLAVYILDAVLVFFVIPFAMFFYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L W+  TAIVCAL+LGILYGLVGKVDFTVRHL
Sbjct  121  KRIKSALLWMVTTAIVCALVLGILYGLVGKVDFTVRHL  158



>ref|XP_010490562.1| PREDICTED: LOW QUALITY PROTEIN: LIMR family protein At5g01460 
[Camelina sativa]
Length=509

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLALLIVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALLIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRHSIYNGACNLTLPMK+LWLA+YI++AVLVFFIIPFAMFFYEGDQDKSLG
Sbjct  61   PADVANRHACRHSIYNGACNLTLPMKDLWLAVYIIDAVLVFFIIPFAMFFYEGDQDKSLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_003529151.1| PREDICTED: LIMR family protein At5g01460-like [Glycine max]
Length=509

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VVCVIVFL+N+YLLVNYQHPDDANQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAVVVCVIVFLVNVYLLVNYQHPDDANQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGAC+LTLPMK+LWLA+YI++AVLVFF+IPFAMFFYEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACSLTLPMKDLWLAVYILDAVLVFFVIPFAMFFYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L W+  TAIVCAL+LGILYGLVGKVDFT+RHL
Sbjct  121  KRIKSALMWMVTTAIVCALVLGILYGLVGKVDFTIRHL  158



>gb|KFK24650.1| hypothetical protein AALP_AA8G007300 [Arabis alpina]
Length=509

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRHSIYNGACNLTLPMK+LWLA+YIV+A+LVFFIIPFAMFFYEGDQDK+LG
Sbjct  61   PADVANRHACRHSIYNGACNLTLPMKDLWLAVYIVDAILVFFIIPFAMFFYEGDQDKTLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_010424827.1| PREDICTED: LIMR family protein At5g01460-like [Camelina sativa]
Length=485

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRHSIYNGACNLTLPMK+LWLA+YI++AVLVFF+IPFAMFFYEGDQDKSLG
Sbjct  61   PADVANRHACRHSIYNGACNLTLPMKDLWLAVYIIDAVLVFFVIPFAMFFYEGDQDKSLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_007133897.1| hypothetical protein PHAVU_010G001200g [Phaseolus vulgaris]
 gb|ESW05891.1| hypothetical protein PHAVU_010G001200g [Phaseolus vulgaris]
Length=508

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVFL+N+YLLVNYQHPDD NQAYFPKFVVV GLSV+AISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFLVNVYLLVNYQHPDDVNQAYFPKFVVVLGLSVSAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLA+YI++A+LVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAVYILDALLVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+LCW+  TAIVCAL+LGILYG++GKVDFTVRHL
Sbjct  121  KRIKSALCWMVTTAIVCALVLGILYGIIGKVDFTVRHL  158



>ref|NP_195766.1| LMBR1-like membrane protein [Arabidopsis thaliana]
 sp|Q9M028.1|LMBD2_ARATH RecName: Full=LIMR family protein At5g01460 [Arabidopsis thaliana]
 emb|CAB81929.1| putative protein [Arabidopsis thaliana]
 gb|AAL60018.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20080.1| unknown protein [Arabidopsis thaliana]
 gb|AED90347.1| LMBR1-like membrane protein [Arabidopsis thaliana]
Length=509

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRHSIYNGACNLTLPMK+LWLA+YIV+AVLVFFIIPFAMFFYEGDQDK+LG
Sbjct  61   PADVANRHACRHSIYNGACNLTLPMKDLWLAVYIVDAVLVFFIIPFAMFFYEGDQDKALG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_006287547.1| hypothetical protein CARUB_v10000756mg [Capsella rubella]
 gb|EOA20445.1| hypothetical protein CARUB_v10000756mg [Capsella rubella]
Length=509

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRHSIYNGACNLTLPMK+LWLA+YI++AVLVFFIIPFAMFFYEGDQDK+LG
Sbjct  61   PADVANRHACRHSIYNGACNLTLPMKDLWLAVYIIDAVLVFFIIPFAMFFYEGDQDKTLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_010095237.1| hypothetical protein L484_008245 [Morus notabilis]
 gb|EXB59005.1| hypothetical protein L484_008245 [Morus notabilis]
Length=544

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVFL NIYLLVNYQHPDDANQAYFPKF+VV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFLFNIYLLVNYQHPDDANQAYFPKFIVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLA+YI++AVLVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAVYILDAVLVFFVIPFAMFYYEGDQDKSIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVC L+LGILYGL+G+VDFTVRHL
Sbjct  121  KRIKSALLWVVTTAIVCGLVLGILYGLIGEVDFTVRHL  158



>ref|XP_010543204.1| PREDICTED: LIMR family protein At5g01460 [Tarenaya hassleriana]
Length=509

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCV+VF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVLVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLAIYIV+AVLVFFIIPF+MFFYEGDQDKS+G
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAIYIVDAVLVFFIIPFSMFFYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALLWVVATAIVCALVLGILYGIIGKVDFSVRHL  158



>gb|KCW86114.1| hypothetical protein EUGRSUZ_B02811 [Eucalyptus grandis]
Length=468

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA VVCV+VFL N+YLLVNYQHPDDANQAYFPK VVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAAVVCVLVFLFNVYLLVNYQHPDDANQAYFPKVVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLAIYIV+AVLVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAIYIVDAVLVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  T IVCAL+LGILYGL+GKVDFTVRHL
Sbjct  121  KRIKSALIWVVTTGIVCALVLGILYGLIGKVDFTVRHL  158



>ref|XP_004302541.1| PREDICTED: LIMR family protein At5g01460 [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAI++ V+VF+ N+YLLVNYQHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIILVVVVFVFNVYLLVNYQHPDDKNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLA+YI++AVLVF IIPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAVYILDAVLVFLIIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRI S++CWV V+A+VCAL+LGILYGL+GKVDFTVRHL
Sbjct  121  KRIGSAMCWVGVSAVVCALVLGILYGLIGKVDFTVRHL  158



>ref|XP_010486441.1| PREDICTED: LIMR family protein At3g08930 [Camelina sativa]
Length=509

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLSVA ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSVAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLAIYIV+A+LVFF+IPFAMFFYEGDQDK+LG
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAIYIVDAILVFFVIPFAMFFYEGDQDKTLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALLWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_006299427.1| hypothetical protein CARUB_v10015588mg [Capsella rubella]
 gb|EOA32325.1| hypothetical protein CARUB_v10015588mg [Capsella rubella]
Length=509

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLAIYIV+A+LVFF+IPFAMFFYEGDQDK+LG
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAIYIVDAILVFFVIPFAMFFYEGDQDKTLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_006398614.1| hypothetical protein EUTSA_v10013023mg [Eutrema salsugineum]
 gb|ESQ40067.1| hypothetical protein EUTSA_v10013023mg [Eutrema salsugineum]
Length=599

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +3

Query  63   EKMGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISIL  242
            + MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISIL
Sbjct  89   QAMGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISIL  148

Query  243  MLPADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKS  422
            MLPADVANR ACRHSIYNGACNLTLPMK LWLA+YIV+AVLVFFIIPFAMFFYEGDQDKS
Sbjct  149  MLPADVANRHACRHSIYNGACNLTLPMKNLWLAVYIVDAVLVFFIIPFAMFFYEGDQDKS  208

Query  423  LGKRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            LGKRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  209  LGKRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  248



>ref|XP_007140346.1| hypothetical protein PHAVU_008G104400g [Phaseolus vulgaris]
 gb|ESW12340.1| hypothetical protein PHAVU_008G104400g [Phaseolus vulgaris]
Length=509

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VVCVIVFL+N+YLLVNYQHPDDANQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAVVVCVIVFLVNVYLLVNYQHPDDANQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMKELWLA+YI++AVLVFF+IPFAMF+YEGD DK++G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKELWLAVYILDAVLVFFVIPFAMFYYEGDLDKTVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L W+  TAIVCAL+LGILYGLVGKVDFTVRHL
Sbjct  121  KRVKSALLWMVTTAIVCALVLGILYGLVGKVDFTVRHL  158



>ref|XP_002882590.1| hypothetical protein ARALYDRAFT_478196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58849.1| hypothetical protein ARALYDRAFT_478196 [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLAIYIV+A+LVFF+IPFAMFFYEGDQDK+LG
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAIYIVDAILVFFVIPFAMFFYEGDQDKTLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|NP_566338.2| LMBR1-like membrane protein [Arabidopsis thaliana]
 sp|Q9SR93.2|LMBD1_ARATH RecName: Full=LIMR family protein At3g08930 [Arabidopsis thaliana]
 gb|AAK59596.1| unknown protein [Arabidopsis thaliana]
 gb|AAN60291.1| unknown [Arabidopsis thaliana]
 gb|AAV97805.1| At3g08930 [Arabidopsis thaliana]
 gb|AEE74696.1| LMBR1-like membrane protein [Arabidopsis thaliana]
Length=509

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLAIYIV+A+LVFF+IPFAMFFYEGDQDK+LG
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAIYIVDAILVFFVIPFAMFFYEGDQDKTLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_010464511.1| PREDICTED: LIMR family protein At3g08930-like [Camelina sativa]
Length=509

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLAIYIV+A+LVFF+IPFAMFFYEGDQDK+LG
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAIYIVDAILVFFVIPFAMFFYEGDQDKTLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALLWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_010466717.1| PREDICTED: LIMR family protein At3g08930-like [Camelina sativa]
Length=509

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLAIYIV+A+LVFF+IPFAMFFYEGDQDK+LG
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAIYIVDAILVFFVIPFAMFFYEGDQDKTLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALLWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_011019120.1| PREDICTED: LIMR family protein At5g01460-like [Populus euphratica]
Length=509

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVC+IV L N+YLLVNYQHPDD NQAYFPKFVVVFGLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVVCIIVLLFNVYLLVNYQHPDDKNQAYFPKFVVVFGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LW+A+YIV+AVLVFFIIPFAMF+YEGDQDKS+ 
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWIAVYIVDAVLVFFIIPFAMFYYEGDQDKSVA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVC L+LGILYG++GKVDFTVRHL
Sbjct  121  KRIKSALLWVITTAIVCGLVLGILYGVIGKVDFTVRHL  158



>ref|XP_004506746.1| PREDICTED: LIMR family protein At5g01460-like [Cicer arietinum]
Length=509

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIV+CVIVFL N+YLLVNYQHPDD NQAYFPKFVVV GLSVA ISILML
Sbjct  1    MGDFNLALVIVAIVLCVIVFLFNVYLLVNYQHPDDVNQAYFPKFVVVLGLSVAVISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLAIYIV+A+LVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAIYIVDAILVFFVIPFAMFYYEGDQDKSIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+LCW+  TA+VCAL+LGILYGL+GKVDFTV+HL
Sbjct  121  KRIKSALCWMVTTALVCALVLGILYGLIGKVDFTVKHL  158



>ref|XP_006407732.1| hypothetical protein EUTSA_v10020541mg [Eutrema salsugineum]
 gb|ESQ49185.1| hypothetical protein EUTSA_v10020541mg [Eutrema salsugineum]
Length=509

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLSVA ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSVAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWL IYIV+A+LVFF+IPFAMFFYEGDQDKSLG
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLVIYIVDAILVFFVIPFAMFFYEGDQDKSLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHL  158



>ref|XP_002308217.1| LMBR1 integral membrane family protein [Populus trichocarpa]
 gb|EEE91740.1| LMBR1 integral membrane family protein [Populus trichocarpa]
Length=509

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVC+IV L N+YLLVNYQHPDD NQAYFPKFVVVFGLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVVCIIVLLFNVYLLVNYQHPDDKNQAYFPKFVVVFGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LW+A+YIV+AVLVFFIIPFAMF+YEGDQDKS+ 
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWIAVYIVDAVLVFFIIPFAMFYYEGDQDKSVA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVC L+LGILYG++GKVDFTVRHL
Sbjct  121  KRIKSALLWVITTAIVCGLVLGILYGVIGKVDFTVRHL  158



>gb|KEH23159.1| LIMR family protein [Medicago truncatula]
Length=509

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVFL+N+YLLVNYQHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFLVNVYLLVNYQHPDDVNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK LWLA+YI++A+LVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKNLWLAVYIIDAILVFFVIPFAMFYYEGDQDKSIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L W+  TA+VCAL+LGILYGLVGKVDFTVRHL
Sbjct  121  KRIKSALMWMVSTAVVCALVLGILYGLVGKVDFTVRHL  158



>ref|XP_011095010.1| PREDICTED: LIMR family protein At5g01460-like [Sesamum indicum]
Length=509

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAI+VCV+VF+ N+YLLVNYQHPDDANQAYFPKFVVVFGLS+AAISILML
Sbjct  1    MGDFNLALVIVAIIVCVLVFIFNVYLLVNYQHPDDANQAYFPKFVVVFGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLA+YI++A+LVFF+IPFAMF+YEGD DK++ 
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAVYIIDALLVFFVIPFAMFYYEGDLDKTVW  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV VTA+VCALLLGILYGLVGKVDFTVRHL
Sbjct  121  KRMKSALLWVIVTAVVCALLLGILYGLVGKVDFTVRHL  158



>ref|XP_011006556.1| PREDICTED: LIMR family protein At5g01460 [Populus euphratica]
Length=509

 Score =   259 bits (661),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL++VAIVVC+IVFL NIYLLVNYQHPDD NQAYFPKFVVVFGL VAAISILML
Sbjct  1    MGDFNLALVVVAIVVCIIVFLFNIYLLVNYQHPDDKNQAYFPKFVVVFGLFVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LW+A+YIV+AVLVFFIIPFAMF+YEGDQDKS+ 
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWIAVYIVDAVLVFFIIPFAMFYYEGDQDKSVA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVC L+LGILYGLVGKVDFTVRHL
Sbjct  121  KRIKSALLWVITTAIVCGLVLGILYGLVGKVDFTVRHL  158



>gb|KFK38280.1| hypothetical protein AALP_AA3G093600 [Arabis alpina]
Length=509

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLA+YIV+A+LVFF+IPFAMFFYEGDQDK++G
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAVYIVDAILVFFVIPFAMFFYEGDQDKAVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALIWVGTTAVVCALVLGILYGVIGKVDFSVRHL  158



>emb|CDP06485.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCV+VF+ NIYLL+NYQHPDD NQAYFPKFVVV GLS+AAISILML
Sbjct  1    MGDFNLALVIVAIVVCVLVFIFNIYLLINYQHPDDVNQAYFPKFVVVLGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGAC LTLPMK+LWLA+YI +A+LVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACKLTLPMKDLWLAVYIADAILVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVCAL+LGILYGLVGKVDFTVRHL
Sbjct  121  KRIKSALWWVITTAIVCALVLGILYGLVGKVDFTVRHL  158



>ref|XP_003520496.1| PREDICTED: LIMR family protein At3g08930-like [Glycine max]
Length=508

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVFL N+YLLVN+QHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFLFNVYLLVNFQHPDDVNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGAC+LTLPMK+LWLAIYI++AVLVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACSLTLPMKDLWLAIYILDAVLVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L W+  TAIVCAL+LGILYGL+GKVDFTVRHL
Sbjct  121  KRIKSALLWMVTTAIVCALVLGILYGLIGKVDFTVRHL  158



>ref|XP_002528095.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34274.1| conserved hypothetical protein [Ricinus communis]
Length=509

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVC++V L N+YLLVNYQHPDD NQAYFPKFVVV GLSVA ISILML
Sbjct  1    MGDFNLALVIVAIVVCIVVLLFNVYLLVNYQHPDDKNQAYFPKFVVVLGLSVALISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LW+A+YI++AVLVFFIIPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWIAVYIIDAVLVFFIIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            +RIKS+L WV  TAIVC L+LGILYGLVGKVDFTVRHL
Sbjct  121  QRIKSALVWVITTAIVCGLVLGILYGLVGKVDFTVRHL  158



>gb|EYU41891.1| hypothetical protein MIMGU_mgv1a004832mg [Erythranthe guttata]
Length=508

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLALL+VA++VCV+VF+ N+YLLVNYQHPDDANQAYFPKFVVV GLS+AAISILML
Sbjct  1    MGDFNLALLLVAVIVCVLVFVFNVYLLVNYQHPDDANQAYFPKFVVVLGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LWLAIYI++A+LVFF+IPFAMF+YEGDQDK++ 
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWLAIYIIDAILVFFVIPFAMFYYEGDQDKTVW  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+  WV VTA+VCAL+LGILYGL+GKVDFTVRHL
Sbjct  121  KRVKSASLWVIVTAVVCALVLGILYGLIGKVDFTVRHL  158



>gb|EYU26666.1| hypothetical protein MIMGU_mgv1a004810mg [Erythranthe guttata]
Length=509

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL++VAI+VCV+VF+ N+YLLVNYQHPDDANQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVLVAIIVCVLVFIFNVYLLVNYQHPDDANQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMKELWLAIYI++A+LVFF+IPFAMF+YEGD DK++ 
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKELWLAIYILDAILVFFVIPFAMFYYEGDLDKTVW  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV VTAI+CAL+LGILYG+VGKVDFTVRHL
Sbjct  121  KRMKSALVWVIVTAIICALVLGILYGVVGKVDFTVRHL  158



>ref|XP_002323579.1| LMBR1 integral membrane family protein [Populus trichocarpa]
 gb|EEF05340.1| LMBR1 integral membrane family protein [Populus trichocarpa]
Length=509

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVC+IVFL NIYLLVNYQHPDD NQAYFPKFVVVFGL VA ISILML
Sbjct  1    MGDFNLALVIVAIVVCIIVFLFNIYLLVNYQHPDDKNQAYFPKFVVVFGLFVATISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LW+A+YIV+AVLVFFIIPFAMF+YEGDQDKS+ 
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWIAVYIVDAVLVFFIIPFAMFYYEGDQDKSVA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVC L+LGILYGLVGKVDFTVRHL
Sbjct  121  KRIKSALLWVITTAIVCGLVLGILYGLVGKVDFTVRHL  158



>ref|XP_010262857.1| PREDICTED: LIMR family protein At5g01460 [Nelumbo nucifera]
Length=509

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCV+VF+ N+YLLVNYQHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVVCVLVFIFNVYLLVNYQHPDDVNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IY+GACNLTLPMKELWL +YIV+AVLVFF+IPFAMF+YEGDQDKS+ 
Sbjct  61   PADVANRQACRHAIYSGACNLTLPMKELWLIVYIVDAVLVFFVIPFAMFYYEGDQDKSVA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TAIVC L+LGILYGL+GKVDFTVRHL
Sbjct  121  KRIKSALLWVVTTAIVCGLVLGILYGLIGKVDFTVRHL  158



>ref|XP_008449896.1| PREDICTED: LIMR family protein At5g01460 [Cucumis melo]
Length=509

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ N+YLLVNYQHPDD NQAYFPKFVVVFGLSVA ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFIFNVYLLVNYQHPDDKNQAYFPKFVVVFGLSVALISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQAC+H++YNGACNLTLPMK+LWLAIYIV+AVLVFFIIPFAMF+YEGDQDK +G
Sbjct  61   PADVANRQACKHALYNGACNLTLPMKDLWLAIYIVDAVLVFFIIPFAMFYYEGDQDKGIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV V AIVCALLLGILYGLVG+VDFTV HL
Sbjct  121  KRIKSALIWVVVMAIVCALLLGILYGLVGEVDFTVMHL  158



>ref|XP_010253885.1| PREDICTED: LIMR family protein At5g01460 [Nelumbo nucifera]
Length=509

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA VVCV+VF++N+YLLVNYQHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAAVVCVLVFIVNLYLLVNYQHPDDVNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQAC+H+IYNGACNLTLPMKELWL +YIV+AVLVFF+IPFAMF+YEGD+DKS+G
Sbjct  61   PADVANRQACQHAIYNGACNLTLPMKELWLIVYIVDAVLVFFVIPFAMFYYEGDEDKSIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR KS+L WV  TAIVC L+LGILYG+VGKVDFTVRHL
Sbjct  121  KRAKSALMWVVTTAIVCGLMLGILYGVVGKVDFTVRHL  158



>ref|XP_009135079.1| PREDICTED: LIMR family protein At3g08930 [Brassica rapa]
 emb|CDY07894.1| BnaC03g36290D [Brassica napus]
 emb|CDX73948.1| BnaA03g30990D [Brassica napus]
Length=509

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ ++YLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSVYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLA+YIV+A+LVFF+IPFAMFFYEGDQ+K++G
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAVYIVDAILVFFVIPFAMFFYEGDQEKTMG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+VRHL
Sbjct  121  KRIKSALLWVVSTAVVCALVLGILYGVIGKVDFSVRHL  158



>gb|KDP24450.1| hypothetical protein JCGZ_25014 [Jatropha curcas]
Length=509

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVC+IVF+ N+YLL+NYQHPDD NQAYFPKFVVV GLS+A ISILML
Sbjct  1    MGDFNLALIIVAIVVCIIVFIFNVYLLINYQHPDDKNQAYFPKFVVVLGLSIALISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK+LW+A+YI++A+LVFFIIPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKDLWIAVYIIDALLVFFIIPFAMFYYEGDQDKSIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            +R+KS+L WV  TAIVC L LGILYGLVGKVDFTVRHL
Sbjct  121  QRMKSALLWVITTAIVCGLALGILYGLVGKVDFTVRHL  158



>ref|XP_006848221.1| hypothetical protein AMTR_s00029p00244850 [Amborella trichopoda]
 gb|ERN09802.1| hypothetical protein AMTR_s00029p00244850 [Amborella trichopoda]
Length=509

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA VVCV+VF+ N+YLL+NYQHPDD NQAYFPKF+VV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAAVVCVLVFIFNVYLLINYQHPDDVNQAYFPKFIVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQAC++SIYNGACNLTLPMK+LWLAIYIV+A+LVFF+IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACKNSIYNGACNLTLPMKDLWLAIYIVDAILVFFVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+ S+L WV  TAIVC L+LGILYGLVGKVDFTV HL
Sbjct  121  KRVLSALMWVVATAIVCGLVLGILYGLVGKVDFTVMHL  158



>gb|AAF07832.1|AC010871_8 unknown protein [Arabidopsis thaliana]
Length=482

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVF+ +IYLLVNYQHPDDANQAYFPKFVVVFGLS+A ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK+LWLAIYIV+A+LVFF+IPFAMFFYEGDQDK+LG
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKDLWLAIYIVDAILVFFVIPFAMFFYEGDQDKTLG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFT  530
            KRIKS+L WV  TA+VCAL+LGILYG++GKVDF+
Sbjct  121  KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFS  154



>gb|KHN42506.1| LIMR family protein [Glycine soja]
Length=515

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 152/165 (92%), Gaps = 7/165 (4%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVFL N+YLLVN+QHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFLFNVYLLVNFQHPDDVNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFI-------IPFAMFFYEG  407
            PADVANRQACRH+IYNGAC+LTLPMK+LWLA+YI++AVLVFF+       IPFAMF+YEG
Sbjct  61   PADVANRQACRHAIYNGACSLTLPMKDLWLAVYILDAVLVFFVIPFAMRPIPFAMFYYEG  120

Query  408  DQDKSLGKRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            DQDKS+GKRIKS+L W+  TAIVCAL+LGILYGL+GKVDFTVRHL
Sbjct  121  DQDKSVGKRIKSALLWMVTTAIVCALVLGILYGLIGKVDFTVRHL  165



>ref|XP_010676736.1| PREDICTED: LIMR family protein At5g01460 [Beta vulgaris subsp. 
vulgaris]
Length=508

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLALLIVAI+VCV+VF+ N+YLL+NYQHPDD NQAYFPKFVVV GLSVA ISILML
Sbjct  1    MGDFNLALLIVAIIVCVLVFVFNVYLLINYQHPDDVNQAYFPKFVVVLGLSVAVISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH++YNGAC LTLPMK+LWLAIYI++A+LVF +IPFAMFFYEGDQDKS+G
Sbjct  61   PADVANRHACRHALYNGACQLTLPMKQLWLAIYIIDAILVFLVIPFAMFFYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS++ WV+VTA++C L+LGILYG++GKV+FTVRHL
Sbjct  121  KRVKSAVLWVSVTAVICGLVLGILYGVIGKVEFTVRHL  158



>ref|XP_008794237.1| PREDICTED: LIMR family protein Os06g0128200-like [Phoenix dactylifera]
Length=510

 Score =   248 bits (632),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VV V+V L +IYLLVNYQHPDD NQAYFPK VVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAVVVSVVVLLASIYLLVNYQHPDDVNQAYFPKLVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK LW A+YI +AVLVFF+IPFAMF+YEGDQDKS+ 
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKTLWFAVYIADAVLVFFVIPFAMFYYEGDQDKSVA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV  +AIVC L+LGILY LVGKVDFTVRHL
Sbjct  121  KRLKSALLWVVTSAIVCGLVLGILYALVGKVDFTVRHL  158



>gb|EPS57824.1| hypothetical protein M569_16993, partial [Genlisea aurea]
Length=494

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLALL+VAIVVCV+VF+ N+YLLVNYQHPDDANQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALLLVAIVVCVLVFIFNVYLLVNYQHPDDANQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACR++IYNGACNLTLPM+ LWLA+YI++AVLVFF+IPFAMF+YEGD DKS+ 
Sbjct  61   PADVANRQACRNAIYNGACNLTLPMRSLWLAVYIIDAVLVFFVIPFAMFYYEGDLDKSVW  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KSSL WV VTAIVCAL LGILYG++GKVDFTV  L
Sbjct  121  KRMKSSLVWVIVTAIVCALALGILYGVIGKVDFTVMRL  158



>ref|XP_010920999.1| PREDICTED: LIMR family protein Os06g0128200-like [Elaeis guineensis]
Length=510

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VVCV+V L++IYLLVNYQHPDD NQAYFPK VVV GLS+AAISILML
Sbjct  1    MGDFNLALVIVAVVVCVLVLLVSIYLLVNYQHPDDVNQAYFPKLVVVVGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR ACRH+IYNGACNLTLPMK LW  +YI +AVLVFF+IPFAMF+YEGDQDKS+ 
Sbjct  61   PADVANRHACRHAIYNGACNLTLPMKTLWFVVYITDAVLVFFVIPFAMFYYEGDQDKSVA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV  +AIVC L+LGILY LVGKVDFTVRHL
Sbjct  121  KRLKSALLWVVTSAIVCGLVLGILYALVGKVDFTVRHL  158



>ref|XP_010937920.1| PREDICTED: LIMR family protein Os06g0128200 isoform X2 [Elaeis 
guineensis]
Length=477

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VV  +V L+++YLLVNYQHPDD NQAYFPK VVV GLS+AAISILML
Sbjct  1    MGDFNLALVIVAVVVSALVLLVSVYLLVNYQHPDDVNQAYFPKLVVVLGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK LWLA+YI +AVLVFFIIPFAMF+YEGDQDKS+ 
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKTLWLAVYIADAVLVFFIIPFAMFYYEGDQDKSVA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV  +AIVC L+LGILY LVGKVDFTVRHL
Sbjct  121  KRLKSALLWVVTSAIVCGLILGILYALVGKVDFTVRHL  158



>ref|XP_010937919.1| PREDICTED: LIMR family protein Os06g0128200 isoform X1 [Elaeis 
guineensis]
Length=510

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VV  +V L+++YLLVNYQHPDD NQAYFPK VVV GLS+AAISILML
Sbjct  1    MGDFNLALVIVAVVVSALVLLVSVYLLVNYQHPDDVNQAYFPKLVVVLGLSIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGACNLTLPMK LWLA+YI +AVLVFFIIPFAMF+YEGDQDKS+ 
Sbjct  61   PADVANRQACRHAIYNGACNLTLPMKTLWLAVYIADAVLVFFIIPFAMFYYEGDQDKSVA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV  +AIVC L+LGILY LVGKVDFTVRHL
Sbjct  121  KRLKSALLWVVTSAIVCGLILGILYALVGKVDFTVRHL  158



>ref|XP_008789162.1| PREDICTED: LIMR family protein Os06g0128200 [Phoenix dactylifera]
Length=510

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VV V+V L+++YLLVNYQHPDD NQAYFPK VVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAVVVSVLVLLVSVYLLVNYQHPDDVNQAYFPKLVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR+ACRH+IYNGACNLTLPMK LWLA+YI +AVLVFFIIPFAMF+YEGDQDKS+ 
Sbjct  61   PADVANRKACRHAIYNGACNLTLPMKTLWLAVYIADAVLVFFIIPFAMFYYEGDQDKSVA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV  +AIVC L+LGILY LVGKVDFTVRHL
Sbjct  121  KRLKSALLWVVTSAIVCGLVLGILYALVGKVDFTVRHL  158



>ref|XP_004964404.1| PREDICTED: LIMR family protein Os06g0128200-like [Setaria italica]
Length=510

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VV V+V L+++YLLVNYQHPDDANQAYFPK VVVFGL+VA +SILML
Sbjct  1    MGDFNLALVIVAVVVSVLVLLVSVYLLVNYQHPDDANQAYFPKLVVVFGLTVAVLSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACR ++YNGACNLTLPM+ LWL +YIV+AVLVF +IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRKAVYNGACNLTLPMRTLWLVVYIVDAVLVFLVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+K++L WV  +A+VC L+LGILYGLVGKVDFTVRHL
Sbjct  121  KRLKTALIWVVASAVVCGLVLGILYGLVGKVDFTVRHL  158



>dbj|BAD44783.1| LMBR1 integral membrane family protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD67933.1| LMBR1 integral membrane family protein-like [Oryza sativa Japonica 
Group]
Length=440

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFN+AL+IVA VV V+V L+++YLL+NYQHPDDANQAYFPK VVV G++VA +SILML
Sbjct  1    MGDFNVALVIVAAVVSVLVLLVSVYLLINYQHPDDANQAYFPKLVVVLGITVALLSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACR +IY+GAC+LTLPMK LWLA+YI +AVLVF +IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRRAIYSGACSLTLPMKTLWLAVYIADAVLVFLVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+ S+L WVAV+A+VC L+LGILYGLVGKVDFTVRHL
Sbjct  121  KRLTSALLWVAVSAVVCGLILGILYGLVGKVDFTVRHL  158



>ref|NP_001056670.1| Os06g0128200 [Oryza sativa Japonica Group]
 sp|Q658I5.1|LMBD1_ORYSJ RecName: Full=LIMR family protein Os06g0128200 [Oryza sativa 
Japonica Group]
 dbj|BAD44782.1| LMBR1 integral membrane family protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD67932.1| LMBR1 integral membrane family protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF18584.1| Os06g0128200 [Oryza sativa Japonica Group]
 dbj|BAG91141.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79914.1| hypothetical protein OsI_21464 [Oryza sativa Indica Group]
 gb|EEE65018.1| hypothetical protein OsJ_19972 [Oryza sativa Japonica Group]
Length=510

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFN+AL+IVA VV V+V L+++YLL+NYQHPDDANQAYFPK VVV G++VA +SILML
Sbjct  1    MGDFNVALVIVAAVVSVLVLLVSVYLLINYQHPDDANQAYFPKLVVVLGITVALLSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACR +IY+GAC+LTLPMK LWLA+YI +AVLVF +IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRRAIYSGACSLTLPMKTLWLAVYIADAVLVFLVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+ S+L WVAV+A+VC L+LGILYGLVGKVDFTVRHL
Sbjct  121  KRLTSALLWVAVSAVVCGLILGILYGLVGKVDFTVRHL  158



>ref|XP_006655738.1| PREDICTED: LIMR family protein Os06g0128200-like [Oryza brachyantha]
Length=510

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFN+AL+IVA      V L+++YLLVNYQHPDDANQAYFPK VVV G++VA +SILML
Sbjct  1    MGDFNVALVIVAAGGGGPVLLVSVYLLVNYQHPDDANQAYFPKLVVVLGITVAVLSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACR +IY+GAC+LTLPMK LWLA+YI +AVLVF +IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRRAIYSGACSLTLPMKTLWLAVYIADAVLVFLVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+ S+L WV V+A+VC L+LGILYGLVGKVDFTVRHL
Sbjct  121  KRLTSALLWVTVSAVVCGLILGILYGLVGKVDFTVRHL  158



>ref|XP_004148616.1| PREDICTED: LIMR family protein At3g08930-like [Cucumis sativus]
 ref|XP_004168372.1| PREDICTED: LIMR family protein At3g08930-like [Cucumis sativus]
 gb|KGN54382.1| hypothetical protein Csa_4G310190 [Cucumis sativus]
Length=509

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVI+F+ N+YLLVNYQHPDD NQAYFPKFVVVFGLSVA ISILML
Sbjct  1    MGDFNLALVIVAIVVCVIIFIFNVYLLVNYQHPDDKNQAYFPKFVVVFGLSVALISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQAC+H++YNGACNLTLPMK+LWLAIYIV+AVLVFFIIPFAMF+YEGDQDK +G
Sbjct  61   PADVANRQACKHALYNGACNLTLPMKDLWLAIYIVDAVLVFFIIPFAMFYYEGDQDKGIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KRIKS+L WV V AIVC LLLGILYGLVG+VDFTV HL
Sbjct  121  KRIKSALIWVVVMAIVCGLLLGILYGLVGEVDFTVMHL  158



>ref|XP_009416300.1| PREDICTED: LIMR family protein Os06g0128200-like [Musa acuminata 
subsp. malaccensis]
Length=510

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VVCV+V L+N+YLLVN QHPDD NQAYFPK VVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAVVVCVMVLLVNVYLLVNCQHPDDVNQAYFPKLVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQAC+H+IY+GAC LTLPMK+LWLA+Y+ +AVLVF +IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACQHAIYSGACTLTLPMKDLWLAVYVADAVLVFLVIPFAMFYYEGDQDKSIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV  +A+VC L+LGILYGLVGKVDFTVRHL
Sbjct  121  KRLKSALLWVLASAVVCGLVLGILYGLVGKVDFTVRHL  158



>ref|XP_008659355.1| PREDICTED: LIMR family protein Os06g0128200-like [Zea mays]
 gb|AFW86074.1| hypothetical protein ZEAMMB73_453401 [Zea mays]
Length=510

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFN+AL+IVA VV V+V L+++YLLVNYQHPDD NQAYFPK VVV GL+VA +SILML
Sbjct  1    MGDFNVALVIVAAVVSVLVLLVSVYLLVNYQHPDDVNQAYFPKLVVVLGLTVAVLSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACR ++YNGAC+LTLPM+ LWL +YIV+AVLVF +IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRKAVYNGACSLTLPMRTLWLVVYIVDAVLVFLVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR++++L WV  +A+VC L+LGILYGLVGKVDFTVRHL
Sbjct  121  KRLRTALIWVVASAVVCGLVLGILYGLVGKVDFTVRHL  158



>ref|NP_001130482.1| uncharacterized protein LOC100191580 [Zea mays]
 gb|ACF78710.1| unknown [Zea mays]
 gb|ACN30554.1| unknown [Zea mays]
Length=510

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFN+AL+IVA VV V+V L+++YLLVNYQHPDD NQAYFPK VVV GL+VA +SILML
Sbjct  1    MGDFNVALVIVAAVVSVLVLLVSVYLLVNYQHPDDVNQAYFPKLVVVLGLTVAVLSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACR ++YNGAC+LTLPM+ LWL +YIV+AVLVF +IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRKAVYNGACSLTLPMRTLWLVVYIVDAVLVFLVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR++++L WV  +A+VC L+LGILYGLVGKVDFTVRHL
Sbjct  121  KRLRTALIWVVASAVVCGLVLGILYGLVGKVDFTVRHL  158



>ref|XP_009406919.1| PREDICTED: LIMR family protein Os06g0128200 [Musa acuminata subsp. 
malaccensis]
Length=510

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VVCV+V L+N+YLLVNYQHPDD NQAYFPK VVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAVVVCVLVLLVNVYLLVNYQHPDDVNQAYFPKLVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQAC+H+IYNGAC LTLPMK LWL +YI +AVLVF +IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACQHAIYNGACTLTLPMKALWLVVYIADAVLVFLVIPFAMFYYEGDQDKSIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV  +A+VC L+LGILYGLVGKVDFTV+HL
Sbjct  121  KRLKSALLWVLTSAVVCGLVLGILYGLVGKVDFTVKHL  158



>dbj|BAJ85289.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFN+AL+IVA VV V+V L+++YLLVNYQHPDDANQAYFPK VVV G++VA +SILML
Sbjct  1    MGDFNVALVIVAAVVSVLVLLVSVYLLVNYQHPDDANQAYFPKLVVVLGITVAVLSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQAC+ ++Y+GAC+LTLPMK LWL +YI++AVLVF +IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACKRAVYSGACSLTLPMKTLWLVVYIIDAVLVFLVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV  +A+VC L+LGILY L+GKVDFTVRHL
Sbjct  121  KRLKSALIWVVASAVVCGLVLGILYALIGKVDFTVRHL  158



>ref|XP_008811686.1| PREDICTED: LIMR family protein At5g01460-like [Phoenix dactylifera]
Length=510

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNL L +VA+VV V+V L ++YLLVNYQHPDDANQAY PK V V GLS+AA+SILML
Sbjct  1    MGDFNLMLAVVAVVVPVLVILASVYLLVNYQHPDDANQAYLPKAVAVLGLSIAALSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQAC H+IY+GAC+LTLPMK LWL IY+ +A+LVFF+IPFAMF+YEGD DK++G
Sbjct  61   PADVANRQACIHAIYSGACDLTLPMKPLWLFIYVADALLVFFVIPFAMFYYEGDLDKTVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            +R+KS+L WV  + +VC L+L I YGL+GKVDFTVRHL
Sbjct  121  ERMKSALKWVLCSVLVCGLVLLIFYGLLGKVDFTVRHL  158



>ref|XP_002960259.1| hypothetical protein SELMODRAFT_75198 [Selaginella moellendorffii]
 ref|XP_002967454.1| hypothetical protein SELMODRAFT_87136 [Selaginella moellendorffii]
 gb|EFJ32053.1| hypothetical protein SELMODRAFT_87136 [Selaginella moellendorffii]
 gb|EFJ37798.1| hypothetical protein SELMODRAFT_75198 [Selaginella moellendorffii]
Length=509

 Score =   221 bits (564),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            M DFN+ LLI+ IVV V+VFL N YLLVNYQHPDD NQAYFPK VVVFGLSVA +SILML
Sbjct  1    MSDFNVILLIIVIVVTVLVFLFNTYLLVNYQHPDDHNQAYFPKAVVVFGLSVAQLSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANR AC+ ++YNGAC+LTLPMK+LW A+YI++AVLVF +IPF MF+YEGDQ+KS+ 
Sbjct  61   PADVANRHACQRALYNGACDLTLPMKDLWYAVYIIDAVLVFLVIPFTMFYYEGDQEKSVA  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            +R   +L WV V AIV  L+LGILYGL+GKVDFTVRHL
Sbjct  121  RRAVGALMWVIVIAIVVGLVLGILYGLIGKVDFTVRHL  158



>ref|XP_003557109.1| PREDICTED: LIMR family protein Os06g0128200 [Brachypodium distachyon]
Length=510

 Score =   221 bits (564),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFN+AL+IVA VV V+V L+++YLLVNYQHPDDANQAYFPK VVV G++VA +SILML
Sbjct  1    MGDFNVALVIVAAVVSVLVLLVSVYLLVNYQHPDDANQAYFPKLVVVLGITVAVLSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACR ++Y+GAC+LTLPMK LWL +YI +A+LVF +IPFAMF+YEGDQDKS+G
Sbjct  61   PADVANRQACRKAVYSGACSLTLPMKTLWLIVYIADALLVFLVIPFAMFYYEGDQDKSVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+K++L WV  +A++C L+LGILY L+GKVDFTVRHL
Sbjct  121  KRLKTALIWVVASAVICGLILGILYALIGKVDFTVRHL  158



>ref|XP_010907860.1| PREDICTED: LIMR family protein At3g08930-like [Elaeis guineensis]
 ref|XP_010907861.1| PREDICTED: LIMR family protein At3g08930-like [Elaeis guineensis]
Length=510

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNL L +VA+VV V+V L+++YLLVNYQHPDDANQAY PK VVV GLS+AA+SILML
Sbjct  1    MGDFNLMLAVVALVVPVLVILVSVYLLVNYQHPDDANQAYLPKAVVVLGLSIAALSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQAC H++Y+GAC+LTLPMK LWL IY+ +A+LVFF+IPFAMF+YEGD DK++G
Sbjct  61   PADVANRQACIHAVYSGACDLTLPMKPLWLFIYVADALLVFFVIPFAMFYYEGDLDKTVG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            +R+KS+L WV  + +VC L+L I YGL+GKVDFTVRHL
Sbjct  121  ERMKSALKWVLCSFLVCGLVLLICYGLLGKVDFTVRHL  158



>ref|XP_009392724.1| PREDICTED: LIMR family protein Os06g0128200-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLALLIVA+VV  +V L+++YLLVNYQHPDD NQAYFPK VVV G+S+AAISILML
Sbjct  1    MGDFNLALLIVAVVVSALVLLVSVYLLVNYQHPDDHNQAYFPKLVVVLGISIAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PADVANRQACRH+IYNGAC+LTLPMK+LWLA+YI +A+LVFF+IPFAMF+YEGDQDK +G
Sbjct  61   PADVANRQACRHAIYNGACSLTLPMKQLWLAVYIADAILVFFVIPFAMFYYEGDQDKGIG  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            KR+KS+L WV  +AIVC LLLGILYGLVGKVDFTVRHL
Sbjct  121  KRLKSALLWVVTSAIVCGLLLGILYGLVGKVDFTVRHL  158



>gb|EMT25406.1| hypothetical protein F775_32767 [Aegilops tauschii]
Length=710

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  153  NYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTLPMKEL  332
            NYQHPDDANQA+FPK VVV G++VA +SILMLPADVANRQAC+ ++Y+GAC LTLPMK L
Sbjct  29   NYQHPDDANQAWFPKLVVVLGITVAVLSILMLPADVANRQACKRAVYSGACALTLPMKTL  88

Query  333  WLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLGILYGLV  512
            WL +YI++AVLVF +IPFAMF+YEGDQDKS+GKR+KS+L WV  +A+VC L+LGILY L+
Sbjct  89   WLVVYIIDAVLVFLVIPFAMFYYEGDQDKSVGKRLKSALIWVVASAVVCGLVLGILYALI  148

Query  513  GKVDFTVRHL  542
            GKVDFTVRHL
Sbjct  149  GKVDFTVRHL  158



>ref|XP_001773045.1| predicted protein [Physcomitrella patens]
 gb|EDQ62085.1| predicted protein [Physcomitrella patens]
Length=514

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGD+N+ LL++ IVV ++V   N+YLL+NYQHPDD NQA+FPK VV+ GLSVA +SILML
Sbjct  1    MGDYNVVLLLIVIVVTLMVLAFNLYLLINYQHPDDKNQAWFPKVVVIVGLSVAELSILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            PAD+ANR AC+HS+Y  ACN TLPM+ELW ++YIV+AVLVFF++PF++F+YE DQ+KS  
Sbjct  61   PADIANRHACKHSVYTDACNYTLPMRELWYSVYIVDAVLVFFVVPFSIFYYEADQEKSWL  120

Query  429  KRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            +R  S++ WV  TAI+  +L G+ + LVGKVDF V+ L
Sbjct  121  RRACSAISWVVATAIILGILFGVAFVLVGKVDFGVQRL  158



>gb|EMS64825.1| hypothetical protein TRIUR3_30387 [Triticum urartu]
Length=411

 Score =   196 bits (497),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  177  NQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTLPMKELWLAIYIVN  356
             +AYFPK VVV G++VA +SILMLPADVANRQAC+ ++Y+GAC LTLPMK LWL +YI++
Sbjct  11   REAYFPKLVVVLGITVAVLSILMLPADVANRQACKRAVYSGACALTLPMKTLWLVVYIID  70

Query  357  AVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVR  536
            AVLVF +IPFAMF+YEGD+DKS+GKR+KS+L WV  +A+VC L+LGILY L+GKVDFTVR
Sbjct  71   AVLVFLVIPFAMFYYEGDRDKSVGKRLKSALIWVVASAVVCGLILGILYALIGKVDFTVR  130

Query  537  HL  542
            HL
Sbjct  131  HL  132



>ref|XP_007026707.1| LMBR1-like membrane protein isoform 3 [Theobroma cacao]
 gb|EOY07209.1| LMBR1-like membrane protein isoform 3 [Theobroma cacao]
Length=354

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +3

Query  243  MLPADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKS  422
            MLPADVANRQACR++IYNGAC LTLPMK+LWLA+YIV+AVLVFFIIPFAMF+YEGDQDKS
Sbjct  1    MLPADVANRQACRNAIYNGACKLTLPMKDLWLAVYIVDAVLVFFIIPFAMFYYEGDQDKS  60

Query  423  LGKRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            +GKRIKS+L WV  TAIVCALLLGILYGLVGKVDFTVRHL
Sbjct  61   VGKRIKSALLWVVTTAIVCALLLGILYGLVGKVDFTVRHL  100



>ref|XP_002973109.1| hypothetical protein SELMODRAFT_99001 [Selaginella moellendorffii]
 gb|EFJ25483.1| hypothetical protein SELMODRAFT_99001 [Selaginella moellendorffii]
Length=518

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            NIY+L+ YQHPDD+NQAY PK +VV GLS+A +SILMLPADVANR +C  ++Y GAC LT
Sbjct  22   NIYILIRYQHPDDSNQAYLPKIIVVIGLSIAQLSILMLPADVANRHSCEKNLYVGACKLT  81

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            LPMK+LW A+YI++ VLV+ +IPFA+FFYEGDQ+K++ +RIK++L WV +   V  LLLG
Sbjct  82   LPMKQLWWAVYIIDTVLVYLVIPFAIFFYEGDQEKTVTQRIKNALLWVVILLTVFCLLLG  141

Query  495  ILYGLVGKVDFTVRHL  542
            ILY ++G  DFTVR L
Sbjct  142  ILYAVIGYADFTVRRL  157



>ref|XP_008370146.1| PREDICTED: LIMR family protein At5g01460 [Malus domestica]
Length=109

 Score =   181 bits (460),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +3

Query  243  MLPADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKS  422
            MLPADVAN QACR +IYNGACN+TLPMK+LWLAIYI++AVLVFFIIPFAMF+YEGDQDKS
Sbjct  1    MLPADVANXQACRXAIYNGACNITLPMKDLWLAIYILDAVLVFFIIPFAMFYYEGDQDKS  60

Query  423  LGKRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            +GKRI S+L WV VTAIVCAL+LGILYGLVGKVDFT+RHL
Sbjct  61   VGKRIGSALLWVGVTAIVCALVLGILYGLVGKVDFTIRHL  100



>ref|XP_002976753.1| hypothetical protein SELMODRAFT_416712 [Selaginella moellendorffii]
 gb|EFJ22422.1| hypothetical protein SELMODRAFT_416712 [Selaginella moellendorffii]
Length=540

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            NIY+L+ YQHPDD+NQAY PK +VV GLS+A +SILMLPADVANR +C  ++Y GAC LT
Sbjct  22   NIYILIRYQHPDDSNQAYLPKIIVVIGLSIAQLSILMLPADVANRHSCEKNLYVGACKLT  81

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            LPMK+LW A+YI++ VLV+ +IPFA+FFYE DQ+K++ +RIK++L WV +   V  LLLG
Sbjct  82   LPMKQLWWAVYIIDTVLVYLVIPFAIFFYESDQEKTVTQRIKNALLWVVILLTVFCLLLG  141

Query  495  ILYGLVGKVDFTVRHL  542
            ILY ++G  DFTVR L
Sbjct  142  ILYAVIGYADFTVRRL  157



>ref|XP_006850689.1| hypothetical protein AMTR_s00034p00237580 [Amborella trichopoda]
 gb|ERN12270.1| hypothetical protein AMTR_s00034p00237580 [Amborella trichopoda]
Length=117

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            M DFNLAL+IVA VVCV+VF+ N+YLL+NYQHPDD NQAYFPKF+VV+GLSVA ISILML
Sbjct  1    MRDFNLALVIVAAVVCVLVFIFNVYLLINYQHPDDVNQAYFPKFIVVWGLSVAGISILML  60

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDK  419
            P DVANRQAC++SIYN ACNLT+PMK+LWL IY+V+ +L FF+IPFAMF+YEGDQDK
Sbjct  61   PTDVANRQACKNSIYNRACNLTIPMKDLWLTIYVVDVILEFFVIPFAMFYYEGDQDK  117



>gb|AFW75355.2| hypothetical protein ZEAMMB73_153382 [Zea mays]
Length=452

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  243  MLPADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKS  422
            MLPADVANRQACR ++YNGAC+LTLPM+ LWL +YIV+AVLVF +IPFAMF+YEGDQDKS
Sbjct  1    MLPADVANRQACRKAVYNGACSLTLPMRTLWLVVYIVDAVLVFLVIPFAMFYYEGDQDKS  60

Query  423  LGKRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            +GKR++++L WV  +A+VC L+LGILYGLVGKVDFTVRHL
Sbjct  61   VGKRLRTALIWVVASAVVCGLVLGILYGLVGKVDFTVRHL  100



>ref|XP_001755027.1| predicted protein [Physcomitrella patens]
 gb|EDQ79971.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            N Y L+NYQHPDD NQAY PK +V+FGLS+A ISILMLPADVANR AC++S+Y  ACN T
Sbjct  24   NTYFLINYQHPDDHNQAYLPKGIVIFGLSIAQISILMLPADVANRNACKNSVYLNACNYT  83

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            LPMK+LW A+YI++A+ +FFI PF+ F+YE D+     KR+ +S  WV V A+V  L++G
Sbjct  84   LPMKDLWYAVYIIDAIFLFFICPFSFFYYEADEQTHTRKRLLNSFLWVLVLAVVLGLVVG  143

Query  495  ILYGLVGKVDFTVRHL  542
            I Y LVG  DFTVR L
Sbjct  144  ICYALVGYSDFTVRRL  159



>ref|XP_002994496.1| hypothetical protein SELMODRAFT_138681, partial [Selaginella 
moellendorffii]
 gb|EFJ04438.1| hypothetical protein SELMODRAFT_138681, partial [Selaginella 
moellendorffii]
Length=378

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 95/122 (78%), Gaps = 3/122 (2%)
 Frame = +3

Query  177  NQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTLPMKELWLAIYIVN  356
            NQAY PK +VV GLS+A +SILMLPADVANR +C  ++Y GAC LTLPMK+LW A+YI++
Sbjct  1    NQAYLPKIIVVIGLSIAQLSILMLPADVANRHSCEKNLYVGACKLTLPMKQLWWAVYIID  60

Query  357  AVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVR  536
             VLV   I FA+FFYE DQ+K++ +R+K++L WV +   V  LLLGILY ++G  +FTVR
Sbjct  61   TVLV---ILFAIFFYESDQEKTVTQRVKNALLWVVILLTVFCLLLGILYAVIGYANFTVR  117

Query  537  HL  542
            HL
Sbjct  118  HL  119



>gb|KIZ02019.1| hypothetical protein MNEG_5943 [Monoraphidium neglectum]
Length=289

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTL  317
            IY+L++YQHPDD NQA+ PK +VV GL +A  ++L+ P DVANR AC   +   AC  TL
Sbjct  27   IYVLIHYQHPDDGNQAWIPKGIVVLGLWLAMATVLLFPLDVANRAACSFGVAESACVFTL  86

Query  318  PMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLGI  497
            PM+ELW AI+I N V+VFF+IPF MFF+E D D +   R+K++  W    A+V  L +G+
Sbjct  87   PMRELWFAIFITNLVMVFFLIPFTMFFWEADSDYTWFMRVKTAFLWTLGMAVVLGLAIGV  146

Query  498  LYGLVGKVDFTVRHL  542
             YGL G V++  + L
Sbjct  147  AYGLAGFVEYPTQEL  161



>gb|KHN35580.1| LIMR family protein [Glycine soja]
Length=508

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 116/168 (69%), Gaps = 20/168 (12%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVAIVVCVIVFL N+YLLVN+QHPDD NQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAIVVCVIVFLFNVYLLVNFQHPDDVNQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACR----------HSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFF  398
            PADVANRQAC            S  +G  N+         A +      +  +       
Sbjct  61   PADVANRQACTLVRVVLDPVPLSKVSGRKNMIEKGDHTKGARFSDRDAKLMIL-------  113

Query  399  YEGDQDKSLGKRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
                 +KS+GKRIKS+L W+  TAIVCAL+LGILYGL+GKVDFTVRHL
Sbjct  114  ---RTNKSVGKRIKSALLWMVTTAIVCALVLGILYGLIGKVDFTVRHL  158



>ref|XP_002505039.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66297.1| predicted protein [Micromonas sp. RCC299]
Length=491

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            N+Y+LV++QHP+D NQA+FPK VV+ GL++A +SIL+LP DVANR AC  SI   ACN  
Sbjct  25   NVYILVHFQHPEDRNQAWFPKLVVILGLTLAEMSILLLPLDVANRAACADSIVLSACNFA  84

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            LPM++LW A+Y+   V++  ++PF +F+YE D D S   +  SS  W+  T +V AL+LG
Sbjct  85   LPMEQLWYAVYMSMFVMMVAVVPFTLFYYEQDHDMSAWGKTVSSGWWIGGTLVVLALILG  144

Query  495  ILYGLVGKVDF  527
            + YG +G VDF
Sbjct  145  LCYGFLGFVDF  155



>ref|XP_005651518.1| hypothetical protein COCSUDRAFT_12091 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26974.1| hypothetical protein COCSUDRAFT_12091 [Coccomyxa subellipsoidea 
C-169]
Length=516

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTL  317
            +YLLV+Y HP+D NQA+FPK VV+ G+++A  ++L+ P D ANR+AC   +    C LT+
Sbjct  24   LYLLVHYMHPEDKNQAWFPKIVVIVGITLAIWTVLLFPLDAANRKACSPDVPVSYCTLTI  83

Query  318  PMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLGI  497
            P ++LWLA +I NAVL F +IPFAMF+YE D + + G+R   +L W A T +   L+LGI
Sbjct  84   PTRQLWLACFIANAVLTFIVIPFAMFYYEADSESTAGQRWMHALLWEAATVVTFGLILGI  143

Query  498  LYGLVGKVDFTVRHL  542
             Y LVG V++ V  L
Sbjct  144  CYALVGFVEYPVAPL  158



>ref|XP_004506743.1| PREDICTED: LIMR family protein At3g08930-like [Cicer arietinum]
Length=185

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 85/106 (80%), Gaps = 9/106 (8%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNL L+IVAIV        N+YLLVNYQHPDD  Q YFPKFVVV GLSV    ILML
Sbjct  1    MGDFNLPLVIVAIVFLF-----NVYLLVNYQHPDDVKQTYFPKFVVVLGLSV----ILML  51

Query  249  PADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPF  386
            PADVANR+ACRH+ Y+G C LTLP K+LWLAIYIV+A+LVF++IP+
Sbjct  52   PADVANRRACRHAFYDGVCKLTLPFKDLWLAIYIVDAILVFYVIPY  97



>gb|EMS68850.1| hypothetical protein TRIUR3_08571 [Triticum urartu]
Length=114

 Score =   130 bits (328),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  183  AYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAV  362
            AYFPK VVV G++VA +SILMLPADVANRQAC+ + YNGAC L LPMK LWL +YI++AV
Sbjct  18   AYFPKLVVVLGITVAVLSILMLPADVANRQACKSAAYNGACALILPMKTLWLVVYILDAV  77

Query  363  LVFFIIPFAMFFYEGDQDKS  422
            LVF +IPFAMF+YEG QDKS
Sbjct  78   LVFLVIPFAMFYYEGGQDKS  97



>ref|XP_007514490.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14730.1| predicted protein [Bathycoccus prasinos]
Length=567

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            N+Y+L+N+QHP+D NQA+FPK +V+ GL++A+ +IL+LP DVANR +C  S+   AC  T
Sbjct  20   NLYVLINFQHPEDRNQAWFPKIIVISGLTIASGAILLLPLDVANRASCDASVSLSACETT  79

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            LPM E+W +IYI+  V V  +IPF  F+YE D D +L +++ +SL WV ++AI  +L+L 
Sbjct  80   LPMDEIWYSIYIITLVYVAILIPFTTFWYESDFDATLSQKLYNSLFWVVMSAIFVSLVLF  139

Query  495  ILYGLVGKVDFTV  533
            + +   G  DF++
Sbjct  140  LCWYYTGYADFSI  152



>ref|XP_001689531.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09269.1| predicted protein [Chlamydomonas reinhardtii]
Length=548

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 106/171 (62%), Gaps = 4/171 (2%)
 Frame = +3

Query  30   NRGRNHISS*PEKMGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVV  209
            ++GR  +SS       FN  L++VA VV  +V    IYLLV YQHP+D NQA+ PK VVV
Sbjct  26   HQGRELLSS----ATGFNWFLILVAAVVSALVLAGCIYLLVEYQHPEDRNQAWVPKIVVV  81

Query  210  FGLSVAAISILMLPADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFA  389
              +++A  ++L+ P DVAN +AC  SI   AC  TLPM +LW A +I N VLVF IIPF 
Sbjct  82   ISMTLAIWTVLLFPLDVANTRACAQSISPSACTYTLPMHQLWYACFISNLVLVFLIIPFT  141

Query  390  MFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            +FFYE D D +  +++K SL W     +   L++ I+Y L+G V +  + L
Sbjct  142  LFFYESDSDYTFCQKVKGSLMWTMGFLVFIVLIIVIMYLLIGYVVYPTQQL  192



>ref|XP_001420900.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99193.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=531

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            N+Y+LV++QHPDD NQA+FPK VVV GL+++ +SIL+LP DVANR AC  +I   AC  T
Sbjct  27   NVYVLVHFQHPDDRNQAWFPKIVVVTGLTLSVLSILLLPLDVANRAACDEAIIESACRYT  86

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            LPM++ W A Y+     +F ++P+ +F+YE D + +LGK++ SS  W   T  V  + + 
Sbjct  87   LPMEDFWYATYLTMFAYMFVLVPWTLFYYEQDSEATLGKKLVSSSIWSVATLFVLLMAML  146

Query  495  ILYGLVGKVDFTVRHL  542
            + Y + G+ +F ++ +
Sbjct  147  LAYYVGGEAEFELKSV  162



>emb|CEG00030.1| LMBR1-like membrane protein [Ostreococcus tauri]
Length=527

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 89/136 (65%), Gaps = 0/136 (0%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            N+Y+LV++QHPDD NQA+FPK VV+ GL++A +SIL+LP DVANR AC  SI   AC  T
Sbjct  25   NVYVLVHFQHPDDRNQAWFPKVVVITGLTIAVLSILLLPLDVANRAACDGSIIESACRYT  84

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            LPM+ LW A +    + +F +IP+A+F+YE D D    K++ S+  W     +V  + + 
Sbjct  85   LPMEALWYATFTTMIIYIFAVIPWALFYYEQDSDAPQLKKVVSATMWTISMGLVLIMAML  144

Query  495  ILYGLVGKVDFTVRHL  542
            I Y   G+ +F ++ +
Sbjct  145  IAYYFGGEAEFQLKSV  160



>ref|XP_003082521.1| LMBR1 integral membrane family protein-like (ISS) [Ostreococcus 
tauri]
Length=550

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 89/136 (65%), Gaps = 0/136 (0%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            N+Y+LV++QHPDD NQA+FPK VV+ GL++A +SIL+LP DVANR AC  SI   AC  T
Sbjct  48   NVYVLVHFQHPDDRNQAWFPKVVVITGLTIAVLSILLLPLDVANRAACDGSIIESACRYT  107

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            LPM+ LW A +    + +F +IP+A+F+YE D D    K++ S+  W     +V  + + 
Sbjct  108  LPMEALWYATFTTMIIYIFAVIPWALFYYEQDSDAPQLKKVVSATMWTISMGLVLIMAML  167

Query  495  ILYGLVGKVDFTVRHL  542
            I Y   G+ +F ++ +
Sbjct  168  IAYYFGGEAEFQLKSV  183



>ref|XP_003060576.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55345.1| predicted protein [Micromonas pusilla CCMP1545]
Length=518

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 89/136 (65%), Gaps = 0/136 (0%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            N+Y+LV++QHP+D NQ+YFPK VVV GLS+A  SIL+LP DVAN  +C  ++    C+  
Sbjct  22   NLYVLVHFQHPNDRNQSYFPKLVVVLGLSLATWSILLLPLDVANNASCSDAVIRSECDFA  81

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            LPM+ELW A+Y+   ++V  ++P+  FFYE +++ +   + KS+  WV       A++LG
Sbjct  82   LPMEELWYAVYMSMFLMVVVVVPWTFFFYEQEEEDTTRTKAKSASLWVTGVVAGLAIILG  141

Query  495  ILYGLVGKVDFTVRHL  542
            + Y  +G V+  V  L
Sbjct  142  LCYAYLGFVELPVTSL  157



>ref|XP_005850504.1| hypothetical protein CHLNCDRAFT_140333 [Chlorella variabilis]
 gb|EFN58402.1| hypothetical protein CHLNCDRAFT_140333 [Chlorella variabilis]
Length=524

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 83/128 (65%), Gaps = 1/128 (1%)
 Frame = +3

Query  153  NYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTLPMKEL  332
            ++QHP+D NQA+ PK VV+ G SVA  +IL+ P DVAN+QAC   I   +C+ T+PMKEL
Sbjct  26   HFQHPEDKNQAWLPKLVVLLGFSVAFWTILLFPLDVANQQACELDIPLSSCS-TMPMKEL  84

Query  333  WLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLGILYGLV  512
            W A+YI N  + F  +PF +F+YE D D S+ +R  S   W A T  V A+L+GI Y   
Sbjct  85   WYAMYIANMAITFIAVPFCIFYYEADSDWSVFRRSLSGALWAAGTVFVMAILIGIPYAFA  144

Query  513  GKVDFTVR  536
            G   +TV+
Sbjct  145  GNAQYTVQ  152



>ref|XP_002956676.1| hypothetical protein VOLCADRAFT_67279 [Volvox carteri f. nagariensis]
 gb|EFJ42278.1| hypothetical protein VOLCADRAFT_67279 [Volvox carteri f. nagariensis]
Length=522

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTL  317
            IY+LV YQHP+D NQA+ PK +VV  +++A  ++LM P DV N  AC  +I   AC  TL
Sbjct  33   IYILVEYQHPEDRNQAWVPKIIVVLSMALAIWTVLMFPLDVGNTNACASNISPSACTYTL  92

Query  318  PMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVA  461
            PM +LW A++I N VLVF IIPF +FFYE D D +  +++K SL W A
Sbjct  93   PMTQLWYAVFISNLVLVFLIIPFTLFFYEADSDYTFCQKVKGSLMWTA  140



>sp|D8TFA8.2|LMBD3_SELML RecName: Full=LIMR family protein SELMODRAFT_432208 [Selaginella 
moellendorffii]
Length=410

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = +3

Query  243  MLPADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKS  422
            MLPADVANR +C  ++Y GAC LTLPMK+LW A+YI++ VLV   IPFA+FFYE DQ+K+
Sbjct  1    MLPADVANRHSCEKNLYVGACKLTLPMKQLWWAVYIIDTVLV---IPFAIFFYESDQEKT  57

Query  423  LGKRIKSSLCWVAVTAIVCALLLGILYGLVGKVDFTVRHL  542
            + +R+K++L WV +   V  LLLGILY ++G  DFT+R L
Sbjct  58   VTQRVKNALLWVVILLTVFCLLLGILYAVIGYADFTMRSL  97



>ref|XP_011396246.1| LIMR family protein [Auxenochlorella protothecoides]
 gb|KFM23376.1| LIMR family protein [Auxenochlorella protothecoides]
Length=618

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 88/135 (65%), Gaps = 0/135 (0%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            ++YLL+ +QHP+D NQA+FPK VV  G+ +A  ++L+ P DVAN  AC   +    C+ T
Sbjct  21   SVYLLIAFQHPEDRNQAWFPKIVVCLGICLAIWTVLLFPLDVANVHACSADLPLADCSTT  80

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            LPM  LW AIY+   V+ F +IPFA+F+YEGD + S+G+RI S++ W   T I   L++ 
Sbjct  81   LPMDILWYAIYVAIVVMAFAVIPFALFYYEGDSEWSMGRRILSAVLWSIGTFICIVLIIV  140

Query  495  ILYGLVGKVDFTVRH  539
            I Y  +G V + V+ 
Sbjct  141  IPYVTIGYVKYPVQS  155



>gb|KHN07715.1| LIMR family protein [Glycine soja]
Length=437

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  69   MGDFNlallivaivvcvivfliNIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILML  248
            MGDFNLAL+IVA+VVCVIVFL+N+YLLVNYQHPDDANQAYFPKFVVV GLSVAAISILML
Sbjct  1    MGDFNLALVIVAVVVCVIVFLVNVYLLVNYQHPDDANQAYFPKFVVVLGLSVAAISILML  60

Query  249  PADVANRQACRHSIYNGACNLTL  317
            PADVANRQACRH+IYNGA + T+
Sbjct  61   PADVANRQACRHAIYNGAVDFTI  83



>gb|KDD72048.1| hypothetical protein H632_c3953p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=125

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +3

Query  141  YLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTLP  320
            Y+LV YQHP+D NQA+FPK VV+ G+ ++  ++L+ P DVAN   C        C  TLP
Sbjct  23   YMLVRYQHPEDYNQAWFPKVVVLLGMCLSIWTVLLFPLDVANVSECPIDQPLANCVTTLP  82

Query  321  MKELWLAIYIVNAVLVFFIIPFAMFFYEGDQD  416
            M+ LW A YI   VLVF ++PF++F+YEGD +
Sbjct  83   MESLWYACYIAIVVLVFAVVPFSIFYYEGDSE  114



>gb|EFA76425.1| LMBR1-like conserved region-containing protein [Polysphondylium 
pallidum PN500]
Length=527

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 77/127 (61%), Gaps = 11/127 (9%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            ++YL+V +QHPDD N AYFPK +V+ G+ +A+ISILMLP DVAN+         G     
Sbjct  21   SLYLIVYFQHPDDKNVAYFPKIIVILGIGLASISILMLPLDVANKGG------EGG----  70

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
             PM+ LW+ +YI  AV    I+PFAMFFYE D+    G +  S++    V   V   L G
Sbjct  71   FPMETLWIVVYIAIAVFAIVIVPFAMFFYESDEADG-GNQFVSAIKGTIVILFVFVALTG  129

Query  495  ILYGLVG  515
            IL+ L+G
Sbjct  130  ILWILIG  136



>dbj|GAM23900.1| hypothetical protein SAMD00019534_070750 [Acytostelium subglobosum 
LB1]
Length=492

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 77/130 (59%), Gaps = 10/130 (8%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            ++YL+V +QHPDD N AYFPK VV+ G ++AA+S+LMLP DVAN         NG     
Sbjct  4    SLYLIVYFQHPDDKNVAYFPKVVVILGFALAAVSVLMLPLDVANLTT------NGG----  53

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
             PM+ +W+ +YIV AV    I+PFAMFFYE ++    G +   ++        +   ++ 
Sbjct  54   FPMETMWIVVYIVIAVFAIVIVPFAMFFYESEEADGSGNQFTGAIKGTFAILFLFVAIVV  113

Query  495  ILYGLVGKVD  524
            IL+ L+G  D
Sbjct  114  ILWFLIGIAD  123



>ref|XP_003287659.1| hypothetical protein DICPUDRAFT_54958 [Dictyostelium purpureum]
 gb|EGC35822.1| hypothetical protein DICPUDRAFT_54958 [Dictyostelium purpureum]
Length=509

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 72/128 (56%), Gaps = 11/128 (9%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
             +YL+V +QHPDD N AYFPK +V+ G+++AA+S+LMLP DVAN         NG     
Sbjct  21   GLYLIVYFQHPDDKNVAYFPKVIVILGITLAAVSVLMLPLDVAN---------NGGQG-G  70

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQ-DKSLGKRIKSSLCWVAVTAIVCALLL  491
             PM+ LW+ +YI+       I PFAMFFYE ++ D   G ++  +L        V   L 
Sbjct  71   FPMETLWIVVYIITGCFAIVICPFAMFFYESEEADPGSGSQLGGALKGTIAIMFVFVALT  130

Query  492  GILYGLVG  515
             +LY   G
Sbjct  131  ILLYVFFG  138



>ref|XP_629046.1| LMBR1-like conserved region-containing protein [Dictyostelium 
discoideum AX4]
 sp|Q54BI3.1|Y3610_DICDI RecName: Full=LIMR family protein DDB_G0293610 [Dictyostelium 
discoideum]
 gb|EAL60617.1| LMBR1-like conserved region-containing protein [Dictyostelium 
discoideum AX4]
Length=507

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 72/128 (56%), Gaps = 11/128 (9%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            ++YL+  +QHPDD N AYFPK +V+ G+++AA SILMLP DVAN+         G     
Sbjct  21   SLYLIAYFQHPDDKNVAYFPKIIVILGITLAATSILMLPLDVANQGG------KGG----  70

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQ-DKSLGKRIKSSLCWVAVTAIVCALLL  491
             PM  LW+ IYIV AV    I PFAMFFYE ++ D + G +I  +           A L 
Sbjct  71   FPMDILWIVIYIVVAVFAIVICPFAMFFYESEEADPAAGSQIAGAFKGTFAILFAFAALT  130

Query  492  GILYGLVG  515
             +LY   G
Sbjct  131  IVLYVFFG  138



>ref|XP_008621503.1| hypothetical protein SDRG_17049 [Saprolegnia diclina VS20]
 gb|EQC25073.1| hypothetical protein SDRG_17049 [Saprolegnia diclina VS20]
Length=549

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 5/97 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N+Y+LV +QHPDD N AYFPK +V+FGL +A   +L+LP DVAN      C    +NG+C
Sbjct  22   NVYILVYFQHPDDKNTAYFPKLLVIFGLLLAEACVLLLPLDVANNSTAIGCDAG-WNGSC  80

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQD  416
               L M+ LWL +++   V +  ++PFA+++YEGD D
Sbjct  81   G-NLDMEVLWLIVFMAIVVFLVLLLPFAIYYYEGDDD  116



>ref|XP_005840131.1| hypothetical protein GUITHDRAFT_100864 [Guillardia theta CCMP2712]
 gb|EKX53151.1| hypothetical protein GUITHDRAFT_100864 [Guillardia theta CCMP2712]
Length=410

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 71/125 (57%), Gaps = 3/125 (2%)
 Frame = +3

Query  159  QHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTLPMKELWL  338
            QHPDD N A+ PK +V+FGL +A   +L+LP D +  QAC     +  C  +  + + W 
Sbjct  2    QHPDDRNSAWLPKLIVLFGLFLACSVVLLLPFDASVSQACGT---DAQCPASAGLAQTWY  58

Query  339  AIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLGILYGLVGK  518
             + I+ A++ F  IP A F+YE D ++ +G RI +++CW  V   V   +L  +Y  VG 
Sbjct  59   TVLIMIAIMTFVFIPLAYFWYETDDEEPMGTRICTTVCWSTVNLFVFVSILLGMYFSVGY  118

Query  519  VDFTV  533
            V+  V
Sbjct  119  VELPV  123



>ref|XP_638976.2| LMBR1-like conserved region-containing protein [Dictyostelium 
discoideum AX4]
 sp|Q54QP7.2|Y3707_DICDI RecName: Full=LIMR family protein DDB_G0283707 [Dictyostelium 
discoideum]
 gb|EAL65620.2| LMBR1-like conserved region-containing protein [Dictyostelium 
discoideum AX4]
Length=507

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 64/106 (60%), Gaps = 11/106 (10%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            ++YL+  +QHPDD N AYFPK +V+ GL++AA SILMLP DVAN         +G     
Sbjct  21   SLYLIAYFQHPDDKNVAYFPKIIVILGLTLAATSILMLPLDVAN---------DGGSG-G  70

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQ-DKSLGKRIKSSL  449
             PM  LW+ IYI  AV    I PFAMFFYE ++ D   G +I  + 
Sbjct  71   FPMDILWIIIYIAVAVFAVVICPFAMFFYESEEADPGAGSQIAGAF  116



>ref|XP_004359754.1| LMBR1-like conserved region-containing protein [Dictyostelium 
fasciculatum]
 gb|EGG21903.1| LMBR1-like conserved region-containing protein [Dictyostelium 
fasciculatum]
Length=512

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 73/128 (57%), Gaps = 17/128 (13%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            ++YL+V +QHPDD N A+ PK +VV GL++AA+SILMLP DVAN+         G     
Sbjct  21   SLYLIVYFQHPDDKNVAWLPKIIVVAGLTLAAVSILMLPLDVANKGG------EGG----  70

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSS-------LCWVAVTAI  473
             PM  +WL IYI  A+    I+PFAMF+YE ++      +  S+       L   AV  +
Sbjct  71   FPMDTIWLVIYIAIAIFSVIIVPFAMFYYESEEADGTNNQFASAFKGTLFLLFAFAVITV  130

Query  474  VCALLLGI  497
            +  L +GI
Sbjct  131  LLWLFIGI  138



>gb|EWM27274.1| lmbr1-like conserved region-containing protein [Nannochloropsis 
gaditana]
Length=522

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 80/140 (57%), Gaps = 11/140 (8%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQA---CRHSIYNGAC  305
            N+Y+LV++ HPDD N+AYFPK +V+FGL +A   +L +P DVAN  +   C    +  +C
Sbjct  22   NVYMLVHWSHPDDKNEAYFPKALVIFGLLLAEACVLAVPLDVANNSSNIGCTQG-WVQSC  80

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLC----WVAVTAI  473
               L M   W  +Y++  VL   I+PFA+F+YE D   + GK    + C    + AV   
Sbjct  81   G-GLDMSLFWQIMYVLITVLCVAILPFAIFYYEDDDGLTEGK--GQAFCGAVKYTAVCLF  137

Query  474  VCALLLGILYGLVGKVDFTV  533
              AL++G+ Y  +G+V   V
Sbjct  138  ASALVVGLCYFFIGRVRLPV  157



>ref|XP_002289422.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED92959.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=529

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 19/145 (13%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
             +YL+V YQHPDD N AY PK VV+FG  ++  ++L+LP DVAN +      Y G     
Sbjct  21   GLYLVVKYQHPDDKNDAYVPKLVVLFGFVLSGATVLLLPLDVANNEG-----YAG-----  70

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQ-----DKSLGKRIKSSLC----WVAVT  467
            L M   W   Y +    +FF+IPF+MF+YE D        S+G +  S +C    +    
Sbjct  71   LNMALFWEIFYWLITAWIFFLIPFSMFYYEADDGMLMAGTSVGAKPNSRICEAVKYEMFV  130

Query  468  AIVCALLLGILYGLVGKVDFTVRHL  542
             ++  L+  + Y  +   D  VR +
Sbjct  131  VVIFGLIFSMTYLFMNSTDIPVREV  155



>gb|EJK48296.1| hypothetical protein THAOC_32924, partial [Thalassiosira oceanica]
Length=154

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 58/98 (59%), Gaps = 9/98 (9%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACR--HSIYNG  299
             +YL+V YQHPDD N AY PK VV+FG  ++  ++LMLP +VAN +    C    +   G
Sbjct  18   GVYLIVKYQHPDDKNDAYLPKLVVLFGFVLSGATVLMLPLNVANNEGYAGCDGFDTAICG  77

Query  300  ACNLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQ  413
              N+TL     W  IY +    VF +IPF++FFYE D 
Sbjct  78   GINMTL----FWTVIYWLIPAWVFLLIPFSIFFYEADD  111



>ref|XP_002976757.1| hypothetical protein SELMODRAFT_416719 [Selaginella moellendorffii]
 gb|EFJ22426.1| hypothetical protein SELMODRAFT_416719 [Selaginella moellendorffii]
Length=346

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +3

Query  321  MKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLGIL  500
            MK+LW A+YI++ VLV   IPFA+FFYE DQ+K++ +R+K++L WV +   V  LLLGIL
Sbjct  1    MKQLWWAVYIIDTVLV---IPFAIFFYESDQEKTVTQRVKNALLWVVILLTVFCLLLGIL  57

Query  501  YGLVGKVDFTVRHL  542
            Y ++G  DFT+R L
Sbjct  58   YAVIGYADFTMRSL  71



>gb|KDO27861.1| hypothetical protein SPRG_07134 [Saprolegnia parasitica CBS 223.65]
Length=550

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 72/127 (57%), Gaps = 8/127 (6%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N+Y+LV +QHPDD N AYFPK +V+ GL +A   IL+LP DVAN      C    +N  C
Sbjct  22   NVYILVYFQHPDDKNTAYFPKLLVIVGLLLAEACILLLPLDVANNSTAIGCDAG-WNSTC  80

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGD---QDKSLGKRIKSSLCWVAVTAIV  476
               L M+ LWL +++   V +  ++PFA+++YE D    D     R   +L     T IV
Sbjct  81   G-NLDMEVLWLIVFMAIVVFLVLLLPFAIYYYEADDGFDDAKAASRWLDALKMEVGTLIV  139

Query  477  CALLLGI  497
             A+++ I
Sbjct  140  VAIVIAI  146



>gb|KDO15964.1| hypothetical protein SPRG_18504, partial [Saprolegnia parasitica 
CBS 223.65]
Length=485

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 72/127 (57%), Gaps = 8/127 (6%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N+Y+LV +QHPDD N AYFPK +V+ GL +A   IL+LP DVAN      C    +N  C
Sbjct  22   NVYILVYFQHPDDKNTAYFPKLLVIVGLLLAEACILLLPLDVANNSTAIGCDAG-WNSTC  80

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGD---QDKSLGKRIKSSLCWVAVTAIV  476
               L M+ LWL +++   V +  ++PFA+++YE D    D     R   +L     T IV
Sbjct  81   G-NLDMEVLWLIVFMAIVVFLVLLLPFAIYYYEADDGFDDAKAASRWLDALKMEVGTLIV  139

Query  477  CALLLGI  497
             A+++ I
Sbjct  140  VAIVVAI  146



>ref|XP_009534763.1| hypothetical protein PHYSODRAFT_522442 [Phytophthora sojae]
 gb|EGZ09902.1| hypothetical protein PHYSODRAFT_522442 [Phytophthora sojae]
Length=525

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 79/141 (56%), Gaps = 7/141 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N+Y+LV +QH DD N AYFPK +VVFGL  A  ++L+LP DVAN      C    +N AC
Sbjct  22   NVYILVYFQHDDDKNTAYFPKALVVFGLFFAEATVLLLPLDVANNSTAIGCAEG-WNTAC  80

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGD--QDKSLGKRIKSSLCWVAVTAIVC  479
               + M  LWL +++   + +  ++PFA+++YE D  +D     +   ++     T +V 
Sbjct  81   G-NINMDLLWLMVFLSIVIFLVVLLPFAIYYYEADDGEDNPKKSQWGEAIKMEVGTVVVA  139

Query  480  ALLLGILYGLVGKVDFTVRHL  542
            A L+ +LY    + +  +R L
Sbjct  140  AALITVLYITSAESNVPMRAL  160



>gb|ETI42239.1| hypothetical protein F443_12595 [Phytophthora parasitica P1569]
 gb|ETK82253.1| hypothetical protein L915_12325 [Phytophthora parasitica]
 gb|ETL88886.1| hypothetical protein L917_12083 [Phytophthora parasitica]
 gb|ETO58510.1| hypothetical protein F444_23114 [Phytophthora parasitica P1976]
 gb|ETO70877.1| hypothetical protein F444_12696 [Phytophthora parasitica P1976]
Length=525

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 15/145 (10%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N+Y+LV +QH DD N AYFPK +V+FGL  A  ++L+LP DVAN      C    +N  C
Sbjct  22   NVYILVYFQHDDDKNTAYFPKALVIFGLFFAEATVLLLPLDVANNSTAIGCAEG-WNTVC  80

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGD------QDKSLGKRIKSSLCWVAVT  467
               + M  LWL +++   + +  ++PFA+F+YE D      +    G+ IK  L     T
Sbjct  81   G-NINMDLLWLMVFLSIIIFLVVLLPFAIFYYEADDGEDNPKKSQWGEAIKMELG----T  135

Query  468  AIVCALLLGILYGLVGKVDFTVRHL  542
              V A L+ +LY    K    +R L
Sbjct  136  VFVAAALITVLYLTCAKSSVPMRAL  160



>gb|ETM42134.1| hypothetical protein L914_12160 [Phytophthora parasitica]
Length=525

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 15/145 (10%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N+Y+LV +QH DD N AYFPK +V+FGL  A  ++L+LP DVAN      C    +N  C
Sbjct  22   NVYILVYFQHDDDKNTAYFPKALVIFGLFFAEATVLLLPLDVANNSTAIGCAEG-WNTVC  80

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGD------QDKSLGKRIKSSLCWVAVT  467
               + M  LWL +++   + +  ++PFA+F+YE D      +    G+ IK  L     T
Sbjct  81   G-NINMDLLWLMVFLSIIIFLVVLLPFAIFYYEADDGEDNPKKSQWGEAIKMELG----T  135

Query  468  AIVCALLLGILYGLVGKVDFTVRHL  542
              V A L+ +LY    K    +R L
Sbjct  136  VFVAAALITVLYLTCAKSSVPMRAL  160



>ref|XP_008908935.1| hypothetical protein PPTG_13236 [Phytophthora parasitica INRA-310]
 gb|ETN05871.1| hypothetical protein PPTG_13236 [Phytophthora parasitica INRA-310]
 gb|ETP11979.1| hypothetical protein F441_12560 [Phytophthora parasitica CJ01A1]
 gb|ETP40092.1| hypothetical protein F442_12512 [Phytophthora parasitica P10297]
Length=525

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 15/145 (10%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N+Y+LV +QH DD N AYFPK +V+FGL  A  ++L+LP DVAN      C    +N  C
Sbjct  22   NVYILVYFQHDDDKNTAYFPKALVIFGLFFAEATVLLLPLDVANNSTAIGCAEG-WNTVC  80

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGD------QDKSLGKRIKSSLCWVAVT  467
               + M  LWL +++   + +  ++PFA+F+YE D      +    G+ IK  L     T
Sbjct  81   G-NINMDLLWLMVFLSIIIFLVVLLPFAIFYYEADDGEDNPKKSQWGEAIKMELG----T  135

Query  468  AIVCALLLGILYGLVGKVDFTVRHL  542
              V A L+ +LY    K    +R L
Sbjct  136  VFVAAALITVLYLTCAKSSVPMRAL  160



>ref|XP_002998528.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY69881.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=525

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 76/141 (54%), Gaps = 7/141 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N+Y+LV +QH DD N AYFPK +V+FGL  A  ++L+LP DVAN      C    +N  C
Sbjct  22   NVYILVYFQHDDDKNTAYFPKALVIFGLFFAEATVLLLPLDVANNSTAIGCAEG-WNSVC  80

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGD--QDKSLGKRIKSSLCWVAVTAIVC  479
               + M  LWL +++   + +  ++PFA+F+YE D  +D S   +   ++     T  V 
Sbjct  81   G-NINMDLLWLMVFLSIVIFLVVLLPFAIFYYEADDGEDTSKKSQWGEAIKMELGTIFVA  139

Query  480  ALLLGILYGLVGKVDFTVRHL  542
              L+ +LY    K    +R L
Sbjct  140  VALITVLYFTSAKSSIPMRAL  160



>gb|ETL35650.1| hypothetical protein L916_12240 [Phytophthora parasitica]
Length=572

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 15/145 (10%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N+Y+LV +QH DD N AYFPK +V+FGL  A  ++L+LP DVAN      C    +N  C
Sbjct  69   NVYILVYFQHDDDKNTAYFPKALVIFGLFFAEATVLLLPLDVANNSTAIGCAEG-WNTVC  127

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGD------QDKSLGKRIKSSLCWVAVT  467
               + M  LWL +++   + +  ++PFA+F+YE D      +    G+ IK  L     T
Sbjct  128  G-NINMDLLWLMVFLSIIIFLVVLLPFAIFYYEADDGEDNPKKSQWGEAIKMELG----T  182

Query  468  AIVCALLLGILYGLVGKVDFTVRHL  542
              V A L+ +LY    K    +R L
Sbjct  183  VFVAAALITVLYLTCAKSSVPMRAL  207



>ref|XP_002184914.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43650.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=523

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 71/132 (54%), Gaps = 13/132 (10%)
 Frame = +3

Query  141  YLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTLP  320
            YLLV+YQHPDD N AY PK +V+ G  +A  ++LMLP DVAN +   ++ Y+      L 
Sbjct  23   YLLVHYQHPDDHNDAYVPKLIVLLGFVLAGATVLMLPLDVANNEG--YAGYDTGLCGGLN  80

Query  321  MKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG-----------KRIKSSLCWVAVT  467
            M+ +W  ++ +  + VF +IPFA F+YE D    +             RI  ++C+    
Sbjct  81   MELMWDIVFWMIPIWVFVLIPFATFYYEADDGMLMAGTAYAPNPVRQSRIGQAICYQLFV  140

Query  468  AIVCALLLGILY  503
             ++  ++  + Y
Sbjct  141  FVIIGVIFAVTY  152



>gb|AFA52586.1| hypothetical protein [Vaucheria litorea]
Length=525

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 77/144 (53%), Gaps = 10/144 (7%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQA---CRHSIYNGAC  305
            N Y++V +QHPDD N++Y+ KF+VV GL++A  ++L LP DVAN      C     +  C
Sbjct  13   NTYIMVLWQHPDDKNESYWAKFLVVMGLTLAEGTLLFLPLDVANNGGNVQCNQFWSSTFC  72

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSL------GKRIKSSLCWVAVT  467
              ++ M   W  ++ +  +  FF+IPF +FFYE D    L       K +  S  ++   
Sbjct  73   G-SIDMHLAWTVLFYLILIFTFFLIPFTIFFYEEDDTLELEGQYNFKKTLIISSKYMLAL  131

Query  468  AIVCALLLGILYGLVGKVDFTVRH  539
             I+ +L+L + Y  +GK +  V  
Sbjct  132  VIMVSLILALTYLFLGKSELPVDE  155



>ref|XP_009824354.1| hypothetical protein H257_02425 [Aphanomyces astaci]
 gb|ETV85882.1| hypothetical protein H257_02425 [Aphanomyces astaci]
Length=535

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 63/105 (60%), Gaps = 7/105 (7%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N Y+LV +QHPDD N AY PK +VV G  +A   +L+LP DVAN      C    +N AC
Sbjct  21   NFYILVYFQHPDDKNTAYMPKVLVVIGFLLAEACVLLLPLDVANNSTAIGCTAG-WNAAC  79

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQ--DKSLGKR  434
               L M+ LWL +++  AV +  ++P++++FYE D   D S  K+
Sbjct  80   G-NLDMETLWLIVFMSIAVFLVVLLPYSIYFYESDDGFDDSSAKK  123



>ref|XP_008864006.1| hypothetical protein H310_02320 [Aphanomyces invadans]
 gb|ETW07913.1| hypothetical protein H310_02320 [Aphanomyces invadans]
Length=534

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N Y+LV +QHPDD N AY PKF+VV G  +A   +L+LP DVAN      C    +N AC
Sbjct  21   NFYILVYFQHPDDKNTAYLPKFLVVIGFLLAEACVLLLPLDVANNSTAIGCSAG-WNPAC  79

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQ  413
               L M+ LWL +++  AV +  ++P+++++YE D 
Sbjct  80   G-NLDMETLWLIVFMSIAVFLVVLLPYSIYYYESDD  114



>ref|XP_001023371.1| LMBR1-like conserved region family protein [Tetrahymena thermophila]
Length=1402

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 12/123 (10%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN--QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACN  308
            N Y+L  Y H DD     A + K +V+ G+++    +LMLP D+AN Q           N
Sbjct  20   NFYILALYCHKDDKGWGAATYCKILVILGMTLCWAQVLMLPLDIANSQN----------N  69

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALL  488
                M   W  I ++    +  ++PFAMF YE D++K    R+ +S C+  + A+V  LL
Sbjct  70   AGFDMVTFWYVIMLIILATIVLLLPFAMFMYETDEEKPFMSRVCTSFCFTMIEAVVVTLL  129

Query  489  LGI  497
            L I
Sbjct  130  LVI  132



>ref|XP_006681112.1| hypothetical protein BATDEDRAFT_26994 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78374.1| hypothetical protein BATDEDRAFT_26994 [Batrachochytrium dendrobatidis 
JAM81]
Length=557

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 78/144 (54%), Gaps = 14/144 (10%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTL  317
            IY +V +Q P D   A+FPK +V+  LS+AA +I +LP DVAN+         GA    +
Sbjct  22   IYFVVYFQSPTDKWVAWFPKVIVILSLSLAAWNIFLLPLDVANQSGSV-----GASPGGI  76

Query  318  PMKELWLAIYIVNAVLVFFIIPFAMFFYEGD---QDKSLGKRIKS-----SLCWVAVT-A  470
            P++ L LA Y  + ++V  ++PF +F+YEG+    D+   KR  S     ++ W+  T A
Sbjct  77   PIQTLTLAFYATSIIIVLVVMPFTVFYYEGEDNKDDEDAPKRSASGQFGYAIKWIIPTLA  136

Query  471  IVCALLLGILYGLVGKVDFTVRHL  542
             +  ++  + +G +G    +  +L
Sbjct  137  FIAGIVAAMYWGGLGYAQISTTYL  160



>gb|EWS72349.1| LMBR1-like motif protein [Tetrahymena thermophila SB210]
Length=501

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 66/136 (49%), Gaps = 12/136 (9%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN--QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACN  308
            N Y+L  Y H DD     A + K +V+ G+++    +LMLP D+AN Q           N
Sbjct  20   NFYILALYCHKDDKGWGAATYCKILVILGMTLCWAQVLMLPLDIANSQN----------N  69

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALL  488
                M   W  I ++    +  ++PFAMF YE D++K    R+ +S C+  + A+V  LL
Sbjct  70   AGFDMVTFWYVIMLIILATIVLLLPFAMFMYETDEEKPFMSRVCTSFCFTMIEAVVVTLL  129

Query  489  LGILYGLVGKVDFTVR  536
            L I +      D  V+
Sbjct  130  LVISWIFFRYADIPVK  145



>ref|XP_001022216.1| LMBR1-like conserved region family protein [Tetrahymena thermophila]
Length=1865

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 40/119 (34%), Positives = 65/119 (55%), Gaps = 12/119 (10%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN--QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACN  308
            + YLLV Y HP+D     + F K VV+ G++++   +L+LP DV+N +           +
Sbjct  21   SFYLLVLYCHPEDRGWGTSLFCKIVVIAGMTLSWAQVLILPLDVSNSRN----------D  70

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCAL  485
              L M   W  IY+  A++V  IIPFA F YE D +K +  R+ +++C+     IV ++
Sbjct  71   AGLDMTTFWYIIYMCVAIMVSIIIPFASFMYETDDEKPIVSRVFTAICYEICLFIVISI  129



>emb|CCA16794.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=524

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 75/129 (58%), Gaps = 8/129 (6%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N+Y+LV +QH DD N AYFPK +VVFGL +   +IL+LP DVAN      C+   +N  C
Sbjct  22   NLYILVYFQHIDDKNTAYFPKLLVVFGLLLGEATILLLPLDVANNTTALGCQEG-WNKEC  80

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYE---GDQDKSLGKRIKSSLCWVAVTAIV  476
               L M+ LWL +++    ++  ++PF++++YE   GD   +  +R   +L    +T + 
Sbjct  81   G-NLDMELLWLIVFLSIIFIIVVLLPFSIYYYESDDGDDSTTGARRFLEALKMEILTLLF  139

Query  477  CALLLGILY  503
               LL IL+
Sbjct  140  TIALLVILF  148



>ref|XP_009311191.1| LMBR1-like conserved region-containing protein [Trypanosoma grayi]
 gb|KEG10573.1| LMBR1-like conserved region-containing protein [Trypanosoma grayi]
Length=469

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 62/98 (63%), Gaps = 10/98 (10%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYN--GACNL  311
            +YL+V +Q  +D N+A+FPK VVV   S+A  ++L+LP DVAN    R  +YN  G  N+
Sbjct  21   LYLVVLFQAEEDKNEAWFPKVVVVLSFSMACYNVLVLPYDVAN---VREGLYNPGGEINV  77

Query  312  TLPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDKS  422
            T+    +W+ I ++  VL F + PFAM +YE  D D++
Sbjct  78   TV----MWIVILVMMFVLCFIMCPFAMAYYESMDPDQT  111



>ref|XP_002675706.1| predicted protein [Naegleria gruberi]
 gb|EFC42962.1| predicted protein [Naegleria gruberi]
Length=501

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 65/132 (49%), Gaps = 9/132 (7%)
 Frame = +3

Query  147  LVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTLPMK  326
            L  +   DD  +A+ PK VV+F  ++A  S+ +LP DVAN +           +LT   +
Sbjct  29   LCYFMSSDDRGKAWCPKLVVIFAFALAVCSVFLLPLDVANARL--------EGDLTYAFQ  80

Query  327  ELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDKSLGKRIKSSLCWVAVTAIVCALLLGILY  503
              W   Y   AV V  I+PF +F+YE  D +KS   +IK  +C   VT IV A L  + Y
Sbjct  81   ITWQVFYGFVAVFVVLILPFFIFYYESEDPEKSFLHQIKWGICATVVTFIVVATLTLVSY  140

Query  504  GLVGKVDFTVRH  539
              +G  D   + 
Sbjct  141  WFLGYADIPFKQ  152



>ref|XP_002994279.1| hypothetical protein SELMODRAFT_432210 [Selaginella moellendorffii]
 sp|D8TFB0.1|LMBD1_SELML RecName: Full=LIMR family protein SELMODRAFT_432210 [Selaginella 
moellendorffii]
 gb|EFJ04658.1| hypothetical protein SELMODRAFT_432210 [Selaginella moellendorffii]
Length=321

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  243  MLPADVANRQACRHSIYNGACNLTLPMKELWLAIYIVNAVLVFFIIPF  386
            MLPAD  NR +C  ++Y G C LTLPMK+LW  +YI++ VLV+ +IPF
Sbjct  1    MLPADAVNRHSCEKNLYVGVCKLTLPMKQLWWVVYIIDTVLVYLVIPF  48



>ref|XP_001434867.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK67470.1| unnamed protein product [Paramecium tetraurelia]
Length=504

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 66/135 (49%), Gaps = 11/135 (8%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN--QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACN  308
            N YLLV Y HPDD+    +   K  V+ G+++    +LMLP D AN +            
Sbjct  20   NFYLLVLYCHPDDSGWGSSLVCKVFVIIGMTLTWAQVLMLPLDAANSRGLGEG-------  72

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALL  488
              L M   W  IY++  +     IPFA ++YE D +KS+G+R  ++L       I+ ALL
Sbjct  73   --LDMDFFWKFIYMLILIFGTLFIPFAQYYYESDDEKSVGQRCCAALYQQLCFVIIVALL  130

Query  489  LGILYGLVGKVDFTV  533
            L I Y  +   D  V
Sbjct  131  LFISYAFLRFADIPV  145



>emb|CCI42339.1| unnamed protein product [Albugo candida]
Length=524

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 5/96 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQ---ACRHSIYNGAC  305
            N+Y+LV +QH DD N AYFPK +VVFGL +   +IL+LP DVAN      C+   +N  C
Sbjct  22   NLYILVYFQHADDKNTAYFPKLLVVFGLLLGEATILLLPLDVANNTTALGCQEG-WNKEC  80

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQ  413
               L M+ LWL +++    ++  ++PF++++YE D 
Sbjct  81   G-NLDMELLWLIVFLSIIFIIVVLLPFSIYYYESDD  115



>gb|EPZ34343.1| LMBR1-like membrane protein domain-containing protein [Rozella 
allomycis CSF55]
Length=493

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTL  317
            IY LV +QHP+D   A+ PK VVV+G+ VA  ++L+LP DVAN+     S  +G     L
Sbjct  21   IYFLVYFQHPEDKWVAWLPKLVVVYGVFVACCNVLLLPLDVANQNLGYLS--SGG----L  74

Query  318  PMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQD  416
            PM+ L    ++   VL   +IPF +F+YEG  +
Sbjct  75   PMETLNYIFFMSTVVLCICVIPFTVFYYEGADN  107



>gb|EJK53353.1| hypothetical protein THAOC_27231, partial [Thalassiosira oceanica]
Length=69

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQA  275
             +YL+V YQHPDD N AY PK VV+FG  ++  ++LMLP DVAN + 
Sbjct  21   GVYLIVKYQHPDDKNDAYLPKLVVLFGFVLSGATVLMLPLDVANNEG  67



>gb|EAR82938.2| LMBR1-like motif protein [Tetrahymena thermophila SB210]
Length=609

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 67/125 (54%), Gaps = 17/125 (14%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN---QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGAC  305
            NIY+L  Y HP+D      AY  K +VV G +++   +LM+P DV+N +      Y G  
Sbjct  20   NIYILGVYCHPEDKGFGANAY-CKLIVVVGFTLSWGQVLMVPLDVSNSRG-----YGGGF  73

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCAL  485
            +    M  +W  IYI+  V + FIIP A F+YE D +KS+ +R+  ++        V  L
Sbjct  74   D----MMTVWYVIYIIVLVFISFIIPTAQFYYESDDEKSMCERLTQTIA----MEFVMIL  125

Query  486  LLGIL  500
            L+G+ 
Sbjct  126  LMGVF  130



>gb|EWS72757.1| LMBR1-like motif protein [Tetrahymena thermophila SB210]
Length=503

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 62/109 (57%), Gaps = 12/109 (11%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN--QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACN  308
            + YLLV Y HP+D     + F K VV+ G++++   +L+LP DV+N +       N A  
Sbjct  21   SFYLLVLYCHPEDRGWGTSLFCKIVVIAGMTLSWAQVLILPLDVSNSR-------NDA--  71

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCW  455
              L M   W  IY+  A++V  IIPFA F YE D +K +  R+ +++C+
Sbjct  72   -GLDMTTFWYIIYMCVAIMVSIIIPFASFMYETDDEKPIVSRVFTAICY  119



>gb|ESL06057.1| hypothetical protein TRSC58_06275 [Trypanosoma rangeli SC58]
Length=476

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 72/136 (53%), Gaps = 5/136 (4%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
             +Y+L  +   ++    Y  + VVV G+ +A   +L+LP DVAN  A   ++ N   N T
Sbjct  21   GVYVLFYFVSEEEDGGDYGARVVVVLGMVIAMGVVLLLPLDVAN--ATDPTVPNKYTN-T  77

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEG--DQDKSLGKRIKSSLCWVAVTAIVCALL  488
            L ++ +W  +  +  VL   ++PF +FFYE    +D  LG++I  +L +      V A++
Sbjct  78   LNVQLMWQIVLWIVLVLAIVVLPFVLFFYEAFDPEDNRLGRQIGHALLYSLTVFGVFAII  137

Query  489  LGILYGLVGKVDFTVR  536
             G+ YGLVG     VR
Sbjct  138  CGVCYGLVGVAQVPVR  153



>ref|XP_001454539.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK87142.1| unnamed protein product [Paramecium tetraurelia]
Length=508

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 12/107 (11%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN--QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACN  308
            NIYLL  Y HP+D       F K VVV GLS++    LML  DV N +  +         
Sbjct  20   NIYLLALYCHPEDGGFGSTLFCKIVVVLGLSLSWCQTLMLTLDVTNEREQQG--------  71

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSL  449
              L M   W+ IYI   V++  +IP A+F+YE D +K + +RI  ++
Sbjct  72   --LDMHLCWIIIYISVFVMLVLLIPLAIFYYESDDEKPICQRISLTI  116



>ref|XP_001683871.1| conserved hypothetical protein [Leishmania major strain Friedlin]
 emb|CAJ05177.1| conserved hypothetical protein [Leishmania major strain Friedlin]
Length=480

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 69/138 (50%), Gaps = 9/138 (7%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVAN--RQACRHSIYNGACN  308
             IY L+ +Q  +D+   Y PK V   GL +A  SIL++P DVAN       H        
Sbjct  21   TIYTLIYFQSEEDSKWDYVPKAVAGLGLILAMGSILLVPYDVANSPNPTVAHKYVQ----  76

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDK-SLGKRIKSSLCWVAVTAIVCA  482
             TL  + +W  +  + AV+   + PF MFFYE  D DK S+G ++   +    + A + A
Sbjct  77   -TLNTQLMWEIVLWMMAVMAVVVCPFFMFFYEAYDPDKPSVGTQVSHGVISTVIIAFLFA  135

Query  483  LLLGILYGLVGKVDFTVR  536
            L++G+ Y   G  D T +
Sbjct  136  LIVGLCYHFQGVADITFQ  153



>gb|EPY41028.1| LMBR1 domain-containing protein 1 [Angomonas deanei]
Length=268

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 7/129 (5%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANR-QACRHSIYNGACNLT  314
            +Y+L+ +Q+ DDA      K + V  + V   S+L+LP DVAN     + + YN   N  
Sbjct  22   VYILIFFQNKDDAKSDIGYKVIFVLAMVVGLGSVLLLPYDVANSPDPTQQTKYNQTLNTQ  81

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDK-SLGKRIKSSLCWVAVTAIVCALL  488
            L    +W  +  + A L   I PF MFFYE  D +K  +GK+I   +    +  ++ AL+
Sbjct  82   L----MWEVVLWMMAALAVVICPFLMFFYEAYDPEKPKIGKQIAHGIVSTLIIFVIFALV  137

Query  489  LGILYGLVG  515
             G+ Y  VG
Sbjct  138  TGLCYWKVG  146



>gb|ESS63933.1| hypothetical protein TCDM_08087 [Trypanosoma cruzi Dm28c]
Length=215

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 70/129 (54%), Gaps = 5/129 (4%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            ++YLL  +   +D  +AY  K +VV G+ ++   +L+LP DV+N  +   +I N   N T
Sbjct  21   SVYLLFYFTSEEDDGEAYGAKVIVVVGMVISMGVVLLLPLDVSN--SVDPTIPNKYIN-T  77

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDKS-LGKRIKSSLCWVAVTAIVCALL  488
            L M   W  ++ +   + F I+PF MF+YE  D D + +GK+I  +  +      + AL+
Sbjct  78   LNMTLAWQIVFWILFSMTFIIVPFVMFYYEAYDPDHNRIGKQILQAFIYTIGICGIFALI  137

Query  489  LGILYGLVG  515
             G+ Y  +G
Sbjct  138  CGLCYKFIG  146



>gb|EPY30284.1| LMBR1 domain-containing protein 1 [Angomonas deanei]
Length=333

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 7/129 (5%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANR-QACRHSIYNGACNLT  314
            +Y+L+ +Q+ DDA      K + V  + V   S+L+LP DVAN     + + YN   N  
Sbjct  22   VYILIFFQNKDDAKSDIGYKVIFVLAMVVGLGSVLLLPYDVANSPDPTQQTKYNQTLNTQ  81

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDK-SLGKRIKSSLCWVAVTAIVCALL  488
            L    +W  +  + A L   I PF MFFYE  D +K  +GK+I   +    +  ++ AL+
Sbjct  82   L----MWEVVLWMMAALAVVICPFLMFFYEAYDPEKPKIGKQIAHGIVSTLIIFVIFALV  137

Query  489  LGILYGLVG  515
             G+ Y  VG
Sbjct  138  TGLCYWKVG  146



>gb|EJY83178.1| hypothetical protein OXYTRI_19202 [Oxytricha trifallax]
Length=547

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 58/107 (54%), Gaps = 12/107 (11%)
 Frame = +3

Query  135  NIYLLVNYQHPDDA--NQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACN  308
            NIY L N  HP+D+   Q    + +VVFG +++ + ILM+P D+AN QA      +G  N
Sbjct  20   NIYFLANNAHPNDSPFGQNIIMRILVVFGFTLSYLPILMVPLDIANSQA------DGGIN  73

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSL  449
            + L    LW  I +     V+ + P  + +YE ++  +L K+ K ++
Sbjct  74   MEL----LWFIILVTQCSFVWGLFPICIVYYESNEQDNLRKKCKRAM  116



>ref|XP_003861450.1| hypothetical protein, conserved [Leishmania donovani]
 emb|CBZ34750.1| hypothetical protein, conserved [Leishmania donovani]
Length=480

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANR--QACRHSIYNGACN  308
             IY  + +Q  +D+   Y PK V   GL +A  SIL++P DVAN       H        
Sbjct  21   TIYTFIYFQSEEDSKWDYVPKAVAGLGLILAMGSILLVPYDVANSPDPTVAHKYVQ----  76

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDK-SLGKRIKSSLCWVAVTAIVCA  482
             TL  + +W  +  + AV+   + PF MFFYE  D DK S G ++   +    + A + A
Sbjct  77   -TLNTQLMWEIVLWMMAVMAVVVCPFFMFFYEAYDPDKPSFGTQVSHGVISTVIIAFLFA  135

Query  483  LLLGILYGLVGKVD  524
            L++G+ Y   G  D
Sbjct  136  LIVGLCYHFQGVAD  149



>ref|XP_001466149.1| conserved hypothetical protein [Leishmania infantum JPCM5]
 emb|CAM68588.1| conserved hypothetical protein [Leishmania infantum JPCM5]
Length=480

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANR--QACRHSIYNGACN  308
             IY  + +Q  +D+   Y PK V   GL +A  SIL++P DVAN       H        
Sbjct  21   TIYTFIYFQSEEDSKWDYVPKAVAGLGLILAMGSILLVPYDVANSPDPTVAHKYVQ----  76

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDK-SLGKRIKSSLCWVAVTAIVCA  482
             TL  + +W  +  + AV+   + PF MFFYE  D DK S G ++   +    + A + A
Sbjct  77   -TLNTQLMWEIVLWMMAVMAVVVCPFFMFFYEAYDPDKPSFGTQVSHGVISTVIIAFLFA  135

Query  483  LLLGILYGLVGKVD  524
            L++G+ Y   G  D
Sbjct  136  LIVGLCYHFQGVAD  149



>ref|XP_001030601.1| LMBR1-like conserved region family protein [Tetrahymena thermophila]
Length=582

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 56/101 (55%), Gaps = 13/101 (13%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN---QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGAC  305
            NIY+L  Y HP+D      AY  K +VV G +++   +LM+P DV+N +      Y G  
Sbjct  24   NIYILGVYCHPEDKGFGANAY-CKLIVVVGFTLSWGQVLMVPLDVSNSRG-----YGGGF  77

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLG  428
            +    M  +W  IYI+  V + FIIP A F+YE D +KS+ 
Sbjct  78   D----MMTVWYVIYIIVLVFISFIIPTAQFYYESDDEKSMA  114



>emb|CDW90192.1| UNKNOWN [Stylonychia lemnae]
Length=496

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 15/105 (14%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            NIY +  Y HP D++   F   VV F    A   IL+LP DV+N +       NG     
Sbjct  23   NIYFVAKYAHPADSS---FDFKVVAF--VCAECQILLLPLDVSNFR-------NGT---N  67

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSL  449
            + MK  W  IY+  A  +  I+PFA+FFYE D+DK+   R+ ++L
Sbjct  68   VDMKIFWYIIYMTAAFFIIIILPFALFFYESDEDKTFKLRLWTAL  112



>gb|EKG03049.1| hypothetical protein TCSYLVIO_005913 [Trypanosoma cruzi]
Length=476

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 70/129 (54%), Gaps = 5/129 (4%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            ++YLL  +   +D  +AY  K +VV G+ ++   +L+LP DV+N  +   +I N   N T
Sbjct  21   SVYLLFYFTSEEDDGEAYGAKVIVVVGMVISMGVVLLLPLDVSN--SVDPTIPNKYIN-T  77

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDKS-LGKRIKSSLCWVAVTAIVCALL  488
            L M   W  ++ +   + F I+PF MF+YE  D D + +GK+I  +  +      + AL+
Sbjct  78   LNMTLAWQIVFWILFSMTFIIVPFVMFYYEAYDPDHNRIGKQILQAFIYTIGICGIFALI  137

Query  489  LGILYGLVG  515
             G+ Y  +G
Sbjct  138  CGLCYKFIG  146



>ref|XP_004032364.1| lmbr1-like conserved region family protein, putative [Ichthyophthirius 
multifiliis]
 gb|EGR30777.1| lmbr1-like conserved region family protein, putative [Ichthyophthirius 
multifiliis]
Length=738

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 62/117 (53%), Gaps = 15/117 (13%)
 Frame = +3

Query  141  YLLVNYQHPDDAN--QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            YLL+ Y HPDD     + F K +V+ G +++   +L+LP DV+N +       NG     
Sbjct  257  YLLILYCHPDDRGWGTSLFCKIIVIIGCTLSWAQVLILPLDVSNSRG------NGN---D  307

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSL----CWVAVTAI  473
            L M+  W  IY++  ++V  +IPFA   YE D +K    R+ S+L    C+  V +I
Sbjct  308  LNMEVFWQIIYMIIGIMVSIVIPFAQLMYETDDEKPFLSRLLSALFMEICYFIVISI  364



>ref|XP_817833.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gb|EAN95982.1| hypothetical protein, conserved [Trypanosoma cruzi]
Length=476

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 69/129 (53%), Gaps = 5/129 (4%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            ++YLL  +   +D  +AY  K +VV G+ ++   +L+LP DVAN  A   +I N   N T
Sbjct  21   SVYLLFYFTSEEDDGEAYGAKVIVVIGMVISMGVVLLLPLDVAN--AVDPTISNKYKN-T  77

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDKS-LGKRIKSSLCWVAVTAIVCALL  488
            L M  +W  +  +   + F I+PF MFFYE  D D + + K+I  ++ +      +  ++
Sbjct  78   LNMTLMWQIVLWLLFCMTFIIVPFVMFFYEAYDPDNNRISKQIIQAIIYTIGILSIFFII  137

Query  489  LGILYGLVG  515
             GI Y  +G
Sbjct  138  CGICYTFIG  146



>ref|XP_001453733.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK86336.1| unnamed protein product [Paramecium tetraurelia]
Length=537

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 58/109 (53%), Gaps = 9/109 (8%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN--QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACN  308
            NIY+L  Y HP D+    + F K +VV G ++A   IL++ AD++  +    +   G   
Sbjct  50   NIYILALYCHPSDSGFGASLFCKILVVLGFTLAWGQILLVSADISASKGVFTT--EGES-  106

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCW  455
                M  +W  IY     +V F+IP A F+YE D+DK L KR+   +C+
Sbjct  107  ----MMIVWYVIYCTILGMVAFLIPCAQFYYESDEDKPLMKRLLEVMCY  151



>ref|XP_001456478.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK89081.1| unnamed protein product [Paramecium tetraurelia]
Length=507

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 58/109 (53%), Gaps = 9/109 (8%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN--QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACN  308
            NIY+L  Y HP D+    + F K +VV G ++A   IL++ AD++  +    +  +    
Sbjct  20   NIYILALYCHPSDSGFGASLFCKILVVLGFTLAWGQILLVSADISASKGVFTTEGDA---  76

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCW  455
                M  +W  IY     +V F+IP A F+YE D+DK L KR+   +C+
Sbjct  77   ----MMIVWYVIYCTILGMVAFLIPCAQFYYESDEDKPLMKRLLEVMCY  121



>ref|XP_002681314.1| hypothetical protein NAEGRDRAFT_77239 [Naegleria gruberi]
 gb|EFC48570.1| hypothetical protein NAEGRDRAFT_77239 [Naegleria gruberi]
Length=497

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 72/140 (51%), Gaps = 14/140 (10%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTL  317
            +  ++ +  P D  Q  FPK + VFG++ A   +L++P D  N +      Y G     L
Sbjct  32   VLFIIFFSSPADRFQGIFPKIICVFGMTFAGCILLIIPFDAWNTR------YKGGIGSAL  85

Query  318  PMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDKSLGKR--IKSSLCWVA---VTAIVC  479
             +  +W  ++ V  +LV  +IP+A+ +YE  D+DK+   +  ++  LC +    +T  +C
Sbjct  86   EI--IWQVLFGVVGLLVCLVIPWALIYYESYDEDKAGTPKGFLRQCLCGLIGSLITFGLC  143

Query  480  ALLLGILYGLVGKVDFTVRH  539
            AL++G+ Y  +G     V+ 
Sbjct  144  ALIIGVTYIWLGIARIDVKE  163



>ref|XP_001737470.1| hypothetical protein [Entamoeba dispar SAW760]
 gb|EDR26243.1| hypothetical protein EDI_227050 [Entamoeba dispar SAW760]
Length=192

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/135 (24%), Positives = 63/135 (47%), Gaps = 9/135 (7%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            NIY++V +Q+P++   ++  + +V+       +S+ ++P DV N          G     
Sbjct  21   NIYMMVYFQNPEEKGVSWIWRIIVIIAFEFLEMSVFLIPLDVLNA---------GPPEPI  71

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            +PM+  W  +Y         I+PF + +Y  ++D S  K+I  S  +  +  +V A+   
Sbjct  72   IPMQIFWYIVYYGMIAFAAIILPFGLCWYNQEEDTSYIKKIVYSFIFALIFLVVAAVFCV  131

Query  495  ILYGLVGKVDFTVRH  539
            I Y + G  +  V +
Sbjct  132  IFYIIFGVAEVPVNY  146



>ref|XP_804397.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gb|EAN82546.1| hypothetical protein, conserved [Trypanosoma cruzi]
Length=476

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (53%), Gaps = 5/129 (4%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            ++YLL  +   +D  +AY  K +VV G+ ++   +L+LP DV+N  +   +I N   N T
Sbjct  21   SVYLLFYFTSEEDDGEAYGAKVIVVLGMVISMGVVLLLPLDVSN--SVDPTIPNKYIN-T  77

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQD-KSLGKRIKSSLCWVAVTAIVCALL  488
            L M  +W  +  +   + F I+PF MF+YE  D D   + K+I  ++ +      +  ++
Sbjct  78   LNMTLMWQIVLWILFSMTFIIVPFVMFYYEAYDPDYNRIRKQIIQAILYTIGILSIFFII  137

Query  489  LGILYGLVG  515
             GI Y  +G
Sbjct  138  CGICYTFIG  146



>ref|XP_010699689.1| hypothetical protein LPMP_251190 [Leishmania panamensis]
 gb|AIN98982.1| hypothetical protein LPMP_251190 [Leishmania panamensis]
Length=480

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 66/137 (48%), Gaps = 7/137 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANR-QACRHSIYNGACNL  311
             +Y+++ +Q  +D+   Y PK V   GL +A  S+ ++P DVAN       + YN   N 
Sbjct  21   TVYIIIYFQSEEDSGWDYVPKAVAGLGLILALGSVFLVPFDVANSPDPTLVNKYNQTINT  80

Query  312  TLPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDK-SLGKRIKSSLCWVAVTAIVCAL  485
             L    +W  +  + A +   I PF MFFYE  D DK  +G +I        +   + AL
Sbjct  81   PL----MWKIVLWMMAAMAVVICPFFMFFYEAYDPDKPRIGTQIAHGFISTLIIVALFAL  136

Query  486  LLGILYGLVGKVDFTVR  536
            ++G+ Y   G  D T +
Sbjct  137  IVGLCYYYKGFADITFQ  153



>ref|XP_651078.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gb|EAL45688.2| hypothetical protein EHI_015360 [Entamoeba histolytica HM-1:IMSS]
 gb|EMD45842.1| LMBR1 family region protein, putative [Entamoeba histolytica 
KU27]
 gb|EMS12245.1| LMBR1 family region protein, putative [Entamoeba histolytica 
HM-3:IMSS]
Length=481

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/135 (24%), Positives = 64/135 (47%), Gaps = 9/135 (7%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            NIY+++ +Q+P++   ++  + +V+       +S+ ++P DV N          G     
Sbjct  21   NIYMMIYFQNPEEKGVSWIWRIIVIIAFEFLEMSVFLIPLDVLNA---------GPPEPI  71

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            +PM+  W  +Y    V    I+PF + +Y  ++D S  K+I  S  +  +  +V A+   
Sbjct  72   IPMQIFWYIVYYGMIVFAAIILPFGLCWYNQEEDTSCVKKIVYSFIFALIFLVVAAVFCV  131

Query  495  ILYGLVGKVDFTVRH  539
            I Y + G  +  V +
Sbjct  132  IFYIIFGVAEVPVNY  146



>ref|XP_004185620.1| hypothetical protein EIN_114180 [Entamoeba invadens IP1]
 gb|ELP86274.1| hypothetical protein EIN_114180 [Entamoeba invadens IP1]
Length=507

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 69/135 (51%), Gaps = 9/135 (7%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            N+Y++V +QHP++    +  + +++  L +  +S+ M+PADV N          G  +  
Sbjct  21   NLYIVVYFQHPEEKGMTWVWRILIILALELLELSVCMVPADVLNA---------GPPDGE  71

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            +PM+ +W  IY    V    I+PF + +Y  D+D +  K++  S+ +  +  +V A+   
Sbjct  72   IPMEIIWYVIYYTLIVFAAIILPFGLCWYNQDEDNTFCKKLILSIVFALIFLLVYAVFSV  131

Query  495  ILYGLVGKVDFTVRH  539
            I Y + G  +  V +
Sbjct  132  IFYIIFGVAEIEVNY  146



>gb|EKF30814.1| hypothetical protein MOQ_005363 [Trypanosoma cruzi marinkellei]
Length=476

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 68/129 (53%), Gaps = 5/129 (4%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            +IYLL  +   +D  +AY  K +VV G+ ++   +L+LP DVAN  A   +I N   N T
Sbjct  21   SIYLLFYFTSEEDDGEAYGAKCIVVIGMVMSMGIVLLLPLDVAN--AVDPTIPNQYMN-T  77

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDKS-LGKRIKSSLCWVAVTAIVCALL  488
            L    +W  +  +   + F I+PF MFFYE  D D + + K+I  ++ +      V  ++
Sbjct  78   LNTVLMWQIVLWLLFCMAFIIVPFVMFFYEAYDPDHNKISKQIIQAVIYTIAVCGVFLII  137

Query  489  LGILYGLVG  515
             G+ Y  +G
Sbjct  138  CGVCYTFIG  146



>ref|XP_001565618.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM39113.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Length=480

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 66/137 (48%), Gaps = 7/137 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANR-QACRHSIYNGACNL  311
             +Y+++ +Q  +D+   Y PK V   GL +A  S+ ++P DVAN       + YN   N 
Sbjct  21   TVYIIIYFQSEEDSGWDYVPKAVAGLGLILALGSVFLVPFDVANSPDPTLVNKYNQTINT  80

Query  312  TLPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDK-SLGKRIKSSLCWVAVTAIVCAL  485
             L    +W  +  + A +   I PF MFFYE  D DK  +G +I        +   + AL
Sbjct  81   PL----MWKIVLWMMAAMAVVICPFFMFFYEAYDPDKPRIGMQIAHGFISTLIIVALFAL  136

Query  486  LLGILYGLVGKVDFTVR  536
            ++G+ Y   G  D T +
Sbjct  137  IVGLCYYYKGFADITFQ  153



>emb|CDW87933.1| UNKNOWN [Stylonychia lemnae]
Length=477

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 52/99 (53%), Gaps = 12/99 (12%)
 Frame = +3

Query  135  NIYLLVNYQHPDDA--NQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACN  308
            NIY + +  HP+D+   Q    + +VVFG +++   ILM+P D++N Q+      NG  N
Sbjct  20   NIYFMAHNAHPNDSPFGQNIIMRILVVFGFTISYTPILMVPLDISNSQS------NGGLN  73

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSL  425
                M+ LW  I I+    V+ + P  + FYE ++   L
Sbjct  74   ----METLWGIILIIQVSCVWVLFPIFIVFYESNEQDQL  108



>ref|XP_001737702.1| hypothetical protein [Entamoeba dispar SAW760]
 gb|EDR25994.1| hypothetical protein, conserved [Entamoeba dispar SAW760]
Length=481

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/135 (24%), Positives = 63/135 (47%), Gaps = 9/135 (7%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLT  314
            NIY++V +Q+P++   ++  + +V+       +S+ ++P DV N          G     
Sbjct  21   NIYMMVYFQNPEEKGVSWIWRIIVIIAFEFLEMSVFLIPLDVLNA---------GPPEPI  71

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLG  494
            +PM+  W  +Y         I+PF + +Y  ++D S  K+I  S  +  +  +V A+   
Sbjct  72   IPMQIFWYIVYYGMIAFAAIILPFGLCWYNQEEDTSYIKKIVYSFIFALIFLVVAAVFCV  131

Query  495  ILYGLVGKVDFTVRH  539
            I Y + G  +  V +
Sbjct  132  IFYIIFGVAEVPVNY  146



>ref|XP_843733.1| hypothetical protein [Trypanosoma brucei brucei TREU927]
 gb|AAX69547.1| hypothetical protein, conserved [Trypanosoma brucei]
 gb|AAZ10174.1| hypothetical protein, conserved [Trypanosoma brucei brucei TREU927]
Length=478

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 7/116 (6%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVAN-RQACRHSIYNGACNLT  314
            IY+L  +   DD   +Y  K ++VFG+ +A   +L+LP D +N R     S Y    N  
Sbjct  22   IYVLYYFSSEDDHEGSYLTKVIIVFGILLAIGVVLLLPFDASNARDPTVGSKYVNTLNTD  81

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEG--DQDKSLGKRIKSSLCWVAVTAIV  476
            L    +W  +    AV+   ++PF +FFYE     D+S  K+   ++    + + V
Sbjct  82   L----MWEIVLWSLAVMALVVVPFTVFFYEAYDPDDESFSKQCGQAITLTLIVSFV  133



>emb|CCC46884.1| conserved hypothetical protein [Trypanosoma vivax Y486]
Length=475

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 63/137 (46%), Gaps = 7/137 (5%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVAN-RQACRHSIYNGACNLT  314
            +Y L  +   +D+  AYF K V+V G+      +L+LP D AN         Y G+ N  
Sbjct  22   VYALFYFISEEDSEGAYFTKIVIVLGILTPVGVVLLLPLDAANVHDPTVVKEYIGSLNTD  81

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEG--DQDKSLGKRIKSSLCWVAVTAIVCALL  488
            L    +W  +      L   ++P  +FFYE    ++ S+G++I  ++ + A+  +V  ++
Sbjct  82   L----MWEIVLWTLLGLALIVVPSLLFFYEAFDPEENSIGRQIGHAIAYTAIICVVYVII  137

Query  489  LGILYGLVGKVDFTVRH  539
                +  VG  D  +  
Sbjct  138  FAACFVNVGTADIPIEK  154



>ref|XP_001299832.1| LMBR1-like conserved region family protein [Trichomonas vaginalis 
G3]
 gb|EAX86902.1| LMBR1-like conserved region family protein [Trichomonas vaginalis 
G3]
Length=481

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 61/112 (54%), Gaps = 14/112 (13%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTL  317
            IYL+V +Q P+D   ++F K +++  + ++ +++L+LP D  NR            N TL
Sbjct  22   IYLVVRFQMPEDKKSSWFIKIIIILTIGISVMNVLILPLDALNRST------PNPMNTTL  75

Query  318  PMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAI  473
                 W+ + I++AVL F +IPF + +YE  +D+     +K  +C   ++ I
Sbjct  76   ---MCWI-LTIISAVLAFIVIPFTLTYYENAEDED----VKHPICKATLSVI  119



>ref|XP_003876171.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ27686.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]
Length=480

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 61/134 (46%), Gaps = 9/134 (7%)
 Frame = +3

Query  135  NIYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANR--QACRHSIYNGACN  308
             IY  + +Q  +D+     PK V   GL +A  SIL++P DVAN       H        
Sbjct  21   TIYTFIYFQSEEDSKWDCVPKAVAGVGLILAMGSILLVPYDVANSPDPTVAHKYAQ----  76

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEG-DQDK-SLGKRIKSSLCWVAVTAIVCA  482
             TL  + +W  +  + A +   + PF MFFYE  D DK S G ++   +    + A +  
Sbjct  77   -TLNTQLMWEIVLWMMAAMAVVVCPFFMFFYEAYDPDKPSFGTQVAHGVISTVIIAALFI  135

Query  483  LLLGILYGLVGKVD  524
            L++ + Y   G  D
Sbjct  136  LIVSLCYNFQGVAD  149



>ref|XP_001914219.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gb|EDS89003.1| hypothetical protein EHI_048960 [Entamoeba histolytica HM-1:IMSS]
Length=185

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 60/131 (46%), Gaps = 9/131 (7%)
 Frame = +3

Query  147  LVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTLPMK  326
            ++ +Q+P++   ++  + +V+       +S+ ++P DV N          G     +PM+
Sbjct  1    MIYFQNPEEKGVSWIWRIIVIIAFEFLEMSVFLIPLDVLNA---------GPPEPIIPMQ  51

Query  327  ELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRIKSSLCWVAVTAIVCALLLGILYG  506
              W  +Y    V    I+PF + +Y  ++D S  K+I  S  +  +  +V A+   I Y 
Sbjct  52   IFWYIVYYGMIVFAAIILPFGLCWYNQEEDTSCVKKIVYSFIFALIFLVVAAVFCVIFYI  111

Query  507  LVGKVDFTVRH  539
            + G  +  V +
Sbjct  112  IFGVAEVPVNY  122



>ref|XP_011131383.1| putative LMBR1-like protein [Gregarina niphandrodes]
 gb|EZG55995.1| putative LMBR1-like protein [Gregarina niphandrodes]
Length=549

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 50/101 (50%), Gaps = 12/101 (12%)
 Frame = +3

Query  135  NIYLLVNYQHPDDA--NQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACN  308
             ++ + +Y HPDD   NQ    + VV+FG  +A +S  ++  D  N +      + G  N
Sbjct  21   TLWFVYHYCHPDDLKYNQGILAQVVVIFGFQIAYLSFCLVATDAYNER------FEGQFN  74

Query  309  LTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGK  431
                M   W  +Y++  + +  ++P A+F+YE D D  + K
Sbjct  75   ----MSYCWKLVYLMIVIYLSIVLPLAVFYYEADSDPRITK  111



>emb|CBH09775.1| hypothetical protein, conserved [Trypanosoma brucei gambiense 
DAL972]
Length=478

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 7/116 (6%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVAN-RQACRHSIYNGACNLT  314
            IY+L  +   DD   +Y  K ++VFG+ +A   +L+LP D +N R     S Y    N  
Sbjct  22   IYVLYYFSSEDDHEGSYLTKVIIVFGILLAIGVVLLLPFDASNARDPTVGSKYVNTLNTD  81

Query  315  LPMKELWLAIYIVNAVLVFFIIPFAMFFYEG--DQDKSLGKRIKSSLCWVAVTAIV  476
            L    +W  +    A +   ++PF +FFYE     D+S  K+   ++    + + V
Sbjct  82   L----MWEIVLWSLAAMALVVVPFTVFFYEAYDPDDESFSKQCGQAITLTLIVSFV  133



>gb|EFA76389.1| hypothetical protein PPL_10154 [Polysphondylium pallidum PN500]
Length=1131

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 44/80 (55%), Gaps = 16/80 (20%)
 Frame = +3

Query  192  PKFVVVFGL------SVAAISILMLPADVANRQACRHSIYNGACNLTLPMKELWLAIYIV  353
            P  V+  GL      S+A  SILMLP DVAN+         G      PM  +WLAIYI+
Sbjct  663  PTCVIPIGLNICVRISLATTSILMLPLDVANKGG------TGG----FPMDTMWLAIYII  712

Query  354  NAVLVFFIIPFAMFFYEGDQ  413
             AV    I+PFA+FFYE D+
Sbjct  713  IAVFAIVIVPFAIFFYESDE  732



>gb|KFG61160.1| putative LMBR1 family region protein [Toxoplasma gondii RUB]
Length=656

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (48%), Gaps = 6/124 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN---QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGAC  305
            N+ LL  ++H  D++        K  ++ GL +A + IL +P D  N+ +       G  
Sbjct  20   NLKLLFYFEHSSDSSLTAPEVVCKVTILAGLQLAWLLILAVPLDAYNQHSPFVDKAAGVA  79

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRI--KSSLCWVAVTAIVC  479
               L M+  W  +    A+ + F +PFA F+YE D D  + +R   K +L    V A+ C
Sbjct  80   TAGLDMRLYWGVVAWFTALYLLFAVPFATFYYEADFDSRVSRRTPWKRALS-KTVLAVCC  138

Query  480  ALLL  491
            A L+
Sbjct  139  AGLV  142



>gb|KFH03574.1| putative LMBR1 family region protein [Toxoplasma gondii VAND]
Length=656

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (48%), Gaps = 6/124 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN---QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGAC  305
            N+ LL  ++H  D++        K  ++ GL +A + IL +P D  N+ +       G  
Sbjct  20   NLKLLFYFEHSSDSSLTAPEVVCKVTILAGLQLAWLLILAVPLDAYNQHSPFVDKAAGVA  79

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRI--KSSLCWVAVTAIVC  479
               L M+  W  +    A+ + F +PFA F+YE D D  + +R   K +L    V A+ C
Sbjct  80   TAGLDMRLYWGVVAWFTALYLLFAVPFATFYYEADFDSRVSRRTPWKRALS-KTVLAVCC  138

Query  480  ALLL  491
            A L+
Sbjct  139  AGLV  142



>gb|ESS30088.1| putative LMBR1 family region protein [Toxoplasma gondii VEG]
 gb|KFG36219.1| putative LMBR1 family region protein [Toxoplasma gondii p89]
 gb|KFG41618.1| putative LMBR1 family region protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=656

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (48%), Gaps = 6/124 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN---QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGAC  305
            N+ LL  ++H  D++        K  ++ GL +A + IL +P D  N+ +       G  
Sbjct  20   NLKLLFYFEHSSDSSLTAPEVVCKVTILAGLQLAWLLILAVPLDAYNQHSPFVDKAAGVA  79

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRI--KSSLCWVAVTAIVC  479
               L M+  W  +    A+ + F +PFA F+YE D D  + +R   K +L    V A+ C
Sbjct  80   TAGLDMRLYWGVVAWFTALYLLFAVPFATFYYEADFDSRVSRRTPWKRALS-KTVLAVCC  138

Query  480  ALLL  491
            A L+
Sbjct  139  AGLV  142



>gb|EPR58493.1| putative LMBR1 family region protein [Toxoplasma gondii GT1]
 gb|KFG47702.1| putative LMBR1 family region protein [Toxoplasma gondii FOU]
Length=656

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (48%), Gaps = 6/124 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN---QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGAC  305
            N+ LL  ++H  D++        K  ++ GL +A + IL +P D  N+ +       G  
Sbjct  20   NLKLLFYFEHSSDSSLTAPEVVCKVTILAGLQLAWLLILAVPLDAYNQHSPFVDKAAGVT  79

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRI--KSSLCWVAVTAIVC  479
               L M+  W  +    A+ + F +PFA F+YE D D  + +R   K +L    V A+ C
Sbjct  80   TAGLDMRLYWGVVAWFTALYLLFAVPFATFYYEADFDSRVSRRTPWKRALS-KTVLAVCC  138

Query  480  ALLL  491
            A L+
Sbjct  139  AGLV  142



>gb|EPT32058.1| LMBR1 family region protein, putative [Toxoplasma gondii ME49]
Length=656

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (48%), Gaps = 6/124 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN---QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGAC  305
            N+ LL  ++H  D++        K  ++ GL +A + IL +P D  N+ +       G  
Sbjct  20   NLKLLFYFEHSSDSSLTAPEVVCKVTILAGLQLAWLLILAVPLDAYNQHSPFVDKAAGVA  79

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRI--KSSLCWVAVTAIVC  479
               L M+  W  +    A+ + F +PFA F+YE D D  + +R   K +L    V A+ C
Sbjct  80   TAGLDMRLYWGVVAWFTALYLLFAVPFATFYYEADFDSRVSRRTPWKRALS-KTVLAVCC  138

Query  480  ALLL  491
            A L+
Sbjct  139  AGLV  142



>emb|CCC89640.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=476

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 64/129 (50%), Gaps = 12/129 (9%)
 Frame = +3

Query  138  IYLLVNYQHPDDANQAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGACNLTL  317
            IY L  +   +D+   YF K +V+ G+ +A   +L+LP D +N  A   +++N   N TL
Sbjct  22   IYTLFYFISEEDSEGGYFTKGLVILGMLLAMGVVLLLPLDASN--ARDPTVWNRYIN-TL  78

Query  318  PMKELWLAIYIVNAVLVFFIIPFAMFFYEG--DQDKSLGKRIKSS-------LCWVAVTA  470
                +W  +     ++   + PFA+FFY+    +++SL K+  S+       L    +T 
Sbjct  79   NTDLMWEIVLWSLCIIALAVAPFAVFFYQAYDPENESLSKQFASASVMTTVLLFAFGITT  138

Query  471  IVCALLLGI  497
             VC L  G+
Sbjct  139  AVCFLTAGV  147



>gb|KFH14581.1| putative LMBR1 family region protein [Toxoplasma gondii MAS]
Length=656

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (48%), Gaps = 6/124 (5%)
 Frame = +3

Query  135  NIYLLVNYQHPDDAN---QAYFPKFVVVFGLSVAAISILMLPADVANRQACRHSIYNGAC  305
            N+ LL  ++H  D++        K  ++ GL +A + IL +P D  N+ +       G  
Sbjct  20   NLKLLFYFEHSSDSSLTAPEVVCKVTILAGLQLAWLLILAVPLDAYNQHSPFVDKAAGVA  79

Query  306  NLTLPMKELWLAIYIVNAVLVFFIIPFAMFFYEGDQDKSLGKRI--KSSLCWVAVTAIVC  479
               L M+  W  +    A+ + F +PFA F+YE D D  + +R   K +L    V A+ C
Sbjct  80   TAGLDMRLYWGVVAWFTALYLLFAVPFATFYYEADFDSRVTRRTPWKRALS-KTVLAVCC  138

Query  480  ALLL  491
            A L+
Sbjct  139  AGLV  142



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160