BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F14

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009800601.1|  PREDICTED: succinate dehydrogenase [ubiquino...    340   2e-114   Nicotiana sylvestris
ref|XP_009598927.1|  PREDICTED: succinate dehydrogenase [ubiquino...    336   4e-113   Nicotiana tomentosiformis
ref|XP_006338645.1|  PREDICTED: succinate dehydrogenase [ubiquino...    333   4e-112   Solanum tuberosum [potatoes]
ref|NP_001234860.1|  mitochondrial succinate dehydrogenase iron s...    333   4e-112   Solanum lycopersicum
ref|XP_010270796.1|  PREDICTED: succinate dehydrogenase [ubiquino...    331   4e-111   Nelumbo nucifera [Indian lotus]
ref|XP_004145686.1|  PREDICTED: succinate dehydrogenase [ubiquino...    330   6e-111   Cucumis sativus [cucumbers]
ref|XP_008450036.1|  PREDICTED: succinate dehydrogenase [ubiquino...    329   3e-110   Cucumis melo [Oriental melon]
ref|XP_011097339.1|  PREDICTED: succinate dehydrogenase [ubiquino...    329   3e-110   Sesamum indicum [beniseed]
emb|CDP15766.1|  unnamed protein product                                327   2e-109   Coffea canephora [robusta coffee]
ref|XP_004488937.1|  PREDICTED: succinate dehydrogenase [ubiquino...    327   3e-109   Cicer arietinum [garbanzo]
gb|KDP46359.1|  hypothetical protein JCGZ_10199                         327   3e-109   Jatropha curcas
gb|AGV54412.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    324   2e-108   Phaseolus vulgaris [French bean]
gb|KEH43401.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    324   3e-108   Medicago truncatula
gb|KEH17402.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    322   9e-108   Medicago truncatula
ref|XP_010111654.1|  Succinate dehydrogenase [ubiquinone] iron-su...    322   2e-107   Morus notabilis
gb|EYU34773.1|  hypothetical protein MIMGU_mgv1a011509mg                322   2e-107   Erythranthe guttata [common monkey flower]
gb|EYU44828.1|  hypothetical protein MIMGU_mgv1a011661mg                321   3e-107   Erythranthe guttata [common monkey flower]
gb|KDO45675.1|  hypothetical protein CISIN_1g023670mg                   320   3e-107   Citrus sinensis [apfelsine]
gb|KHG00857.1|  Succinate dehydrogenase [ubiquinone] iron-sulfur ...    320   7e-107   Gossypium arboreum [tree cotton]
ref|XP_004304690.1|  PREDICTED: succinate dehydrogenase [ubiquino...    320   7e-107   Fragaria vesca subsp. vesca
gb|AFK34767.1|  unknown                                                 320   9e-107   Medicago truncatula
gb|KDO45674.1|  hypothetical protein CISIN_1g023670mg                   318   3e-106   Citrus sinensis [apfelsine]
ref|XP_003553891.1|  PREDICTED: succinate dehydrogenase [ubiquino...    318   4e-106   Glycine max [soybeans]
ref|XP_003547685.1|  PREDICTED: succinate dehydrogenase [ubiquino...    318   7e-106   
gb|EPS71789.1|  succinate dehydrogenase                                 317   2e-105   Genlisea aurea
gb|KJB76479.1|  hypothetical protein B456_012G091400                    317   3e-105   Gossypium raimondii
ref|XP_007031724.1|  Succinate dehydrogenase 2-2                        313   3e-104   
ref|XP_002268523.1|  PREDICTED: succinate dehydrogenase [ubiquino...    311   2e-103   Vitis vinifera
ref|XP_006447204.1|  hypothetical protein CICLE_v10016181mg             309   4e-103   
ref|XP_006447205.1|  hypothetical protein CICLE_v10016181mg             308   3e-102   Citrus clementina [clementine]
ref|XP_010528199.1|  PREDICTED: succinate dehydrogenase [ubiquino...    307   1e-101   Tarenaya hassleriana [spider flower]
gb|KJB11590.1|  hypothetical protein B456_001G267500                    306   2e-101   Gossypium raimondii
gb|KHG24377.1|  Succinate dehydrogenase [ubiquinone] iron-sulfur ...    304   4e-101   Gossypium arboreum [tree cotton]
ref|XP_010689037.1|  PREDICTED: succinate dehydrogenase [ubiquino...    303   2e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_198881.1|  succinate dehydrogenase [ubiquinone] iron-sulfu...    302   7e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405448.1|  hypothetical protein EUTSA_v10027879mg             302   1e-99    Eutrema salsugineum [saltwater cress]
ref|XP_010927573.1|  PREDICTED: succinate dehydrogenase [ubiquino...    302   1e-99    Elaeis guineensis
gb|AAM65047.1|  succinate dehydrogenase iron-protein subunit-like       300   5e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514444.1|  PREDICTED: succinate dehydrogenase [ubiquino...    300   6e-99    Camelina sativa [gold-of-pleasure]
ref|XP_002870688.1|  succinate dehydrogenase 2-2                        300   9e-99    Arabidopsis lyrata subsp. lyrata
ref|XP_010450634.1|  PREDICTED: succinate dehydrogenase [ubiquino...    299   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010425489.1|  PREDICTED: succinate dehydrogenase [ubiquino...    299   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006282691.1|  hypothetical protein CARUB_v10005447mg             298   4e-98    Capsella rubella
emb|CAC19856.1|  mitochondrial succinate dehydrogenase iron-sulph...    298   5e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395448.1|  hypothetical protein EUTSA_v10004747mg             297   7e-98    Eutrema salsugineum [saltwater cress]
ref|XP_010436005.1|  PREDICTED: succinate dehydrogenase [ubiquino...    297   9e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006291631.1|  hypothetical protein CARUB_v10017784mg             296   2e-97    Capsella rubella
ref|XP_009125153.1|  PREDICTED: succinate dehydrogenase [ubiquino...    295   3e-97    Brassica rapa
ref|XP_010932282.1|  PREDICTED: succinate dehydrogenase [ubiquino...    295   5e-97    Elaeis guineensis
ref|XP_008799935.1|  PREDICTED: succinate dehydrogenase [ubiquino...    295   7e-97    Phoenix dactylifera
ref|XP_002526944.1|  succinate dehydrogenase, putative                  295   8e-97    Ricinus communis
ref|XP_008230465.1|  PREDICTED: succinate dehydrogenase [ubiquino...    295   1e-96    Prunus mume [ume]
ref|XP_011045237.1|  PREDICTED: succinate dehydrogenase [ubiquino...    294   2e-96    Populus euphratica
ref|XP_008797193.1|  PREDICTED: succinate dehydrogenase [ubiquino...    294   2e-96    Phoenix dactylifera
ref|XP_002298583.1|  succinate dehydrogenase iron-sulfur protein ...    294   2e-96    Populus trichocarpa [western balsam poplar]
emb|CDX83688.1|  BnaC07g24280D                                          293   4e-96    
ref|XP_010441224.1|  PREDICTED: succinate dehydrogenase [ubiquino...    293   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_009382912.1|  PREDICTED: succinate dehydrogenase [ubiquino...    292   1e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009340851.1|  PREDICTED: succinate dehydrogenase [ubiquino...    292   1e-95    Pyrus x bretschneideri [bai li]
ref|XP_010554967.1|  PREDICTED: succinate dehydrogenase [ubiquino...    300   1e-95    
ref|XP_009151968.1|  PREDICTED: succinate dehydrogenase [ubiquino...    291   3e-95    Brassica rapa
ref|XP_008348008.1|  PREDICTED: succinate dehydrogenase [ubiquino...    291   4e-95    
ref|XP_007215620.1|  hypothetical protein PRUPE_ppa007934mg             293   4e-95    
ref|NP_189374.1|  succinate dehydrogenase [ubiquinone] iron-sulfu...    290   4e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CDY13709.1|  BnaA06g32140D                                          290   4e-95    Brassica napus [oilseed rape]
ref|XP_002877047.1|  succinate dehydrogenase 2-1                        290   5e-95    Arabidopsis lyrata subsp. lyrata
emb|CAC19855.1|  mitochondrial succinate dehydrogenase iron-sulph...    288   3e-94    Arabidopsis thaliana [mouse-ear cress]
gb|KCW50658.1|  hypothetical protein EUGRSUZ_J00347                     291   6e-94    Eucalyptus grandis [rose gum]
ref|XP_009370320.1|  PREDICTED: succinate dehydrogenase [ubiquino...    286   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_010034172.1|  PREDICTED: uncharacterized protein LOC104423370    293   7e-93    
gb|AAM63946.1|  succinate dehydrogenase iron-protein subunit, put...    285   8e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008379173.1|  PREDICTED: succinate dehydrogenase [ubiquino...    284   1e-92    
ref|XP_009111569.1|  PREDICTED: succinate dehydrogenase [ubiquino...    283   3e-92    Brassica rapa
ref|XP_009129421.1|  PREDICTED: succinate dehydrogenase [ubiquino...    280   6e-91    Brassica rapa
ref|NP_001136531.1|  uncharacterized protein LOC100216648               273   2e-88    Zea mays [maize]
ref|XP_009384258.1|  PREDICTED: succinate dehydrogenase [ubiquino...    273   3e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008647440.1|  PREDICTED: uncharacterized protein LOC100216...    274   9e-88    Zea mays [maize]
gb|ACG35757.1|  succinate dehydrogenase iron-sulfur protein,mitoc...    268   4e-86    Zea mays [maize]
emb|CAD62367.1|  succinate dehydrogenase                                267   4e-86    Triticum aestivum [Canadian hard winter wheat]
gb|AFW61340.1|  hypothetical protein ZEAMMB73_203922                    265   8e-86    
dbj|BAK03407.1|  predicted protein                                      266   2e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573312.1|  PREDICTED: succinate dehydrogenase [ubiquino...    266   2e-85    Brachypodium distachyon [annual false brome]
emb|CAD62368.1|  chimeric SDH2-RPS14 protein                            268   3e-85    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008677742.1|  PREDICTED: iron sulfur subunit of succinate ...    265   5e-85    Zea mays [maize]
gb|ABR16401.1|  unknown                                                 263   7e-85    Picea sitchensis
ref|XP_003573313.1|  PREDICTED: succinate dehydrogenase [ubiquino...    266   8e-85    Brachypodium distachyon [annual false brome]
ref|NP_001183639.1|  iron sulfur subunit of succinate dehydrogena...    265   2e-84    Zea mays [maize]
gb|ABR17434.1|  unknown                                                 263   3e-84    Picea sitchensis
ref|XP_004972987.1|  PREDICTED: succinate dehydrogenase [ubiquino...    262   8e-84    Setaria italica
gb|AFW61337.1|  iron sulfur subunit of succinate dehydrogenase an...    265   1e-83    
ref|NP_001060876.1|  Os08g0120000                                       259   9e-83    
ref|XP_004972986.1|  PREDICTED: succinate dehydrogenase [ubiquino...    263   1e-82    
ref|XP_006659072.1|  PREDICTED: succinate dehydrogenase [ubiquino...    258   2e-82    Oryza brachyantha
dbj|BAA82748.1|  mitochondrial ribosomal protein S14                    260   2e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659071.1|  PREDICTED: succinate dehydrogenase [ubiquino...    260   3e-82    Oryza brachyantha
ref|XP_007398019.1|  hypothetical protein PHACADRAFT_259610             256   1e-81    Phanerochaete carnosa HHB-10118-sp
gb|EAZ05419.1|  hypothetical protein OsI_27631                          260   1e-81    Oryza sativa Indica Group [Indian rice]
gb|ABF83897.1|  succinate dehydrogenase                                 250   6e-81    Mangifera indica
ref|XP_007412483.1|  hypothetical protein MELLADRAFT_117110             250   3e-79    Melampsora larici-populina 98AG31
ref|XP_011120355.1|  hypothetical protein AOL_s00054g737                249   6e-79    Arthrobotrys oligospora ATCC 24927
ref|XP_007306928.1|  succinate dehydrogenase and fumarate r             248   1e-78    Stereum hirsutum FP-91666 SS1
ref|XP_007261901.1|  succinate dehydrogenase iron-sulfur subunit,...    248   1e-78    Fomitiporia mediterranea MF3/22
gb|KIO21745.1|  hypothetical protein M407DRAFT_15770                    248   2e-78    Tulasnella calospora MUT 4182
ref|XP_007350046.1|  succinate dehydrogenase iron-sulfur subunit        246   4e-78    
ref|XP_001784121.1|  predicted protein                                  245   4e-78    
gb|EWM29428.1|  succinate dehydrogenase iron sulfur protein             247   4e-78    Nannochloropsis gaditana
ref|XP_503189.1|  YALI0D23397p                                          246   6e-78    Yarrowia lipolytica CLIB122
dbj|BAJ24098.1|  succinate dehydrogenase iron-sulphur protein           247   7e-78    Helicobasidium mompa
emb|CEG01696.1|  Succinate dehydrogenase/fumarate reductase iron-...    246   1e-77    Ostreococcus tauri
dbj|GAA97382.1|  hypothetical protein E5Q_04060                         246   1e-77    Mixia osmundae IAM 14324
gb|KDE06101.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    244   3e-77    Microbotryum lychnidis-dioicae p1A1 Lamole
gb|EPS94983.1|  hypothetical protein FOMPIDRAFT_1133380                 244   4e-77    Fomitopsis pinicola FP-58527 SS1
ref|XP_004992280.1|  succinate dehydrogenase                            244   4e-77    Salpingoeca rosetta
ref|XP_002979741.1|  hypothetical protein SELMODRAFT_57580              242   6e-77    
gb|ACE98099.1|  2Fe-2S ferredoxin                                       239   6e-77    Populus tremula [European aspen]
gb|ACE98095.1|  2Fe-2S ferredoxin                                       239   6e-77    Populus tremula [European aspen]
emb|CCG83181.1|  Probable succinate dehydrogenase                       244   7e-77    Taphrina deformans PYCC 5710
gb|KIP11285.1|  hypothetical protein PHLGIDRAFT_27998                   243   8e-77    Phlebiopsis gigantea 11061_1 CR5-6
gb|ACE98127.1|  2Fe-2S ferredoxin                                       239   8e-77    Populus tremula [European aspen]
ref|XP_006456222.1|  succinate dehydrogenase iron-sulfur subunit        243   8e-77    Agaricus bisporus var. bisporus H97
ref|XP_006564033.1|  PREDICTED: succinate dehydrogenase [ubiquino...    243   9e-77    
gb|KDE06102.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    243   1e-76    Microbotryum lychnidis-dioicae p1A1 Lamole
gb|KIL56467.1|  hypothetical protein M378DRAFT_113413                   243   1e-76    Amanita muscaria Koide BX008
gb|KGB76525.1|  succinate dehydrogenase iron-sulfur subunit             243   1e-76    Cryptococcus gattii VGII R265
gb|KIR31702.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    243   1e-76    Cryptococcus gattii VGII MMRL2647
gb|ACE98101.1|  2Fe-2S ferredoxin                                       239   2e-76    Populus tremula [European aspen]
gb|ACE98097.1|  2Fe-2S ferredoxin                                       239   2e-76    Populus tremula [European aspen]
emb|CDF89482.1|  ZYBA0S04-05336g1_1                                     242   2e-76    Zygosaccharomyces bailii CLIB 213
emb|CDH08447.1|  probable Succinate dehydrogenase [ubiquinone] ir...    242   2e-76    Zygosaccharomyces bailii ISA1307
ref|XP_006617552.1|  PREDICTED: succinate dehydrogenase [ubiquino...    243   2e-76    Apis dorsata [rock honeybee]
emb|CDH57720.1|  iron-sulfur protein subunit of succinatedehydrog...    242   3e-76    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007870368.1|  hypothetical protein GLOTRDRAFT_133076             243   4e-76    Gloeophyllum trabeum ATCC 11539
gb|AFR96451.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    242   4e-76    Cryptococcus neoformans var. grubii H99
gb|KIR88650.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    242   4e-76    Cryptococcus gattii VGIV IND107
ref|XP_003441476.1|  PREDICTED: succinate dehydrogenase [ubiquino...    241   5e-76    Oreochromis niloticus
ref|XP_001747850.1|  hypothetical protein                               242   8e-76    Monosiga brevicollis MX1
ref|XP_007387437.1|  iron-sulphar subunit protein of succinate de...    241   8e-76    Punctularia strigosozonata HHB-11173 SS5
gb|KIY45193.1|  iron-sulfur subunit protein of succinate dehydrog...    241   9e-76    Fistulina hepatica ATCC 64428
emb|CAT00089.1|  succinate dehydrogenase iron-sulfur subunit            241   9e-76    Hebeloma cylindrosporum
emb|CEJ90179.1|  Putative Succinate dehydrogenase iron-sulfur pro...    241   9e-76    Torrubiella hemipterigena
ref|XP_572035.1|  succinate dehydrogenase iron-sulfur subunit           241   9e-76    Cryptococcus neoformans var. neoformans JEC21
dbj|GAM84698.1|  hypothetical protein ANO11243_026970                   241   1e-75    fungal sp. No.11243
gb|KIR49148.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    241   1e-75    Cryptococcus gattii CA1280
gb|KIM43854.1|  hypothetical protein M413DRAFT_390042                   240   1e-75    Hebeloma cylindrosporum h7
ref|XP_004544823.1|  PREDICTED: succinate dehydrogenase [ubiquino...    241   1e-75    Maylandia zebra
gb|KDR70285.1|  hypothetical protein GALMADRAFT_255190                  240   1e-75    Galerina marginata CBS 339.88
ref|XP_002050487.1|  GJ22180                                            241   1e-75    Drosophila virilis
ref|XP_011307280.1|  PREDICTED: succinate dehydrogenase [ubiquino...    240   1e-75    Fopius arisanus
ref|XP_002988385.1|  hypothetical protein SELMODRAFT_47515              239   1e-75    
ref|XP_001838873.1|  succinate dehydrogenase iron-sulfur subunit        240   1e-75    Coprinopsis cinerea okayama7#130
ref|XP_572036.1|  succinate dehydrogenase iron-sulfur subunit           241   2e-75    Cryptococcus neoformans var. neoformans JEC21
gb|KIR52001.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    240   2e-75    Cryptococcus gattii Ru294
gb|KIK01904.1|  hypothetical protein K443DRAFT_678046                   239   2e-75    Laccaria amethystina LaAM-08-1
gb|KIJ49079.1|  hypothetical protein M422DRAFT_28092                    240   2e-75    Sphaerobolus stellatus SS14
ref|XP_003195122.1|  succinate dehydrogenase iron-sulfur subunit        240   2e-75    Cryptococcus gattii WM276
gb|AAY63983.1|  succinate dehydrogenase iron sulfur subunit B           240   2e-75    Lysiphlebus testaceipes
ref|NP_477101.1|  succinate dehydrogenase B                             241   2e-75    Drosophila melanogaster
ref|XP_002433069.1|  succinate dehydrogenase, iron-sulfur subunit       240   2e-75    Pediculus humanus corporis [human body lice]
ref|XP_002089380.1|  GE19076                                            241   2e-75    Drosophila yakuba
ref|XP_002032650.1|  GM20899                                            241   2e-75    Drosophila sechellia
ref|XP_003005289.1|  succinate dehydrogenase iron-sulfur subunit        239   2e-75    Verticillium alfalfae VaMs.102
ref|XP_001360158.1|  GA17170                                            240   3e-75    Drosophila pseudoobscura pseudoobscura
ref|XP_008292151.1|  PREDICTED: succinate dehydrogenase [ubiquino...    240   3e-75    Stegastes partitus
ref|XP_003485289.1|  PREDICTED: succinate dehydrogenase [ubiquino...    239   3e-75    Bombus impatiens
ref|XP_001793919.1|  hypothetical protein SNOG_03351                    240   3e-75    Parastagonospora nodorum SN15
emb|CDR47313.1|  CYFA0S31e00210g1_1                                     239   3e-75    Cyberlindnera fabianii
ref|XP_002004991.1|  GI19303                                            240   4e-75    Drosophila mojavensis
ref|WP_006954635.1|  Succinate dehydrogenase iron-sulfur protein        239   4e-75    Sphingobium japonicum
ref|XP_005741497.1|  PREDICTED: succinate dehydrogenase [ubiquino...    239   4e-75    Pundamilia nyererei
gb|EMF10018.1|  succinate dehydrogenase iron-sulfur protein,mitoc...    240   4e-75    Sphaerulina musiva SO2202
ref|WP_017182650.1|  succinate dehydrogenase iron-sulfur subunit        239   4e-75    Sphingobium
ref|XP_001987146.1|  GH21756                                            240   4e-75    Drosophila grimshawi
gb|AEE63557.1|  unknown                                                 238   4e-75    Dendroctonus ponderosae
ref|XP_010773596.1|  PREDICTED: succinate dehydrogenase [ubiquino...    239   4e-75    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009552678.1|  hypothetical protein HETIRDRAFT_481926             239   4e-75    Heterobasidion irregulare TC 32-1
ref|XP_005454159.1|  PREDICTED: succinate dehydrogenase [ubiquino...    239   5e-75    Oreochromis niloticus
gb|AGO11201.1|  AaceriACL065Cp                                          238   6e-75    Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_006695818.1|  succinate dehydrogenase-like protein               239   6e-75    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_006783450.1|  PREDICTED: succinate dehydrogenase [ubiquino...    239   6e-75    Neolamprologus brichardi [lyretail cichlid]
ref|XP_001961283.1|  GF11072                                            239   6e-75    Drosophila ananassae
gb|KIV95381.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    239   6e-75    Exophiala mesophila
ref|XP_004535794.1|  PREDICTED: succinate dehydrogenase [ubiquino...    239   7e-75    Ceratitis capitata [medfly]
ref|XP_007570175.1|  PREDICTED: succinate dehydrogenase [ubiquino...    239   7e-75    Poecilia formosa
gb|ACO15487.1|  Succinate dehydrogenase iron-sulfur subunit, mito...    239   7e-75    Caligus clemensi
ref|XP_007774143.1|  iron-sulphar subunit protein of succinate de...    238   8e-75    Coniophora puteana RWD-64-598 SS2
gb|KDQ53949.1|  hypothetical protein JAAARDRAFT_38932                   238   8e-75    Jaapia argillacea MUCL 33604
ref|XP_002165357.1|  PREDICTED: succinate dehydrogenase [ubiquino...    238   9e-75    Hydra vulgaris
ref|XP_003840583.1|  similar to succinate dehydrogenase iron-sulf...    239   9e-75    Leptosphaeria maculans JN3
emb|CAG01723.1|  unnamed protein product                                238   1e-74    Tetraodon nigroviridis
ref|XP_003034564.1|  Iron-sulfur subunit protein of succinate deh...    238   1e-74    Schizophyllum commune H4-8
ref|XP_011109617.1|  hypothetical protein H072_3647                     238   1e-74    
ref|XP_005805822.1|  PREDICTED: succinate dehydrogenase [ubiquino...    238   1e-74    Xiphophorus maculatus
gb|ACQ58465.1|  Succinate dehydrogenase iron-sulfur subunit, mito...    238   1e-74    Anoplopoma fimbria
ref|XP_002066043.1|  GK22142                                            238   1e-74    Drosophila willistoni
ref|NP_983339.1|  ACL065Cp                                              237   2e-74    Eremothecium gossypii ATCC 10895
sp|Q70KF8.1|SDHB_UROFA  RecName: Full=Succinate dehydrogenase [ub...    238   2e-74    Uromyces viciae-fabae
emb|CCX04392.1|  Similar to Succinate dehydrogenase [ubiquinone] ...    238   2e-74    Pyronema omphalodes CBS 100304
gb|KDR22350.1|  Succinate dehydrogenase [ubiquinone] iron-sulfur ...    238   2e-74    Zootermopsis nevadensis
ref|XP_004343434.1|  succinate dehydrogenase iron-sulfur subunit        238   2e-74    Capsaspora owczarzaki ATCC 30864
ref|XP_001970722.1|  GG23224                                            238   2e-74    Drosophila erecta
gb|KIY72291.1|  iron-sulfur subunit protein of succinate dehydrog...    237   2e-74    Cylindrobasidium torrendii FP15055 ss-10
emb|CBI17705.3|  unnamed protein product                                239   2e-74    Vitis vinifera
ref|XP_003394586.1|  PREDICTED: succinate dehydrogenase [ubiquino...    237   2e-74    Bombus terrestris [large earth bumblebee]
ref|XP_003869443.1|  Sdh2 Fe-S subunit of succinate dehydrogenase       237   2e-74    Candida orthopsilosis Co 90-125
ref|XP_007681605.1|  hypothetical protein BAUCODRAFT_134827             238   3e-74    Baudoinia panamericana UAMH 10762
ref|XP_011445975.1|  PREDICTED: succinate dehydrogenase [ubiquino...    237   3e-74    Crassostrea gigas
gb|ADV91179.1|  mitochondrial succinate dehydrogenase iron-sulphu...    238   3e-74    Karlodinium veneficum
ref|XP_011196731.1|  PREDICTED: succinate dehydrogenase [ubiquino...    238   3e-74    Zeugodacus cucurbitae [melon fruit fly]
gb|ENN70482.1|  hypothetical protein YQE_12985                          238   3e-74    Dendroctonus ponderosae
gb|KDQ08070.1|  hypothetical protein BOTBODRAFT_38289                   237   3e-74    Botryobasidium botryosum FD-172 SS1
gb|KIK82102.1|  hypothetical protein PAXRUDRAFT_832396                  237   3e-74    Paxillus rubicundulus Ve08.2h10
emb|CDS11832.1|  Putative Succinate dehydrogenase                       236   3e-74    Lichtheimia ramosa
emb|CCE42815.1|  hypothetical protein CPAR2_204580                      236   3e-74    Candida parapsilosis
gb|EHK17152.1|  hypothetical protein TRIVIDRAFT_88418                   237   3e-74    Trichoderma virens Gv29-8
dbj|BAJ07111.1|  succinate dehydrogenase subunit B                      238   4e-74    Corynespora cassiicola
dbj|BAJ07110.1|  succinate dehydrogenase subunit B                      238   4e-74    Corynespora cassiicola
emb|CCE26570.1|  probable succinate dehydrogenase (ubiquinone) ir...    236   4e-74    Claviceps purpurea 20.1
dbj|BAO42719.1|  succinate dehydrogenase [ubiquinone] iron-sulfur...    236   4e-74    Kluyveromyces marxianus DMKU3-1042
gb|KFH68219.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    236   4e-74    Mortierella verticillata NRRL 6337
gb|ESW98615.1|  Succinate dehydrogenase [ubiquinone] iron-sulfur ...    236   4e-74    Ogataea parapolymorpha DL-1
dbj|BAH72989.1|  iron-sulfur subunit of succinate dehydrogenase         236   4e-74    Mortierella alpina
ref|XP_009649180.1|  succinate dehydrogenase iron-sulfur subunit        236   5e-74    Verticillium dahliae VdLs.17
ref|XP_011273321.1|  succinate dehydrogenase complex, subunit B         236   5e-74    Wickerhamomyces ciferrii
ref|XP_003959765.1|  hypothetical protein KAFR_0L00230                  236   5e-74    Kazachstania africana CBS 2517
gb|ACO09839.1|  Succinate dehydrogenase iron-sulfur protein, mito...    236   5e-74    Osmerus mordax
dbj|BAM15614.1|  iron-sulfur subunit of succinate dehydrogenase         238   5e-74    Plasmodium gallinaceum
ref|XP_007819571.2|  succinate dehydrogenase iron-sulfur protein        236   5e-74    Metarhizium robertsii ARSEF 23
ref|XP_005931534.1|  PREDICTED: succinate dehydrogenase [ubiquino...    236   5e-74    Haplochromis burtoni
ref|XP_004575464.1|  PREDICTED: succinate dehydrogenase [ubiquino...    236   5e-74    Maylandia zebra
ref|XP_001876249.1|  predicted protein                                  236   5e-74    Laccaria bicolor S238N-H82
gb|KFH42867.1|  Succinate dehydrogenase [ubiquinone] iron-sulfur ...    236   6e-74    Acremonium chrysogenum ATCC 11550
ref|XP_006675189.1|  hypothetical protein BATDEDRAFT_18595              236   6e-74    Batrachochytrium dendrobatidis JAM81
gb|EJK54269.1|  hypothetical protein THAOC_26120                        237   7e-74    Thalassiosira oceanica
emb|CEL53558.1|  succinate dehydrogenase iron-sulfur subunit            236   7e-74    Rhizoctonia solani AG-1 IB
gb|EQK99080.1|  succinate dehydrogenase iron-sulfur protein             236   7e-74    Ophiocordyceps sinensis CO18
emb|CAA75895.1|  succinate dehydrogenase iron-sulfur subunit            235   7e-74    Agaricus bisporus [button mushroom]
ref|XP_003963013.1|  PREDICTED: succinate dehydrogenase [ubiquino...    236   8e-74    Takifugu rubripes [tiger puffer]
gb|EKG14795.1|  Ferredoxin                                              236   8e-74    Macrophomina phaseolina MS6
gb|EZA47846.1|  Succinate dehydrogenase [ubiquinone] iron-sulfur ...    235   8e-74    Ooceraea biroi
ref|XP_007323431.1|  iron-sulfur protein subunit of succinate deh...    236   9e-74    Serpula lacrymans var. lacrymans S7.9
ref|XP_007828551.1|  Succinate dehydrogenase [ubiquinone] iron-su...    236   9e-74    Pestalotiopsis fici W106-1
ref|XP_010785173.1|  PREDICTED: succinate dehydrogenase [ubiquino...    236   1e-73    Notothenia coriiceps [yellowbelly rockcod]
gb|AAY66829.1|  succinate dehydrogenase Ip subunit                      236   1e-73    Ixodes scapularis [blacklegged tick]
gb|ACO57604.1|  succinate dehydrogenase complex subunit B               234   1e-73    Gillichthys mirabilis
ref|XP_011349118.1|  PREDICTED: succinate dehydrogenase [ubiquino...    236   1e-73    Ooceraea biroi
gb|KIW01365.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    236   1e-73    Verruconis gallopava
emb|CDO94128.1|  unnamed protein product                                234   1e-73    Kluyveromyces dobzhanskii CBS 2104
gb|AER08702.1|  mitochondrial succinate dehydrogenase subunit B         236   1e-73    Zymoseptoria tritici
ref|XP_007843521.1|  succinate dehydrogenase iron-sulfur subunit        235   1e-73    
ref|XP_005190481.1|  PREDICTED: succinate dehydrogenase [ubiquino...    236   1e-73    Musca domestica
dbj|BAC78391.1|  succinate dehydrogenase iron-sulfur protein subunit    231   1e-73    Cucumis sativus [cucumbers]
ref|XP_007736854.1|  succinate dehydrogenase [ubiquinone] iron-su...    236   1e-73    Capronia epimyces CBS 606.96
gb|AER08707.1|  mitochondrial succinate dehydrogenase subunit B         236   2e-73    Zymoseptoria tritici
ref|XP_001908552.1|  hypothetical protein                               235   2e-73    Podospora anserina S mat+
gb|KII85656.1|  hypothetical protein PLICRDRAFT_116306                  235   2e-73    Plicaturopsis crispa FD-325 SS-3
gb|KIW26313.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    236   2e-73    Cladophialophora immunda
ref|XP_008548881.1|  PREDICTED: succinate dehydrogenase [ubiquino...    235   2e-73    Microplitis demolitor
gb|AGO46415.1|  succinate dehydrogenase complex subunit A               235   2e-73    Reticulitermes flavipes
gb|AER08703.1|  mitochondrial succinate dehydrogenase subunit B         236   2e-73    Zymoseptoria tritici
gb|EPX72617.1|  succinate dehydrogenase iron-sulfur protein subunit     235   2e-73    Schizosaccharomyces octosporus yFS286
ref|XP_005787774.1|  succinate dehydrogenase iron-sulfur subunit,...    234   2e-73    Emiliania huxleyi CCMP1516
ref|XP_453977.1|  hypothetical protein                                  234   2e-73    Kluyveromyces lactis
ref|XP_003708104.1|  PREDICTED: succinate dehydrogenase [ubiquino...    235   2e-73    Megachile rotundata
ref|XP_005730885.1|  PREDICTED: succinate dehydrogenase [ubiquino...    235   2e-73    Pundamilia nyererei
ref|XP_007002562.1|  hypothetical protein TREMEDRAFT_42851              235   2e-73    Tremella mesenterica DSM 1558
ref|XP_008053300.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   2e-73    Carlito syrichta
ref|XP_002498333.1|  ZYRO0G07788p                                       234   2e-73    Zygosaccharomyces rouxii
gb|ENH88418.1|  succinate dehydrogenase iron-sulfur protein             234   2e-73    
ref|XP_003656832.1|  hypothetical protein THITE_2122016                 235   2e-73    Thielavia terrestris NRRL 8126
gb|EPS61262.1|  hypothetical protein M569_13536                         234   2e-73    Genlisea aurea
ref|XP_003302561.1|  hypothetical protein PTT_14436                     235   3e-73    
ref|XP_003578041.1|  PREDICTED: succinate dehydrogenase [ubiquino...    235   3e-73    Brachypodium distachyon [annual false brome]
ref|XP_008719405.1|  succinate dehydrogenase [ubiquinone] iron-su...    235   3e-73    Cyphellophora europaea CBS 101466
gb|KFH68062.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    234   3e-73    Mortierella verticillata NRRL 6337
emb|CCA71962.1|  related to succinate dehydrogenase [ubiquinone] ...    234   3e-73    Serendipita indica DSM 11827
gb|EHK47561.1|  succinate dehydrogenase/fumarate reductase iron-s...    234   3e-73    Trichoderma atroviride IMI 206040
gb|EMG48515.1|  Succinate dehydrogenase, iron-sulfur protein subu...    234   3e-73    Candida maltosa Xu316
ref|XP_003850753.1|  succinate dehydrogenase (ubiquinone) iron-su...    235   3e-73    Zymoseptoria tritici IPO323
ref|XP_445854.1|  hypothetical protein                                  234   3e-73    [Candida] glabrata
ref|XP_007373775.1|  hypothetical protein SPAPADRAFT_59621              234   3e-73    
gb|KFG82019.1|  succinate dehydrogenase iron-sulfur protein             234   3e-73    
ref|XP_006672347.1|  succinate dehydrogenase iron-sulfur protein        234   3e-73    
ref|WP_011629079.1|  succinate dehydrogenase iron-sulfur subunit        234   3e-73    
gb|ADV40163.1|  succinate dehydrogenase iron-sulfur subunit mitoc...    235   4e-73    
gb|EJT51329.1|  succinate dehydrogenase iron-sulfur subunit             234   4e-73    
gb|KIJ08477.1|  succinate dehydrogenase                                 234   4e-73    
gb|KIW42547.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    235   4e-73    
ref|XP_001642818.1|  hypothetical protein Kpol_388p3                    233   4e-73    
gb|KIM80193.1|  hypothetical protein PILCRDRAFT_822712                  234   4e-73    
gb|EPY52806.1|  succinate dehydrogenase iron-sulfur protein subunit     234   4e-73    
ref|NP_001187800.1|  mitochondrial succinate dehydrogenase (ubiqu...    234   4e-73    
ref|XP_011139507.1|  PREDICTED: LOW QUALITY PROTEIN: succinate de...    235   4e-73    
ref|XP_011097587.1|  PREDICTED: succinate dehydrogenase [ubiquino...    235   4e-73    
ref|XP_007596574.1|  succinate dehydrogenase iron-sulfur subunit        234   4e-73    
ref|XP_001386475.1|  succinate dehydrogenase subunit                    233   4e-73    
gb|KID70353.1|  succinate dehydrogenase iron-sulfur protein             234   5e-73    
gb|KFM65829.1|  Succinate dehydrogenase [ubiquinone] iron-sulfur ...    234   5e-73    
ref|XP_005996363.1|  PREDICTED: succinate dehydrogenase [ubiquino...    234   5e-73    
ref|XP_004180718.1|  hypothetical protein TBLA_0E01400                  234   5e-73    
ref|WP_025282014.1|  MULTISPECIES: succinate dehydrogenase              233   5e-73    
ref|XP_004903431.1|  PREDICTED: succinate dehydrogenase [ubiquino...    234   5e-73    
tpg|DAA34111.1|  TPA: succinate dehydrogenase Ip subunit                232   5e-73    
ref|XP_010729841.1|  PREDICTED: succinate dehydrogenase [ubiquino...    234   5e-73    
ref|WP_037480303.1|  succinate dehydrogenase                            233   5e-73    
ref|XP_008411254.1|  PREDICTED: succinate dehydrogenase [ubiquino...    234   5e-73    
gb|EMD36413.1|  succinate dehydrogenase iron-sulfur subunit             233   5e-73    
gb|ADV91178.1|  mitochondrial succinate dehydrogenase iron-sulphu...    234   6e-73    
ref|NP_593530.2|  succinate dehydrogenase iron-sulfur subunit pro...    233   6e-73    
gb|KFA75142.1|  hypothetical protein S40288_02856                       234   6e-73    
gb|EMS24064.1|  succinate dehydrogenase (ubiquinone) iron-sulfur ...    233   6e-73    
emb|CDQ74288.1|  unnamed protein product                                234   6e-73    
ref|XP_445316.1|  hypothetical protein                                  233   7e-73    
gb|KJA18291.1|  hypothetical protein HYPSUDRAFT_205533                  233   7e-73    
ref|XP_006967782.1|  succinate dehydrogenase                            233   7e-73    
ref|XP_002965310.1|  hypothetical protein SELMODRAFT_82638              233   7e-73    
ref|XP_008407994.1|  PREDICTED: succinate dehydrogenase [ubiquino...    234   7e-73    
gb|EFQ26491.1|  succinate dehydrogenase and fumarate reductase ir...    233   7e-73    
ref|XP_002616764.1|  succinate dehydrogenase iron-sulfur protein,...    233   7e-73    
gb|ACO09927.1|  Succinate dehydrogenase iron-sulfur protein, mito...    233   8e-73    
emb|CAG06850.1|  unnamed protein product                                233   8e-73    
gb|KIV78396.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    234   8e-73    
gb|ELU39765.1|  Iron-sulfur subunit protein of succinate dehydrog...    235   8e-73    
ref|XP_007276271.1|  succinate dehydrogenase iron-sulfur protein        233   8e-73    
dbj|BAH30231.1|  succinate dehydrogenase iron-sulfur protein subunit    233   8e-73    
ref|XP_001643981.1|  hypothetical protein Kpol_1070p4                   233   8e-73    
gb|EGI62002.1|  Succinate dehydrogenase [ubiquinone] iron-sulfur ...    233   8e-73    
ref|XP_003069233.1|  Succinate dehydrogenase iron-sulfur protein,...    233   8e-73    
gb|EME39283.1|  hypothetical protein DOTSEDRAFT_66315                   234   8e-73    
ref|XP_001241858.1|  succinate dehydrogenase iron-sulfur protein,...    233   1e-72    
ref|XP_007541713.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   1e-72    
gb|KIJ60855.1|  hypothetical protein HYDPIDRAFT_116720                  233   1e-72    
emb|CCT71204.1|  probable succinate dehydrogenase (ubiquinone) ir...    233   1e-72    
gb|EUC67655.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    233   1e-72    
ref|XP_004070269.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   1e-72    
gb|EWG46351.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    233   1e-72    
gb|KIX97805.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    234   1e-72    
ref|XP_003973274.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   1e-72    
gb|ACO12876.1|  Succinate dehydrogenase iron-sulfur subunit, mito...    234   1e-72    
ref|XP_002493357.1|  Iron-sulfur protein subunit of succinate deh...    233   1e-72    
gb|ACO57605.1|  succinate dehydrogenase complex subunit B               231   1e-72    
ref|XP_005108883.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   1e-72    
ref|XP_008318073.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   1e-72    
gb|AGS56261.1|  mitochondrial succinate dehydrogenase iron-sulphu...    234   1e-72    
gb|ACO07425.1|  Succinate dehydrogenase iron-sulfur protein, mito...    233   1e-72    
gb|EXA38596.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    233   1e-72    
ref|XP_007928845.1|  hypothetical protein MYCFIDRAFT_51773              233   1e-72    
ref|XP_011209911.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   1e-72    
ref|XP_006883665.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   1e-72    
gb|AGS56260.1|  mitochondrial succinate dehydrogenase iron-sulphu...    234   1e-72    
ref|XP_009152364.1|  succinate dehydrogenase [ubiquinone] iron-su...    233   1e-72    
ref|WP_037499720.1|  succinate dehydrogenase                            232   1e-72    
gb|AGS56259.1|  mitochondrial succinate dehydrogenase iron-sulphu...    234   1e-72    
ref|XP_001933259.1|  succinate dehydrogenase iron-sulfur subunit,...    234   1e-72    
ref|XP_008053298.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   1e-72    
ref|XP_007690405.1|  hypothetical protein COCMIDRAFT_101794             234   1e-72    
ref|XP_003658864.1|  hypothetical protein MYCTH_2295190                 233   1e-72    
ref|XP_008041468.1|  succinate dehydrogenase iron-sulfur subunit        232   1e-72    
ref|XP_002977159.1|  hypothetical protein SELMODRAFT_57433              231   1e-72    
ref|XP_002811455.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   1e-72    
ref|XP_011254577.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   1e-72    
gb|KFA67420.1|  hypothetical protein S40285_00176                       233   2e-72    
ref|XP_011060208.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   2e-72    
gb|EWZ34644.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    233   2e-72    
ref|WP_043154221.1|  succinate dehydrogenase                            232   2e-72    
gb|EGU75748.1|  hypothetical protein FOXB_13767                         233   2e-72    
gb|EXM31322.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    233   2e-72    
ref|XP_002113318.1|  expressed hypothetical protein                     232   2e-72    
ref|XP_712003.1|  hypothetical protein CaO19.8251                       232   2e-72    
gb|KHO00626.1|  succinate dehydrogenase iron-sulfur protein             232   2e-72    
gb|KID85635.1|  succinate dehydrogenase iron-sulfur protein             232   2e-72    
gb|AFV73756.1|  mitochondrial succinate dehydrogenase subunit B         233   2e-72    
ref|NP_001035573.1|  succinate dehydrogenase [ubiquinone] iron-su...    233   2e-72    
gb|ADO27903.1|  mitochondrial succinate dehydrogenase iron-sulfur...    233   2e-72    
ref|XP_010740514.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   2e-72    
emb|CEP60566.1|  LALA0S01e13850g1_1                                     232   2e-72    
ref|XP_003648497.1|  hypothetical protein Ecym_8411                     232   2e-72    
gb|KHC28939.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    232   2e-72    
gb|AHW57935.1|  mitochondrial succinate dehydrogenase iron-sulfur...    233   2e-72    
ref|XP_008085538.1|  alpha-helical ferredoxin                           233   2e-72    
gb|EMD91016.1|  hypothetical protein COCHEDRAFT_1225045                 233   2e-72    
gb|KEY67196.1|  hypothetical protein S7711_03055                        232   2e-72    
ref|XP_462382.1|  DEHA2G19382p                                          232   2e-72    
gb|AFV73757.1|  mitochondrial succinate dehydrogenase subunit B         233   2e-72    
gb|KIX00376.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    233   2e-72    
gb|KGU19149.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    231   2e-72    
gb|EJT99580.1|  succinate dehydrogenase iron-sulfur subunit             231   2e-72    
ref|XP_009826543.1|  succinate dehydrogenase [ubiquinone] iron-su...    232   2e-72    
ref|NP_001165802.1|  succinate dehydrogenase [ubiquinone] iron-su...    232   2e-72    
gb|KIN03876.1|  hypothetical protein OIDMADRAFT_158796                  232   3e-72    
ref|XP_002422055.1|  succinate dehydrogenase, iron-sulfur protein...    231   3e-72    
ref|NP_001092210.1|  succinate dehydrogenase [ubiquinone] iron-su...    232   3e-72    
gb|KIL95343.1|  succinate dehydrogenase                                 232   3e-72    
gb|AFV73755.1|  mitochondrial succinate dehydrogenase subunit B         232   3e-72    
ref|XP_010343895.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   3e-72    
gb|EFX79333.1|  hypothetical protein DAPPUDRAFT_231048                  232   3e-72    
ref|XP_004959409.1|  PREDICTED: succinate dehydrogenase [ubiquino...    233   3e-72    
ref|XP_007905147.1|  PREDICTED: succinate dehydrogenase [ubiquino...    232   3e-72    
ref|XP_004637743.1|  PREDICTED: succinate dehydrogenase [ubiquino...    232   3e-72    
gb|ESA10337.1|  hypothetical protein GLOINDRAFT_335540                  232   3e-72    
ref|XP_008692900.1|  PREDICTED: succinate dehydrogenase [ubiquino...    232   4e-72    
ref|XP_001525346.1|  succinate dehydrogenase iron-sulfur protein,...    231   4e-72    
dbj|BAP54727.1|  succinate dehydrogenase iron-sulfur subunit            231   4e-72    
ref|XP_004850441.1|  PREDICTED: succinate dehydrogenase [ubiquino...    234   4e-72    
gb|KDB17818.1|  succinate dehydrogenase iron-sulfur protein precu...    231   4e-72    
ref|XP_008280911.1|  PREDICTED: succinate dehydrogenase [ubiquino...    232   4e-72    
ref|NP_001239146.1|  succinate dehydrogenase [ubiquinone] iron-su...    232   4e-72    
emb|CCF47739.1|  succinate dehydrogenase iron-sulfur subunit            231   4e-72    
ref|XP_007878503.1|  hypothetical protein PFL1_02798                    232   4e-72    
ref|XP_003351694.1|  hypothetical protein SMAC_00236                    231   4e-72    
dbj|GAN10175.1|  succinate dehydrogenase iron-sulfur subunit            231   4e-72    
gb|KIW82988.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    232   4e-72    
gb|AHW57932.1|  mitochondrial succinate dehydrogenase iron-sulfur...    232   4e-72    
ref|XP_008600347.1|  succinate dehydrogenase and fumarate reducta...    231   4e-72    
emb|CDY48359.1|  BnaCnng16210D                                          229   4e-72    
ref|XP_006866404.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   4e-72    
emb|CDY20051.1|  BnaA09g02000D                                          229   5e-72    
ref|XP_007175068.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   5e-72    
ref|XP_005409879.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   5e-72    
dbj|BAK06334.1|  predicted protein                                      232   5e-72    
gb|KIW17673.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    232   5e-72    
ref|XP_005807331.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   5e-72    
ref|XP_007782047.1|  succinate dehydrogenase [ubiquinone] iron-su...    232   5e-72    
ref|XP_008581127.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   5e-72    
ref|XP_004272500.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   5e-72    
ref|XP_007815671.1|  succinate dehydrogenase iron-sulfur protein ...    231   5e-72    
ref|XP_007523779.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   5e-72    
ref|XP_004377263.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   5e-72    
gb|AHW57933.1|  mitochondrial succinate dehydrogenase iron-sulfur...    232   5e-72    
ref|XP_008031470.1|  hypothetical protein SETTUDRAFT_166304             232   6e-72    
gb|AHW57936.1|  mitochondrial succinate dehydrogenase iron-sulfur...    232   6e-72    
ref|XP_007702375.1|  hypothetical protein COCSADRAFT_122288             232   6e-72    
gb|KGG50982.1|  hypothetical protein DI09_49p120                        231   6e-72    
gb|KDO20453.1|  succinate dehydrogenase iron-sulfur subunit             231   6e-72    
ref|XP_007753905.1|  succinate dehydrogenase [ubiquinone] iron-su...    232   6e-72    
gb|ABD77143.1|  succinate dehydrogenase complex subunit B               230   6e-72    
ref|XP_007795076.1|  putative succinate dehydrogenase iron-sulfur...    231   6e-72    
ref|XP_004313664.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   6e-72    
ref|XP_003145730.1|  succinate dehydrogenase iron-sulfur protein        231   7e-72    
pdb|1YQ3|B  Chain B, Avian Respiratory Complex Ii With Oxaloaceta...    230   7e-72    
ref|XP_004603433.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   7e-72    
gb|EGC49151.1|  succinate dehydrogenase iron-sulfur protein             231   7e-72    
ref|XP_011386878.1|  succinate dehydrogenase iron-sulfur protein ...    231   7e-72    
ref|WP_037461843.1|  succinate dehydrogenase                            230   7e-72    
emb|CAA44612.1|  succinate dehydrogenase                                231   7e-72    
ref|XP_002171552.2|  succinate dehydrogenase iron-sulfur protein ...    231   7e-72    
gb|KIW61886.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    231   8e-72    
ref|WP_024019507.1|  succinate dehydrogenase iron-sulfur subunit        230   8e-72    
ref|XP_005528299.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   8e-72    
ref|XP_005317568.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   8e-72    
gb|EER36874.1|  succinate dehydrogenase iron-sulphur protein            231   8e-72    
emb|CBY13006.1|  unnamed protein product                                231   9e-72    
gb|ABD77149.1|  succinate dehydrogenase complex subunit B               230   9e-72    
gb|KDN61213.1|  putative succinate dehydrogenase and fumarate red...    231   9e-72    
ref|XP_008146388.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   9e-72    
ref|XP_008604065.1|  succinate dehydrogenase [ubiquinone] iron-su...    230   1e-71    
gb|EEH35056.2|  succinate dehydrogenase iron-sulfur subunit             231   1e-71    
gb|ABW39788.1|  mitochondrial succinate dehydrogenase iron-sulphu...    231   1e-71    
ref|XP_002189250.1|  PREDICTED: succinate dehydrogenase [ubiquino...    229   1e-71    
ref|NP_002991.2|  succinate dehydrogenase [ubiquinone] iron-sulfu...    230   1e-71    
ref|XP_002545754.1|  succinate dehydrogenase iron-sulfur protein,...    230   1e-71    
gb|EFZ14081.1|  hypothetical protein SINV_09801                         231   1e-71    
sp|Q9YHT2.1|SDHB_CHICK  RecName: Full=Succinate dehydrogenase [ub...    231   1e-71    
ref|NP_001277542.1|  succinate dehydrogenase complex, subunit B, ...    231   1e-71    
gb|ABW39793.1|  mitochondrial succinate dehydrogenase iron-sulphu...    231   1e-71    
ref|NP_001074344.2|  succinate dehydrogenase [ubiquinone] iron-su...    231   1e-71    
ref|WP_027079843.1|  succinate dehydrogenase                            230   1e-71    
gb|ABW39789.1|  mitochondrial succinate dehydrogenase iron-sulphu...    231   1e-71    
emb|CDY00158.1|  BnaC09g01430D                                          228   1e-71    
ref|XP_004200345.1|  Piso0_002930                                       230   1e-71    
ref|XP_007918414.1|  putative succinate dehydrogenase iron-sulfur...    231   1e-71    
gb|EEH16466.2|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    230   1e-71    
ref|NP_001098423.1|  succinate dehydrogenase [ubiquinone] iron-su...    230   1e-71    
emb|CCF54951.1|  probable succinate dehydrogenase [ubiquinone] ir...    231   1e-71    
gb|KEF62378.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    231   1e-71    
ref|XP_003341083.1|  PREDICTED: succinate dehydrogenase [ubiquino...    230   1e-71    
gb|KIW94406.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    231   1e-71    
ref|XP_008870586.1|  succinate dehydrogenase [ubiquinone] iron-su...    230   1e-71    
ref|XP_011165978.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   1e-71    
ref|XP_003989572.1|  PREDICTED: succinate dehydrogenase [ubiquino...    230   1e-71    
ref|XP_011324170.1|  succinate dehydrogenase iron-sulfur protein        230   1e-71    
emb|CDI51769.1|  succinate dehydrogenase [ubiquinone] iron-sulfur...    231   1e-71    
ref|XP_008820855.1|  PREDICTED: succinate dehydrogenase [ubiquino...    230   1e-71    
gb|KIK67418.1|  hypothetical protein GYMLUDRAFT_93224                   230   1e-71    
ref|NP_001264968.1|  succinate dehydrogenase [ubiquinone] iron-su...    230   2e-71    
ref|XP_003413492.1|  PREDICTED: succinate dehydrogenase [ubiquino...    230   2e-71    
gb|ABD77130.1|  succinate dehydrogenase complex subunit B               228   2e-71    
ref|XP_004086147.1|  PREDICTED: succinate dehydrogenase [ubiquino...    230   2e-71    
ref|XP_003232698.1|  succinate dehydrogenase iron-sulfur protein        230   2e-71    
ref|XP_004289318.1|  PREDICTED: succinate dehydrogenase [ubiquino...    231   2e-71    
ref|WP_018718365.1|  succinate dehydrogenase iron-sulfur subunit        229   2e-71    
ref|NP_001080247.1|  succinate dehydrogenase [ubiquinone] iron-su...    230   2e-71    
ref|XP_007586813.1|  putative mitochondrial succinate dehydrogena...    230   2e-71    
emb|CCU74871.1|  succinate dehydrogenase iron sulfur protein            229   2e-71    
gb|EPB84057.1|  succinate dehydrogenase [ubiquinone] iron-sulfur ...    230   2e-71    
ref|XP_006145292.1|  PREDICTED: succinate dehydrogenase [ubiquino...    230   2e-71    
emb|CDK26377.1|  unnamed protein product                                229   2e-71    
ref|XP_009257594.1|  hypothetical protein FPSE_06201                    230   2e-71    
gb|ACO12841.1|  Succinate dehydrogenase iron-sulfur subunit, mito...    231   2e-71    
gb|EYE95724.1|  iron-sulfur protein subunit of succinate dehydrog...    231   2e-71    
gb|ABD77140.1|  succinate dehydrogenase complex subunit B               229   2e-71    



>ref|XP_009800601.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Nicotiana sylvestris]
Length=275

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 179/199 (90%), Gaps = 2/199 (1%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK--IKKFQIYRWSPENPQKP  189
            MA+ L+RRAI++V SSPAAK+ +ARAHASEA A Q+ +  +  IK FQIYRWSP+NP KP
Sbjct  1    MATGLIRRAISRVHSSPAAKLVVARAHASEAKAHQSESKQQPNIKSFQIYRWSPDNPGKP  60

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
            EL+EY+IDLKECGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNIDG NGLACLTK
Sbjct  61   ELKEYKIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTK  120

Query  370  ISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
            I SG +S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK  PP PGKE+ QSK+DR+
Sbjct  121  IDSGAESTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTEPPTPGKEIPQSKSDRA  180

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCSTSCP
Sbjct  181  KLDGMYECILCACCSTSCP  199



>ref|XP_009598927.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Nicotiana tomentosiformis]
Length=275

 Score =   336 bits (862),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 177/199 (89%), Gaps = 2/199 (1%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK--IKKFQIYRWSPENPQKP  189
            MA+ L+RRAI++V SSPAAK+ +ARAHASEA A Q+ +  +  IK FQIYRWSP+NP KP
Sbjct  1    MATGLIRRAISRVHSSPAAKLVVARAHASEAKAHQSESKQQPNIKSFQIYRWSPDNPGKP  60

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
            EL+EY+IDLKECGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNIDG NGLACLTK
Sbjct  61   ELKEYKIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTK  120

Query  370  ISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
            I SG +S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK   P PGKE+ QSK DR+
Sbjct  121  IDSGAESTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTESPTPGKEIPQSKNDRA  180

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCSTSCP
Sbjct  181  KLDGMYECILCACCSTSCP  199



>ref|XP_006338645.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Solanum tuberosum]
Length=274

 Score =   333 bits (855),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 178/198 (90%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASSLVRRAITKV-SSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQKPE  192
            MA+ L+RRAI++V SS+PAA++ +ARAHAS++ A Q  +   +K FQIYRW+P+NP KPE
Sbjct  1    MATGLIRRAISRVQSSAPAARLLVARAHASDSQAQQVESKPNLKSFQIYRWTPDNPGKPE  60

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            L+EY+IDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG NGLACLTKI
Sbjct  61   LKEYKIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNGLACLTKI  120

Query  373  SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSK  552
            SS  +S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK P P PGKE+ QSK+DR+K
Sbjct  121  SSDSESTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPAPTPGKEIPQSKSDRAK  180

Query  553  LDGMYECILCACCSTSCP  606
            LDGMYECILCACCSTSCP
Sbjct  181  LDGMYECILCACCSTSCP  198



>ref|NP_001234860.1| mitochondrial succinate dehydrogenase iron sulfur subunit [Solanum 
lycopersicum]
 gb|ACZ71182.1| mitochondrial succinate dehydrogenase iron sulfur subunit [Solanum 
lycopersicum]
Length=274

 Score =   333 bits (855),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 179/198 (90%), Gaps = 1/198 (1%)
 Frame = +1

Query  16   MASSLVRRAITKV-SSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQKPE  192
            MA+SL+RRAI++V SS+PAA++ +ARAHAS++ A +  +   +K FQIYRW+P+NP KPE
Sbjct  1    MATSLIRRAISRVQSSAPAARLLVARAHASDSQAQKVESKPNLKSFQIYRWTPDNPGKPE  60

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            L+EY+IDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG NGLACLTKI
Sbjct  61   LKEYKIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNGLACLTKI  120

Query  373  SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSK  552
            SS  +S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK P P PGKE+ QSK+DR+K
Sbjct  121  SSDSESTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPAPTPGKEIPQSKSDRAK  180

Query  553  LDGMYECILCACCSTSCP  606
            LDGMYECILCACCSTSCP
Sbjct  181  LDGMYECILCACCSTSCP  198



>ref|XP_010270796.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Nelumbo nucifera]
Length=278

 Score =   331 bits (848),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 177/201 (88%), Gaps = 5/201 (2%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK----IKKFQIYRWSPENPQ  183
            MA+ L RRA+++VS+ PA+K+  +RAHASEA A Q  A AK    +K F IYRW+P+NP 
Sbjct  1    MATGLFRRAVSRVST-PASKLIRSRAHASEAQAQQVEAKAKDQSKMKTFSIYRWNPDNPT  59

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KP+LQ+YEIDLK+CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG NGLACL
Sbjct  60   KPQLQDYEIDLKDCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGCNGLACL  119

Query  364  TKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            TKISSG  + +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK PPP+PGKE+ QSK D
Sbjct  120  TKISSGASTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPPPVPGKEIPQSKKD  179

Query  544  RSKLDGMYECILCACCSTSCP  606
            R+KLDGMYECILCACCSTSCP
Sbjct  180  RAKLDGMYECILCACCSTSCP  200



>ref|XP_004145686.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Cucumis sativus]
 ref|XP_004159135.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Cucumis sativus]
 gb|KGN58222.1| hypothetical protein Csa_3G595230 [Cucumis sativus]
Length=277

 Score =   330 bits (847),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 177/201 (88%), Gaps = 4/201 (2%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQ----ATASAKIKKFQIYRWSPENPQ  183
            MA+ ++RRA+++VS+S  ++    RAHASEA A Q    A AS+ +K F IYRW+P++P 
Sbjct  1    MATGILRRALSRVSASSPSRFLRIRAHASEAQAQQVDQKAAASSHLKTFAIYRWNPDSPS  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KPELQEY+IDLKECGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNIDG NGLACL
Sbjct  61   KPELQEYKIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACL  120

Query  364  TKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            TKISSG  S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+ PP+PGKE+LQSK D
Sbjct  121  TKISSGDSSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSEPPVPGKEILQSKKD  180

Query  544  RSKLDGMYECILCACCSTSCP  606
            R+KLDGMYECILCACCSTSCP
Sbjct  181  RAKLDGMYECILCACCSTSCP  201



>ref|XP_008450036.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial [Cucumis melo]
 gb|ADN34136.1| succinate dehydrogenase [Cucumis melo subsp. melo]
Length=277

 Score =   329 bits (843),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 176/201 (88%), Gaps = 4/201 (2%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQ----ATASAKIKKFQIYRWSPENPQ  183
            MA+ ++RR +++VS+S  ++    RAHASEA A Q    ATAS+ +K F IYRW+P++P 
Sbjct  1    MATGILRRVLSRVSASSPSRFVRIRAHASEAEAQQVEQKATASSNLKTFAIYRWNPDSPS  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KPELQEY+IDLKECGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNIDG NGLACL
Sbjct  61   KPELQEYKIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACL  120

Query  364  TKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            TKI SG  S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+ PP+PGKE+LQSK D
Sbjct  121  TKIPSGDSSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSEPPVPGKEILQSKKD  180

Query  544  RSKLDGMYECILCACCSTSCP  606
            R+KLDGMYECILCACCSTSCP
Sbjct  181  RAKLDGMYECILCACCSTSCP  201



>ref|XP_011097339.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Sesamum indicum]
Length=278

 Score =   329 bits (843),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 180/202 (89%), Gaps = 5/202 (2%)
 Frame = +1

Query  16   MASSLVRRAITKV-SSSPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENP  180
            MAS L+RRAI++V ++S AA++ + RAHASEA A    P+AT+++  K FQIYRW+P++P
Sbjct  1    MASGLLRRAISRVPAASSAARVVVFRAHASEAQAQQVEPKATSNSTPKTFQIYRWNPDSP  60

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
             KPELQ+YEIDLK+CGPM+LDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG+NGLAC
Sbjct  61   NKPELQDYEIDLKDCGPMILDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGRNGLAC  120

Query  361  LTKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKA  540
            LTKI  G  +M+TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+PP  PGKE+LQSK 
Sbjct  121  LTKIPPGGPTMITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPPETPGKEILQSKE  180

Query  541  DRSKLDGMYECILCACCSTSCP  606
            DR KLDGMYECILCACCSTSCP
Sbjct  181  DRKKLDGMYECILCACCSTSCP  202



>emb|CDP15766.1| unnamed protein product [Coffea canephora]
Length=281

 Score =   327 bits (838),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 176/204 (86%), Gaps = 7/204 (3%)
 Frame = +1

Query  16   MASSLVRRAITKV-SSSPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENP  180
            MA+ LVRRAI +V SS+PAAK+ + RAHASEA A    PQA  +  +K FQIYRW+P+NP
Sbjct  1    MATGLVRRAIARVQSSAPAAKLVITRAHASEAEAQQAEPQAKKTHSLKTFQIYRWNPDNP  60

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
            QKPEL++Y IDLKECGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNIDG NGLAC
Sbjct  61   QKPELKDYHIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLAC  120

Query  361  LTKISSGPDS--MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            LTKI S   S   +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+ PP PGKE+ QS
Sbjct  121  LTKIDSDGSSATTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSSPPTPGKEIPQS  180

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            K DR+KLDGMYECILCACCSTSCP
Sbjct  181  KNDRAKLDGMYECILCACCSTSCP  204



>ref|XP_004488937.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Cicer arietinum]
Length=279

 Score =   327 bits (837),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 180/203 (89%), Gaps = 6/203 (3%)
 Frame = +1

Query  16   MASSLVRRAITKVSS-SPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENP  180
            MA+ +++RAI + S+ SPA+++TL RAHASEA A    P+A  +  +KKFQIYRW+P++P
Sbjct  1    MATGMLKRAIYRFSTTSPASRLTLLRAHASEAQAQQVEPKARDTTSLKKFQIYRWNPDSP  60

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
             KPEL+EYEI+LKECGPMVLDALIKIKN+IDP+LTFRRSCREGICGSCAMNIDG NGLAC
Sbjct  61   TKPELKEYEINLKECGPMVLDALIKIKNDIDPSLTFRRSCREGICGSCAMNIDGCNGLAC  120

Query  361  LTKI-SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
            LTKI S G D+ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP  PGKE+LQSK
Sbjct  121  LTKIPSEGSDTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPSEPGKEILQSK  180

Query  538  ADRSKLDGMYECILCACCSTSCP  606
             DR+KLDGMYECILCACCSTSCP
Sbjct  181  KDRAKLDGMYECILCACCSTSCP  203



>gb|KDP46359.1| hypothetical protein JCGZ_10199 [Jatropha curcas]
Length=283

 Score =   327 bits (837),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 177/205 (86%), Gaps = 8/205 (4%)
 Frame = +1

Query  16   MASSLVRR--AITKVSSSP--AAKMTLARAHASEANA----PQATASAKIKKFQIYRWSP  171
            MA+ L+RR  +I +VSSS    A+   AR HASEA A    P+AT+S  +K FQIYRW+P
Sbjct  1    MATGLIRRGVSIARVSSSAPFTARFVPARFHASEAEAQKVEPKATSSTNLKTFQIYRWNP  60

Query  172  ENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNG  351
            +NP KP+LQ+Y+IDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG NG
Sbjct  61   DNPAKPQLQDYQIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNG  120

Query  352  LACLTKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQ  531
            LACLTKI SG  S +TPLPHM+VIKDLVVDMTNFYNQYKSIEPWLKRKNPP +PGKE+LQ
Sbjct  121  LACLTKIPSGNSSTITPLPHMYVIKDLVVDMTNFYNQYKSIEPWLKRKNPPQVPGKEILQ  180

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            SK DR+KLDGMYECILCACCSTSCP
Sbjct  181  SKKDRAKLDGMYECILCACCSTSCP  205



>gb|AGV54412.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2 [Phaseolus 
vulgaris]
Length=279

 Score =   324 bits (830),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 173/201 (86%), Gaps = 5/201 (2%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENPQK  186
            A+ L++RA  +V SSPA K+   RAHASEA A    P+A  +  +K FQIYRW+PENP K
Sbjct  3    ATGLLKRAAQRVPSSPAFKLAFIRAHASEAQAQQVEPKARDTTSLKTFQIYRWNPENPSK  62

Query  187  PELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLT  366
            PEL++Y+I+LKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG NGLACLT
Sbjct  63   PELKDYQINLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNGLACLT  122

Query  367  KI-SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            KI S+   S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP+ GKE+LQSK D
Sbjct  123  KIPSATTASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPVQGKEILQSKKD  182

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDGMYECILCACCSTSCP
Sbjct  183  REKLDGMYECILCACCSTSCP  203



>gb|KEH43401.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit [Medicago 
truncatula]
Length=278

 Score =   324 bits (830),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 178/202 (88%), Gaps = 5/202 (2%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK----IKKFQIYRWSPENPQ  183
            MAS++++RAI ++SSSP +++TL RAHASEA A QA+  A+    +KKFQIYRW+P+ P 
Sbjct  1    MASTMLKRAIHRISSSPTSRLTLLRAHASEAQAQQASPKARDTTVLKKFQIYRWNPDTPS  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KPEL+EYEI+LKECGPMVLDALIKIKN+IDP+LTFRRSCREGICGSCAMNIDG NGLACL
Sbjct  61   KPELKEYEINLKECGPMVLDALIKIKNDIDPSLTFRRSCREGICGSCAMNIDGCNGLACL  120

Query  364  TKI-SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKA  540
            TKI  +G DS +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+P    GKE+ QSK 
Sbjct  121  TKIPDAGMDSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPAEEDGKEIKQSKK  180

Query  541  DRSKLDGMYECILCACCSTSCP  606
            DR+KLDGMYECILCACCSTSCP
Sbjct  181  DRAKLDGMYECILCACCSTSCP  202



>gb|KEH17402.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit [Medicago 
truncatula]
Length=278

 Score =   322 bits (826),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 176/202 (87%), Gaps = 5/202 (2%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK----IKKFQIYRWSPENPQ  183
            MAS++++RAI  +SSSP +++TL RAHASEA A Q +  A+    +KKFQIYRW+P+ P 
Sbjct  1    MASTMLKRAINSISSSPTSRLTLLRAHASEAQAQQVSPKARDTTVLKKFQIYRWNPDTPS  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KPEL+EYEI+LKECGPMVLDALIKIKN+IDP+LTFRRSCREGICGSCAMNIDG NGLACL
Sbjct  61   KPELKEYEINLKECGPMVLDALIKIKNDIDPSLTFRRSCREGICGSCAMNIDGCNGLACL  120

Query  364  TKI-SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKA  540
            TKI  +G DS +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+P    GKE+ QSK 
Sbjct  121  TKIPDAGTDSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPAEEDGKEIRQSKK  180

Query  541  DRSKLDGMYECILCACCSTSCP  606
            DR+KLDGMYECILCACCSTSCP
Sbjct  181  DRAKLDGMYECILCACCSTSCP  202



>ref|XP_010111654.1| Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2 [Morus 
notabilis]
 gb|EXC31399.1| Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2 [Morus 
notabilis]
Length=279

 Score =   322 bits (824),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 172/201 (86%), Gaps = 4/201 (2%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENPQ  183
            MA+ ++RRAI++VSS+ A+K    R  ASEA A    P+A  S  +K F IYRW+P+   
Sbjct  1    MATGILRRAISRVSSTQASKFVPLRFLASEAEAQQVEPKAQGSTNLKTFSIYRWNPDKSG  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KPELQ Y+IDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG NGLACL
Sbjct  61   KPELQNYQIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNGLACL  120

Query  364  TKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            TKI SG  +M+TPLPHM+VIKDLVVDMTNFYNQYKSIEPWLKRK+PP +PGKEVLQSK D
Sbjct  121  TKIPSGSSTMITPLPHMYVIKDLVVDMTNFYNQYKSIEPWLKRKSPPSVPGKEVLQSKKD  180

Query  544  RSKLDGMYECILCACCSTSCP  606
            R+KLDGMYECILCACCSTSCP
Sbjct  181  RAKLDGMYECILCACCSTSCP  201



>gb|EYU34773.1| hypothetical protein MIMGU_mgv1a011509mg [Erythranthe guttata]
Length=279

 Score =   322 bits (824),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 173/202 (86%), Gaps = 5/202 (2%)
 Frame = +1

Query  16   MASSLVRRAITKV-SSSPAAKMTLARAHASEANAPQATASAKI----KKFQIYRWSPENP  180
            MA+ LVRRA+++V S SPAA+  + R+HASEA A Q    AK     K FQIYRW+P++ 
Sbjct  1    MATGLVRRALSRVPSVSPAARAIIYRSHASEAEAQQVEPKAKTTSTPKTFQIYRWNPDST  60

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
            QKPEL++Y+IDLKECGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNIDG+NGLAC
Sbjct  61   QKPELKDYDIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGRNGLAC  120

Query  361  LTKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKA  540
            LTKI SG  +MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK P   P KE+LQSK 
Sbjct  121  LTKIPSGGPTMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPAETPAKEILQSKD  180

Query  541  DRSKLDGMYECILCACCSTSCP  606
            DR KLDGMYECILCACCSTSCP
Sbjct  181  DRKKLDGMYECILCACCSTSCP  202



>gb|EYU44828.1| hypothetical protein MIMGU_mgv1a011661mg [Erythranthe guttata]
Length=275

 Score =   321 bits (823),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 175/202 (87%), Gaps = 8/202 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSS-SPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENP  180
            MA++L+RRAI++V + SPA     +RAHAS A A    P+A ++   K FQIYRW+P +P
Sbjct  1    MATALLRRAISRVPALSPA---IFSRAHASAAEAQQVEPKAKSTTTPKTFQIYRWNPNSP  57

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
            QKPELQ YEIDLKECGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+NGLAC
Sbjct  58   QKPELQNYEIDLKECGPMILDALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGRNGLAC  117

Query  361  LTKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKA  540
            LTKISSG  +MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+ P  PGKE+LQSK 
Sbjct  118  LTKISSGGPTMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSEPSSPGKEILQSKE  177

Query  541  DRSKLDGMYECILCACCSTSCP  606
            DR KLDGMYECILCACCSTSCP
Sbjct  178  DRKKLDGMYECILCACCSTSCP  199



>gb|KDO45675.1| hypothetical protein CISIN_1g023670mg [Citrus sinensis]
Length=230

 Score =   320 bits (819),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 178/203 (88%), Gaps = 6/203 (3%)
 Frame = +1

Query  16   MASSLVRRAITKVSS-SPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENP  180
            MA+ L+RRAI+  ++ +  A++  AR HASEA A    P+A+A+   KKFQIYRW+P++P
Sbjct  1    MATGLIRRAISSSAAVAQPARLLTARFHASEAEAQKVEPKASANTDTKKFQIYRWNPDSP  60

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
             KPEL+E+EI+LKECGPMVLDALIKIK+EIDP+LTFRRSCREGICGSCAMNIDG NGLAC
Sbjct  61   SKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLAC  120

Query  361  LTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
            LTKIS SG  S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP+PGKE+ QSK
Sbjct  121  LTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQSK  180

Query  538  ADRSKLDGMYECILCACCSTSCP  606
             DR+KLDGMYECILCACCSTSCP
Sbjct  181  KDRAKLDGMYECILCACCSTSCP  203



>gb|KHG00857.1| Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial 
-like protein [Gossypium arboreum]
Length=284

 Score =   320 bits (821),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 180/208 (87%), Gaps = 11/208 (5%)
 Frame = +1

Query  16   MASSLVRRAI---TKVSS---SPAAKMTLARAHASEANA----PQATASAKIKKFQIYRW  165
            MA++ +RRA+   ++VSS   +PA++M + R +ASE  A    P+A AS+ +K FQIYRW
Sbjct  1    MATNFIRRAMNMASRVSSPKVAPASRMVVVRPYASETEAQKVEPKAAASSNMKTFQIYRW  60

Query  166  SPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGK  345
            +P+NP KP+LQ+Y+IDLKECGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNI+G 
Sbjct  61   NPDNPTKPQLQDYKIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNINGC  120

Query  346  NGLACLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKE  522
            NGLACLTKI SG  D+ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP  GKE
Sbjct  121  NGLACLTKIESGSLDTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPTAGKE  180

Query  523  VLQSKADRSKLDGMYECILCACCSTSCP  606
            +LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  ILQSKKDRAKLDGMYECILCACCSTSCP  208



>ref|XP_004304690.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Fragaria vesca subsp. vesca]
Length=286

 Score =   320 bits (821),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 175/203 (86%), Gaps = 6/203 (3%)
 Frame = +1

Query  16   MASSLVRRAITKVSSS--PAAKMTLARAHASE----ANAPQATASAKIKKFQIYRWSPEN  177
            MA+ L+RRA T +SSS  PAA+  L RA ASE    A+ P+A  ++K+K F IYRWSP++
Sbjct  1    MATGLLRRAFTGISSSTSPAARRVLLRAFASEPQIDASTPKARETSKLKTFSIYRWSPDS  60

Query  178  PQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
            P KPEL+EYEIDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLA
Sbjct  61   PTKPELKEYEIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA  120

Query  358  CLTKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
            CLTKI SG  + +TPLPHM+VIKDLVVDMTNFYNQYKSIEPWLKRKNP   PGKE+LQ+K
Sbjct  121  CLTKIESGSATTITPLPHMYVIKDLVVDMTNFYNQYKSIEPWLKRKNPAEEPGKEILQTK  180

Query  538  ADRSKLDGMYECILCACCSTSCP  606
             DR+KLDGMYECILCACCSTSCP
Sbjct  181  KDRAKLDGMYECILCACCSTSCP  203



>gb|AFK34767.1| unknown [Medicago truncatula]
Length=278

 Score =   320 bits (820),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 177/202 (88%), Gaps = 5/202 (2%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK----IKKFQIYRWSPENPQ  183
            MAS++++RAI ++SSSP +++TL RAHASEA A QA+  A+    +KKFQIYRW+P+ P 
Sbjct  1    MASTMLKRAIHRISSSPTSRLTLLRAHASEAQAQQASPKARDTTVLKKFQIYRWNPDTPS  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KPEL+E EI+LKECGPMVLDALIKIKN+IDP+LTFRRSCREGICGSCAMNIDG NGLACL
Sbjct  61   KPELKECEINLKECGPMVLDALIKIKNDIDPSLTFRRSCREGICGSCAMNIDGCNGLACL  120

Query  364  TKI-SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKA  540
            TKI  +G DS +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+P    GKE+ QSK 
Sbjct  121  TKIPDAGMDSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPAEEDGKEIKQSKK  180

Query  541  DRSKLDGMYECILCACCSTSCP  606
            DR+KLDGMYECILCACCSTSCP
Sbjct  181  DRAKLDGMYECILCACCSTSCP  202



>gb|KDO45674.1| hypothetical protein CISIN_1g023670mg [Citrus sinensis]
Length=279

 Score =   318 bits (816),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 178/203 (88%), Gaps = 6/203 (3%)
 Frame = +1

Query  16   MASSLVRRAITKVSS-SPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENP  180
            MA+ L+RRAI+  ++ +  A++  AR HASEA A    P+A+A+   KKFQIYRW+P++P
Sbjct  1    MATGLIRRAISSSAAVAQPARLLTARFHASEAEAQKVEPKASANTDTKKFQIYRWNPDSP  60

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
             KPEL+E+EI+LKECGPMVLDALIKIK+EIDP+LTFRRSCREGICGSCAMNIDG NGLAC
Sbjct  61   SKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLAC  120

Query  361  LTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
            LTKIS SG  S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP+PGKE+ QSK
Sbjct  121  LTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQSK  180

Query  538  ADRSKLDGMYECILCACCSTSCP  606
             DR+KLDGMYECILCACCSTSCP
Sbjct  181  KDRAKLDGMYECILCACCSTSCP  203



>ref|XP_003553891.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial [Glycine max]
Length=277

 Score =   318 bits (815),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 173/202 (86%), Gaps = 6/202 (3%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENPQ  183
            MA+ L++RA  ++ SSP  K+ L RAHASEA A    P+A  +  +K FQIYRWSPENP 
Sbjct  1    MATGLLKRAAQRLPSSPGFKLALLRAHASEAQAQQVEPKARGTPTLKTFQIYRWSPENPS  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KPEL++Y+I+LKECGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNIDG NGLACL
Sbjct  61   KPELKDYQINLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACL  120

Query  364  TKI-SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKA  540
            TKI S G  + +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP  PGKE+LQSK 
Sbjct  121  TKIPSEGAATTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPE-PGKEILQSKK  179

Query  541  DRSKLDGMYECILCACCSTSCP  606
            +R KLDGMYECILCACCSTSCP
Sbjct  180  EREKLDGMYECILCACCSTSCP  201



>ref|XP_003547685.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Glycine max]
Length=279

 Score =   318 bits (814),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 175/204 (86%), Gaps = 8/204 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENPQ  183
            MA+ L++RA  +V SSPA K+ + RAHASEA A    P+A  +  +K FQIYRW+PENP 
Sbjct  1    MATGLLKRAAQRVPSSPAFKLAILRAHASEAQAQQVEPKARETPTLKTFQIYRWNPENPS  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KPEL++Y+I+LKECGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNIDG NGLACL
Sbjct  61   KPELKDYQINLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACL  120

Query  364  TKISSGPDS---MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            TKI S  +S    +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKN PP+PGKE+LQS
Sbjct  121  TKIPSEKNSAATTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKN-PPVPGKEILQS  179

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            K +R KLDGMYECILCACCSTSCP
Sbjct  180  KKEREKLDGMYECILCACCSTSCP  203



>gb|EPS71789.1| succinate dehydrogenase, partial [Genlisea aurea]
Length=276

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 173/202 (86%), Gaps = 5/202 (2%)
 Frame = +1

Query  16   MASSLVRRAITKVSS-SPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENP  180
            MAS LVRRAI +  + +PA++  +AR HASEA A    P+A A +K K FQIYRW+P++P
Sbjct  1    MASGLVRRAICRAPALAPASRAVIARQHASEAEAQQVEPKARADSKPKTFQIYRWNPDSP  60

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
            QKPEL  YEI+LKECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+NGLAC
Sbjct  61   QKPELASYEINLKECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGRNGLAC  120

Query  361  LTKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKA  540
            LTKI S   +M+TPLPHM+VIKDLVVDMTNFYNQYKSIEPWLKRK+PP   GKE+ QSK 
Sbjct  121  LTKIPSDGLTMITPLPHMYVIKDLVVDMTNFYNQYKSIEPWLKRKSPPEEQGKEIRQSKE  180

Query  541  DRSKLDGMYECILCACCSTSCP  606
            DR KLDGMYECILCACCSTSCP
Sbjct  181  DRKKLDGMYECILCACCSTSCP  202



>gb|KJB76479.1| hypothetical protein B456_012G091400 [Gossypium raimondii]
Length=284

 Score =   317 bits (811),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 178/208 (86%), Gaps = 11/208 (5%)
 Frame = +1

Query  16   MASSLVRRAI---TKVSS---SPAAKMTLARAHASEANA----PQATASAKIKKFQIYRW  165
            MA+SL+RRA+   ++VSS   +PA++M + R +ASE  A    P+A AS  +K FQIYRW
Sbjct  1    MATSLIRRAMNMASRVSSPTVAPASRMVVVRPYASETEAQKVEPKAAASPNMKTFQIYRW  60

Query  166  SPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGK  345
            +P+NP KP+LQ+Y IDLKECGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNI+G 
Sbjct  61   NPDNPTKPQLQDYRIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNINGC  120

Query  346  NGLACLTKISSG-PDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKE  522
            NGLACLTKI SG  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP  GKE
Sbjct  121  NGLACLTKIESGSSETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPTAGKE  180

Query  523  VLQSKADRSKLDGMYECILCACCSTSCP  606
            + QSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  IPQSKKDRAKLDGMYECILCACCSTSCP  208



>ref|XP_007031724.1| Succinate dehydrogenase 2-2 [Theobroma cacao]
 gb|EOY02650.1| Succinate dehydrogenase 2-2 [Theobroma cacao]
Length=283

 Score =   313 bits (803),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 177/205 (86%), Gaps = 8/205 (4%)
 Frame = +1

Query  16   MASSLVRRAIT---KVSSS---PAAKMTLARAHASEANAPQA-TASAKIKKFQIYRWSPE  174
            MA++L+RRA++   +VSSS   PA ++ + R +ASEA A +   A+  +K FQIYRW+P+
Sbjct  1    MATTLIRRAMSMTSRVSSSTVAPALRLVVTRPYASEAEAEKGDAATTNMKTFQIYRWNPD  60

Query  175  NPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGL  354
            NP KP+LQ+Y+IDLKECGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNI+G NGL
Sbjct  61   NPSKPQLQDYKIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNINGCNGL  120

Query  355  ACLTKISSG-PDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQ  531
            ACLTKI SG  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP  GKE+ Q
Sbjct  121  ACLTKIESGSSETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPTAGKEIPQ  180

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            SK DR+KLDGMYECILCACCSTSCP
Sbjct  181  SKKDRAKLDGMYECILCACCSTSCP  205



>ref|XP_002268523.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
1, mitochondrial [Vitis vinifera]
Length=276

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 169/199 (85%), Gaps = 3/199 (2%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATA--SAKIKKFQIYRWSPENPQKP  189
            MA+ L+RR +++V    AAK+  +RAHA+ A + +  +  +  +K F IYRW+P+NP KP
Sbjct  1    MATGLLRRGMSRVPGQ-AAKLLRSRAHATGAQSSEVNSEVAKTLKTFSIYRWNPDNPSKP  59

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
            ELQ Y+I+LK+CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG NGLACLTK
Sbjct  60   ELQNYQINLKDCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGCNGLACLTK  119

Query  370  ISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
            I SG  S VTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK PPP PGKE+ QSK DR+
Sbjct  120  IPSGESSTVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPPPTPGKEIPQSKKDRA  179

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCSTSCP
Sbjct  180  KLDGMYECILCACCSTSCP  198



>ref|XP_006447204.1| hypothetical protein CICLE_v10016181mg [Citrus clementina]
 gb|ESR60444.1| hypothetical protein CICLE_v10016181mg [Citrus clementina]
Length=233

 Score =   309 bits (791),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 9/206 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAA----KMTLARAHASEANA----PQATASAKIKKFQIYRWSP  171
            MA+ L+RRAI+   ++ A     ++  AR HASEA A    P+A+A+ + KKFQIYRW+P
Sbjct  1    MATGLIRRAISSSHAAAAVAQPARLLTARLHASEAEAQKVEPKASANTETKKFQIYRWNP  60

Query  172  ENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNG  351
            ++P KPEL+E++I+LKECGPMVLDALIKIK+EIDP+LTFRRSCREGICGSCAMNIDG NG
Sbjct  61   DSPSKPELKEFKINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNG  120

Query  352  LACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVL  528
            LACLTKIS SG  S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP+PGKE+ 
Sbjct  121  LACLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIP  180

Query  529  QSKADRSKLDGMYECILCACCSTSCP  606
            QSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  QSKKDRAKLDGMYECILCACCSTSCP  206



>ref|XP_006447205.1| hypothetical protein CICLE_v10016181mg [Citrus clementina]
 ref|XP_006469942.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Citrus sinensis]
 gb|ESR60445.1| hypothetical protein CICLE_v10016181mg [Citrus clementina]
Length=282

 Score =   308 bits (790),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 9/206 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAA----KMTLARAHASEANA----PQATASAKIKKFQIYRWSP  171
            MA+ L+RRAI+   ++ A     ++  AR HASEA A    P+A+A+ + KKFQIYRW+P
Sbjct  1    MATGLIRRAISSSHAAAAVAQPARLLTARLHASEAEAQKVEPKASANTETKKFQIYRWNP  60

Query  172  ENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNG  351
            ++P KPEL+E++I+LKECGPMVLDALIKIK+EIDP+LTFRRSCREGICGSCAMNIDG NG
Sbjct  61   DSPSKPELKEFKINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNG  120

Query  352  LACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVL  528
            LACLTKIS SG  S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP+PGKE+ 
Sbjct  121  LACLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIP  180

Query  529  QSKADRSKLDGMYECILCACCSTSCP  606
            QSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  QSKKDRAKLDGMYECILCACCSTSCP  206



>ref|XP_010528199.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial [Tarenaya hassleriana]
Length=282

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 173/207 (84%), Gaps = 10/207 (5%)
 Frame = +1

Query  16   MASSLVRRAITKVSS--SPAAKMTLARAHASEANA----PQATAS---AKIKKFQIYRWS  168
            MAS L+ R +    +  S AA++  +R  ASE  A    P+A++    + +K FQIYRW+
Sbjct  1    MASGLIGRVVGAKPARLSVAARLIQSRWMASETEAQKVEPKASSGGGGSNVKTFQIYRWN  60

Query  169  PENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKN  348
            P+NP KP+LQ+Y+IDLKECGPMVLDALIKIKNEIDP++TFRRSCREGICGSCAMNIDG N
Sbjct  61   PDNPSKPQLQDYQIDLKECGPMVLDALIKIKNEIDPSITFRRSCREGICGSCAMNIDGCN  120

Query  349  GLACLTKISSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEV  525
            GLACLTKI SGP  + +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP +PGKE+
Sbjct  121  GLACLTKIQSGPSPTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPEVPGKEI  180

Query  526  LQSKADRSKLDGMYECILCACCSTSCP  606
            LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  LQSKKDRAKLDGMYECILCACCSTSCP  207



>gb|KJB11590.1| hypothetical protein B456_001G267500 [Gossypium raimondii]
Length=289

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 177/211 (84%), Gaps = 14/211 (7%)
 Frame = +1

Query  16   MASSLVRRAITKVSS------SPAAKMTLARAHASEANA----PQATASA---KIKKFQI  156
            MA++L+RRA+   S       +PA+++ L R +A+E  A    P+A++ +    +K FQI
Sbjct  1    MATNLIRRAMNMTSRFPSSTVAPASRLVLDRPYATETEAQKVEPKASSGSGGTSMKTFQI  60

Query  157  YRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNI  336
            YRW+P+NP KP+LQ+++IDLKECGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNI
Sbjct  61   YRWNPDNPTKPQLQDFKIDLKECGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNI  120

Query  337  DGKNGLACLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIP  513
            +G NGLACLTKI SGP ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP  
Sbjct  121  NGCNGLACLTKIESGPSETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPTA  180

Query  514  GKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            GKE+ QSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  GKEIPQSKKDRAKLDGMYECILCACCSTSCP  211



>gb|KHG24377.1| Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial 
-like protein [Gossypium arboreum]
Length=231

 Score =   304 bits (778),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 179/211 (85%), Gaps = 14/211 (7%)
 Frame = +1

Query  16   MASSLVRRAIT---KVSSS---PAAKMTLARAHASEANA----PQATAS---AKIKKFQI  156
            MA++L+RRA+    ++ SS   PA+++ L R +A+E  A    P+A++    A +K FQI
Sbjct  1    MATNLIRRAMNMTPRLPSSKVAPASRLVLDRPYATETEAQKVEPKASSGSGGANMKTFQI  60

Query  157  YRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNI  336
            YRW+P+NP KP+LQ+++I+LKECGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNI
Sbjct  61   YRWNPDNPTKPQLQDFKINLKECGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNI  120

Query  337  DGKNGLACLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIP  513
            +G NGLACLTKI SGP ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP  
Sbjct  121  NGCNGLACLTKIESGPSETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPAA  180

Query  514  GKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            GKE+ QSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  GKEIPQSKKDRAKLDGMYECILCACCSTSCP  211



>ref|XP_010689037.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Beta vulgaris subsp. vulgaris]
Length=270

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 164/198 (83%), Gaps = 3/198 (2%)
 Frame = +1

Query  16   MASSLVRRAITKVS-SSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQKPE  192
            MA+ L+RR  T  S +SP +K+ L+R HA++    +++    +K F IYRW+P+ P KPE
Sbjct  1    MATRLLRRTSTSTSIASPLSKLLLSRLHATDT--AKSSPVTSMKTFSIYRWNPDQPSKPE  58

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            L+ YEI+LKECGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLACLTKI
Sbjct  59   LKNYEINLKECGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKI  118

Query  373  SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSK  552
             S   SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKN    PGKE LQSK DR K
Sbjct  119  ESTGTSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNEAATPGKEYLQSKEDRKK  178

Query  553  LDGMYECILCACCSTSCP  606
            LDGMYECILCACCSTSCP
Sbjct  179  LDGMYECILCACCSTSCP  196



>ref|NP_198881.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2 [Arabidopsis 
thaliana]
 sp|Q8LB02.2|SDHB2_ARATH RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur 
subunit 2, mitochondrial; AltName: Full=Iron-sulfur subunit 
of complex II; Short=Ip; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08537.1| succinate dehydrogenase iron-protein subunit [Arabidopsis thaliana]
 gb|AAL66996.1| putative succinate dehydrogenase iron-protein subunit [Arabidopsis 
thaliana]
 gb|AAM67569.1| putative succinate dehydrogenase iron-protein subunit [Arabidopsis 
thaliana]
 gb|AED94578.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2 [Arabidopsis 
thaliana]
Length=280

 Score =   302 bits (774),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 170/204 (83%), Gaps = 7/204 (3%)
 Frame = +1

Query  16   MASSLVRRAITKVSS--SPAAKMTLAR--AHASEANAPQATAS--AKIKKFQIYRWSPEN  177
            MA  L+ R +   SS  S AA++  AR  +  SEA +  +T    A +K FQIYRW+P+N
Sbjct  1    MAFGLIGRVVGTKSSRLSTAARLIPARWTSTGSEAQSKASTGGGGASLKTFQIYRWNPDN  60

Query  178  PQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
            P KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLA
Sbjct  61   PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA  120

Query  358  CLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            CLTKI SG  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP  +PGKE+LQS
Sbjct  121  CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS  180

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            K DR+KLDGMYECILCACCSTSCP
Sbjct  181  KKDRAKLDGMYECILCACCSTSCP  204



>ref|XP_006405448.1| hypothetical protein EUTSA_v10027879mg [Eutrema salsugineum]
 gb|ESQ46901.1| hypothetical protein EUTSA_v10027879mg [Eutrema salsugineum]
Length=281

 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 168/205 (82%), Gaps = 8/205 (4%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLARAHASEANA-----PQATASAKIKKFQIYRWSPE  174
            MA  L+RR + TK S  S AA++  AR   S   A     P     A +K FQIYRW+P+
Sbjct  1    MAFGLIRRVVGTKPSRLSTAAQLIPARLTGSGPEAQTKASPGGGGGANLKTFQIYRWNPD  60

Query  175  NPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGL  354
            NP KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGL
Sbjct  61   NPGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGL  120

Query  355  ACLTKISSG-PDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQ  531
            ACLTKI SG  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP  +PGKE+LQ
Sbjct  121  ACLTKIESGSSETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQ  180

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            SK DR+KLDGMYECILCACCSTSCP
Sbjct  181  SKKDRAKLDGMYECILCACCSTSCP  205



>ref|XP_010927573.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Elaeis guineensis]
 ref|XP_010927574.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Elaeis guineensis]
 ref|XP_010927575.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Elaeis guineensis]
Length=285

 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = +1

Query  73   KMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALI  252
            ++  A+AH+S +  PQ+T + ++K F IYRW+P+NP KP+LQ YEIDL ECGPMVLDALI
Sbjct  32   RLVPAQAHSSHSE-PQSTKTKRMKTFSIYRWNPDNPSKPQLQHYEIDLAECGPMVLDALI  90

Query  253  KIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISS-GPDSMVTPLPHMFVIKD  429
            K+KNE+DP+LTFRRSCREGICGSCAMNIDG NGLACLTKISS G  + +TPLPHMFVIKD
Sbjct  91   KVKNEVDPSLTFRRSCREGICGSCAMNIDGDNGLACLTKISSAGSPTTITPLPHMFVIKD  150

Query  430  LVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            LVVDMTNFYNQYKS+EPWLKRK+PPP+PGKE+ QSK DR+KLDGMYECILCACCSTSCP
Sbjct  151  LVVDMTNFYNQYKSVEPWLKRKDPPPVPGKEIPQSKKDRAKLDGMYECILCACCSTSCP  209



>gb|AAM65047.1| succinate dehydrogenase iron-protein subunit-like [Arabidopsis 
thaliana]
Length=280

 Score =   300 bits (769),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 171/204 (84%), Gaps = 7/204 (3%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLAR--AHASEANAPQATAS--AKIKKFQIYRWSPEN  177
            MA  L+ R + TK S  S AA++  AR  +  SEA +  +T    A +K FQIYRW+P+N
Sbjct  1    MAFGLIGRVVGTKPSRLSTAARLIPARWTSKGSEAQSKASTGGGGASLKTFQIYRWNPDN  60

Query  178  PQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
            P KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLA
Sbjct  61   PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA  120

Query  358  CLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            CLTKI SG  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP  +PGKE+LQS
Sbjct  121  CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS  180

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            K DR+KLDGMYECILCACCSTSCP
Sbjct  181  KKDRAKLDGMYECILCACCSTSCP  204



>ref|XP_010514444.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
1, mitochondrial-like [Camelina sativa]
Length=279

 Score =   300 bits (768),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 170/205 (83%), Gaps = 8/205 (4%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLARAHASEANAPQATAS-----AKIKKFQIYRWSPE  174
            MAS L+ R + TK S  + AA++  AR  +S A A    +S     +K+K FQIYRW+P+
Sbjct  1    MASGLIGRLVGTKPSRLTTAARLIPARWTSSGAEAETKASSGGGRESKLKNFQIYRWNPD  60

Query  175  NPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGL  354
            NP KPELQ Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGL
Sbjct  61   NPGKPELQNYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGL  120

Query  355  ACLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQ  531
            ACLTKI  G  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK PP +PGKE+LQ
Sbjct  121  ACLTKIQDGASETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPPSVPGKEILQ  180

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            SK DR+KLDGMYECILCACCSTSCP
Sbjct  181  SKKDRAKLDGMYECILCACCSTSCP  205



>ref|XP_002870688.1| succinate dehydrogenase 2-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46947.1| succinate dehydrogenase 2-2 [Arabidopsis lyrata subsp. lyrata]
Length=280

 Score =   300 bits (767),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 168/204 (82%), Gaps = 7/204 (3%)
 Frame = +1

Query  16   MASSLVRRAITKVSSS--PAAKMTLAR--AHASEANAPQATAS--AKIKKFQIYRWSPEN  177
            M   L+ R +   SS    AA++  AR  +  SEA +  +T    A +K FQIYRW+P+N
Sbjct  1    MTFGLIGRVVGTKSSRLYTAARLIPARWTSTGSEAQSKASTGGGGASLKTFQIYRWNPDN  60

Query  178  PQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
            P KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLA
Sbjct  61   PGKPELQDYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA  120

Query  358  CLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            CLTKI SG  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP  +PGKE+LQS
Sbjct  121  CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS  180

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            K DR+KLDGMYECILCACCSTSCP
Sbjct  181  KKDRAKLDGMYECILCACCSTSCP  204



>ref|XP_010450634.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial [Camelina sativa]
Length=280

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 168/204 (82%), Gaps = 7/204 (3%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLAR----AHASEANAPQATASAKIKKFQIYRWSPEN  177
            MA  L+ R + TK S  S AA++  AR       +++ A      A +K FQIYRW+P+N
Sbjct  1    MAFGLIGRVVGTKPSRLSTAARLIPARWTSTGSEAQSKASSGGGGANLKTFQIYRWNPDN  60

Query  178  PQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
            P KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLA
Sbjct  61   PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA  120

Query  358  CLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            CLTKI SG  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP  +PGKE+LQS
Sbjct  121  CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS  180

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            K DR+KLDGMYECILCACCSTSCP
Sbjct  181  KKDRAKLDGMYECILCACCSTSCP  204



>ref|XP_010425489.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
1, mitochondrial [Camelina sativa]
Length=279

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 170/205 (83%), Gaps = 8/205 (4%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLARAHASEANAPQATAS-----AKIKKFQIYRWSPE  174
            MAS L+ R + TK S  + AA++  AR  ++ A A    +S     +K+K FQIYRW+P+
Sbjct  1    MASGLIGRLVGTKPSRLTTAARLIPARWTSTGAEAETKASSGGGRESKLKNFQIYRWNPD  60

Query  175  NPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGL  354
            NP KPELQ Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGL
Sbjct  61   NPGKPELQNYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGL  120

Query  355  ACLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQ  531
            ACLTKI  G  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK PP +PGKE+LQ
Sbjct  121  ACLTKIQDGASETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPPSVPGKEILQ  180

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            SK DR+KLDGMYECILCACCSTSCP
Sbjct  181  SKKDRAKLDGMYECILCACCSTSCP  205



>ref|XP_006282691.1| hypothetical protein CARUB_v10005447mg [Capsella rubella]
 gb|EOA15589.1| hypothetical protein CARUB_v10005447mg [Capsella rubella]
Length=280

 Score =   298 bits (762),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 167/204 (82%), Gaps = 7/204 (3%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLAR----AHASEANAPQATASAKIKKFQIYRWSPEN  177
            MA  L+ R + TK S  S A ++  AR       +++ A      A +K FQIYRW+P+N
Sbjct  1    MAFGLIGRVVGTKPSRLSAAVRLIPARWTSTGSEAQSKASSGGGGANLKTFQIYRWNPDN  60

Query  178  PQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
            P KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLA
Sbjct  61   PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA  120

Query  358  CLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            CLTKI SG  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP  +PGKE+LQS
Sbjct  121  CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS  180

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            K DR+KLDGMYECILCACCSTSCP
Sbjct  181  KKDRAKLDGMYECILCACCSTSCP  204



>emb|CAC19856.1| mitochondrial succinate dehydrogenase iron-sulphur subunit [Arabidopsis 
thaliana]
Length=280

 Score =   298 bits (762),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 170/204 (83%), Gaps = 7/204 (3%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLAR--AHASEANAPQATAS--AKIKKFQIYRWSPEN  177
            MA  L+ R + TK S  S AA++  AR  +  SEA +  +T    A +K FQIYRW+P+N
Sbjct  1    MAFGLIGRVVGTKPSRLSTAARLIPARWTSKGSEAQSKASTGGGGASLKTFQIYRWNPDN  60

Query  178  PQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
            P KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLA
Sbjct  61   PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA  120

Query  358  CLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            CLTKI  G  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP  +PGKE+LQS
Sbjct  121  CLTKIEFGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS  180

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            K DR+KLDGMYECILCACCSTSCP
Sbjct  181  KKDRAKLDGMYECILCACCSTSCP  204



>ref|XP_006395448.1| hypothetical protein EUTSA_v10004747mg [Eutrema salsugineum]
 dbj|BAJ34353.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ32734.1| hypothetical protein EUTSA_v10004747mg [Eutrema salsugineum]
Length=279

 Score =   297 bits (761),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 173/205 (84%), Gaps = 8/205 (4%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLARAHASEANA-PQATASA----KIKKFQIYRWSPE  174
            MAS L+ R + TK S  + AA++  AR  AS + A P+A++      K+K FQIYRW+P+
Sbjct  1    MASGLIGRLVGTKPSRLTTAARLIPARCTASGSEAEPKASSGGGGGSKLKTFQIYRWNPD  60

Query  175  NPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGL  354
            NP KP+LQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGL
Sbjct  61   NPGKPQLQDYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGL  120

Query  355  ACLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQ  531
            ACLTKI  G  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP  PGKE+LQ
Sbjct  121  ACLTKIQDGASETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPSEPGKEILQ  180

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            SK DR+KLDGMYECILCACCSTSCP
Sbjct  181  SKKDRAKLDGMYECILCACCSTSCP  205



>ref|XP_010436005.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Camelina sativa]
Length=280

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 169/204 (83%), Gaps = 7/204 (3%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLARAHASEANAPQATAS----AKIKKFQIYRWSPEN  177
            MA  L+ R + TK S  S AA++  AR  ++ + A    +S    A +K FQIYRW+P+N
Sbjct  1    MAFGLIGRVVGTKPSRLSTAARLIPARWTSTRSEAQSKASSGGGGANLKTFQIYRWNPDN  60

Query  178  PQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
            P KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLA
Sbjct  61   PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA  120

Query  358  CLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            CLTKI SG  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK P  +PGKE+LQS
Sbjct  121  CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPASVPGKEILQS  180

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            K DR+KLDGMYECILCACCSTSCP
Sbjct  181  KKDRAKLDGMYECILCACCSTSCP  204



>ref|XP_006291631.1| hypothetical protein CARUB_v10017784mg [Capsella rubella]
 gb|EOA24529.1| hypothetical protein CARUB_v10017784mg [Capsella rubella]
Length=282

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 170/208 (82%), Gaps = 11/208 (5%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLARAHASEANAP--------QATASAKIKKFQIYRW  165
            MAS L+ R + TK S  + AA++  AR  ++ A A          A   +K+K FQIYRW
Sbjct  1    MASGLIGRLVGTKPSRLTTAARLMPARWTSTGAEAETKASSGGGGAGKDSKLKTFQIYRW  60

Query  166  SPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGK  345
            +P+NP KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG 
Sbjct  61   NPDNPGKPELQDYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGC  120

Query  346  NGLACLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKE  522
            NGLACLTKI  G  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK PP +PGKE
Sbjct  121  NGLACLTKIQDGASETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPPSVPGKE  180

Query  523  VLQSKADRSKLDGMYECILCACCSTSCP  606
            +LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  ILQSKKDRAKLDGMYECILCACCSTSCP  208



>ref|XP_009125153.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial [Brassica rapa]
Length=267

 Score =   295 bits (756),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 166/199 (83%), Gaps = 8/199 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQKPEL  195
            MAS LV R +   + S AA++  +R  +S     +A   AK+K FQIYRW+P++P KPEL
Sbjct  1    MASGLVGRVVG-TNPSRAARLIPSRWTSS-----KAVVGAKLKTFQIYRWNPDSPGKPEL  54

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLACLTKI 
Sbjct  55   QDYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKIE  114

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
              S  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK P  +PGKE+LQSK DR+
Sbjct  115  SESSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPASVPGKEILQSKKDRA  174

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCSTSCP
Sbjct  175  KLDGMYECILCACCSTSCP  193



>ref|XP_010932282.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial [Elaeis guineensis]
Length=289

 Score =   295 bits (756),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 164/186 (88%), Gaps = 2/186 (1%)
 Frame = +1

Query  52   VSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGP  231
             +SS AA++  A+AH+S+++   +    ++K F IYRW+P++P KP+LQ+YEIDL ECGP
Sbjct  29   AASSAAARLVPAQAHSSQSSP-PSAQPKRMKTFSIYRWNPDDPTKPQLQKYEIDLAECGP  87

Query  232  MVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD-SMVTPLP  408
            MVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLACLTKISS    + +TPLP
Sbjct  88   MVLDALIKIKNEVDPSLTFRRSCREGICGSCAMNIDGDNGLACLTKISSAESPTTITPLP  147

Query  409  HMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCAC  588
            HMFVIKDLVVDMTNFYNQYKS+EPWLKRK+PPP+PGKE++QSK DR+KLDGMYECILCAC
Sbjct  148  HMFVIKDLVVDMTNFYNQYKSVEPWLKRKDPPPVPGKEIIQSKKDRAKLDGMYECILCAC  207

Query  589  CSTSCP  606
            CSTSCP
Sbjct  208  CSTSCP  213



>ref|XP_008799935.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial [Phoenix dactylifera]
Length=289

 Score =   295 bits (756),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 160/186 (86%), Gaps = 2/186 (1%)
 Frame = +1

Query  52   VSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGP  231
             +SS A+++  A+AH+S++  P A    +++ F IYRW+P++P KP+L  YEIDL ECGP
Sbjct  29   AASSTASRLVPAQAHSSQSEPPSAQPK-RMRTFSIYRWNPDDPSKPQLHNYEIDLAECGP  87

Query  232  MVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD-SMVTPLP  408
            MVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLACLTKI S    + VTPLP
Sbjct  88   MVLDALIKIKNEVDPSLTFRRSCREGICGSCAMNIDGDNGLACLTKIPSAESPTTVTPLP  147

Query  409  HMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCAC  588
            HMFVIKDLVVDMTNFYNQYKS+EPWLKRK+PPP+PGKE+ QSK DR+KLDGMYECILCAC
Sbjct  148  HMFVIKDLVVDMTNFYNQYKSVEPWLKRKDPPPVPGKEIPQSKKDRAKLDGMYECILCAC  207

Query  589  CSTSCP  606
            CSTSCP
Sbjct  208  CSTSCP  213



>ref|XP_002526944.1| succinate dehydrogenase, putative [Ricinus communis]
 gb|EEF35431.1| succinate dehydrogenase, putative [Ricinus communis]
Length=284

 Score =   295 bits (754),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 167/206 (81%), Gaps = 9/206 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTL----ARAHASEANA----PQATASAKIKKFQIYRWSP  171
            MA+ L+R+ ++    S  A  T      R HASEA A    P+A+++A +K FQIYRW+P
Sbjct  1    MATGLLRKGLSIARVSKTAPFTSRLIPTRFHASEAEAQKVEPKASSTASLKTFQIYRWNP  60

Query  172  ENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNG  351
            +NP KP LQ+Y+IDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG NG
Sbjct  61   DNPSKPTLQDYKIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNG  120

Query  352  LACL-TKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVL  528
            LACL    S    S +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP+ GKE+ 
Sbjct  121  LACLTKISSGSTSSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPVDGKEIP  180

Query  529  QSKADRSKLDGMYECILCACCSTSCP  606
            QSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  QSKKDRAKLDGMYECILCACCSTSCP  206



>ref|XP_008230465.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial [Prunus mume]
Length=287

 Score =   295 bits (754),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 166/208 (80%), Gaps = 13/208 (6%)
 Frame = +1

Query  22   SSLVRRAIT------KVSSSPAAKMTLARAHASEANAPQATASAK----IKKFQIYRWSP  171
            + L+RRAI         S++ + +  + R  ASE  A Q    A+    +K F IYRW+P
Sbjct  2    AGLIRRAIAAGVSSASRSTAASFRYVVVRGMASEVQAQQVDLKAQDKTSLKTFSIYRWNP  61

Query  172  ENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNG  351
            ENP+KPEL+EYEIDLKECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG NG
Sbjct  62   ENPKKPELREYEIDLKECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGCNG  121

Query  352  LACLTKI---SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKE  522
            LACLTKI   SS   + +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+PP  PGKE
Sbjct  122  LACLTKIAPSSSVGATTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPPTEPGKE  181

Query  523  VLQSKADRSKLDGMYECILCACCSTSCP  606
            + QSK DR+KLDGMYECILCACCSTSCP
Sbjct  182  IRQSKKDRAKLDGMYECILCACCSTSCP  209



>ref|XP_011045237.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial [Populus euphratica]
Length=285

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +1

Query  124  TASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCR  303
            T    +K FQIYRW+P+NP KPELQ YEIDL +CGPMVLDALIKIKNEIDPTLTFRRSCR
Sbjct  49   TQPQHLKTFQIYRWNPDNPTKPELQNYEIDLNKCGPMVLDALIKIKNEIDPTLTFRRSCR  108

Query  304  EGICGSCAMNIDGKNGLACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEP  480
            EGICGSCAMN+DG NGLACLTKI  SGP +M+ PLPHMFVIKDLVVDMTNFYNQYKSIEP
Sbjct  109  EGICGSCAMNMDGCNGLACLTKIDKSGPATMINPLPHMFVIKDLVVDMTNFYNQYKSIEP  168

Query  481  WLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            WLKRKNPPP+ GKE+LQ+K DR+KLDGMYECILCACCSTSCP
Sbjct  169  WLKRKNPPPVKGKEILQTKKDRAKLDGMYECILCACCSTSCP  210



>ref|XP_008797193.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Phoenix dactylifera]
Length=288

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = +1

Query  73   KMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALI  252
            ++  A+AH+S++  PQ+T   ++K F IYRW+P++  KPELQ YEIDL +CGPMVLDALI
Sbjct  35   RLVPAQAHSSQSE-PQSTKPKRMKTFSIYRWNPDDLSKPELQNYEIDLADCGPMVLDALI  93

Query  253  KIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISS-GPDSMVTPLPHMFVIKD  429
            KIKNE+DP+LTFRRSCREGICGSCAMN+DG NGLACLTKISS G  + +TPLPHMFV+KD
Sbjct  94   KIKNEVDPSLTFRRSCREGICGSCAMNMDGDNGLACLTKISSAGSPTTITPLPHMFVVKD  153

Query  430  LVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            LVVDMTNFYNQYKS+EPWLKRK+PPP+PGKE+ QSK DR+KLDGMYECILCACCSTSCP
Sbjct  154  LVVDMTNFYNQYKSVEPWLKRKDPPPVPGKEIPQSKKDRAKLDGMYECILCACCSTSCP  212



>ref|XP_002298583.1| succinate dehydrogenase iron-sulfur protein subunit [Populus 
trichocarpa]
 gb|EEE83388.1| succinate dehydrogenase iron-sulfur protein subunit [Populus 
trichocarpa]
Length=285

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = +1

Query  124  TASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCR  303
            T    +K FQIYRW+P+NP KPELQ YE+DL +CGPMVLDALIKIKNEIDPTLTFRRSCR
Sbjct  49   TQPQHLKTFQIYRWNPDNPTKPELQNYEVDLNKCGPMVLDALIKIKNEIDPTLTFRRSCR  108

Query  304  EGICGSCAMNIDGKNGLACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEP  480
            EGICGSCAMN+DG NGLACLTKI  SGP SM+ PLPHMFVIKDLVVDMTNFYNQYKSIEP
Sbjct  109  EGICGSCAMNMDGCNGLACLTKIDKSGPPSMINPLPHMFVIKDLVVDMTNFYNQYKSIEP  168

Query  481  WLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            WLKRKNPPP+ GKE+LQ+K DR+KLDGMYECILCACCSTSCP
Sbjct  169  WLKRKNPPPVKGKEILQTKKDRAKLDGMYECILCACCSTSCP  210



>emb|CDX83688.1| BnaC07g24280D [Brassica napus]
Length=279

 Score =   293 bits (750),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 169/206 (82%), Gaps = 10/206 (5%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLARAHASEANAPQATASA------KIKKFQIYRWSP  171
            M+S L+ R + TK S  + AA++  +R  AS    P+  AS+        K FQIYRW+P
Sbjct  1    MSSGLIGRLVRTKPSRLTTAARLIPSRCTAS-VTEPEPKASSGGGKPSNFKTFQIYRWNP  59

Query  172  ENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNG  351
            +NP KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NG
Sbjct  60   DNPSKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNG  119

Query  352  LACLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVL  528
            LACLTKI  G  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP  PGKE+L
Sbjct  120  LACLTKIEEGAKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPSEPGKEIL  179

Query  529  QSKADRSKLDGMYECILCACCSTSCP  606
            QSK DR+KLDGMYECILCACCSTSCP
Sbjct  180  QSKKDRAKLDGMYECILCACCSTSCP  205



>ref|XP_010441224.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Camelina sativa]
Length=280

 Score =   293 bits (750),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 165/204 (81%), Gaps = 7/204 (3%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLAR----AHASEANAPQATASAKIKKFQIYRWSPEN  177
            MA  L+ R + TK S  S AA++  AR       +++ A        +K FQIYRW+P+N
Sbjct  1    MAFGLIGRVVGTKPSRLSTAARLIPARWTSTGSEAQSKASSGGGGENLKTFQIYRWNPDN  60

Query  178  PQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
            P KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGLA
Sbjct  61   PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA  120

Query  358  CLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            CLTKI  G  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK P  +PGKE+LQS
Sbjct  121  CLTKIECGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPASVPGKEILQS  180

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            K DR+KLDGMYECILCACCSTSCP
Sbjct  181  KKDRAKLDGMYECILCACCSTSCP  204



>ref|XP_009382912.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=283

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 160/189 (85%), Gaps = 3/189 (2%)
 Frame = +1

Query  46   TKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQKPELQEYEIDLKEC  225
            T    + AA+   A+ H+S++++  A+   + K F IYRW+P+ P+KP+LQ YEIDL EC
Sbjct  21   THAPETTAARFLQAQHHSSQSDS-AASKPKRTKTFSIYRWNPDQPEKPQLQSYEIDLGEC  79

Query  226  GPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVT  399
            GPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNIDG NGLACLTKI  SS   + +T
Sbjct  80   GPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGDNGLACLTKIPSSSAAATTIT  139

Query  400  PLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECIL  579
            PLPHM+V+KDLVVDMTNFY+QYKS+EPWLKRK+PPPIPGKEV QSK DR+KLDGMYECIL
Sbjct  140  PLPHMYVVKDLVVDMTNFYSQYKSVEPWLKRKDPPPIPGKEVPQSKKDRAKLDGMYECIL  199

Query  580  CACCSTSCP  606
            CACCST+CP
Sbjct  200  CACCSTACP  208



>ref|XP_009340851.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
1, mitochondrial-like [Pyrus x bretschneideri]
Length=285

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 167/209 (80%), Gaps = 12/209 (6%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAA-----KMTLARAHASEANAPQATASAK----IKKFQIYRWS  168
            MA+ L+RRAI   +SS +      +    RA ASEA A Q    A+    IK F IYRW+
Sbjct  1    MATGLIRRAIASAASSGSTAAASFRYVCVRAMASEAQAQQVDLKARDKTDIKTFSIYRWN  60

Query  169  PENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKN  348
            P+NP+KPEL+EYEIDLKECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N
Sbjct  61   PDNPKKPELKEYEIDLKECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGCN  120

Query  349  GLACLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP-IPGK  519
            GLACLTKI  S    SM+TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK P   + GK
Sbjct  121  GLACLTKIAPSEAGASMITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPAAELDGK  180

Query  520  EVLQSKADRSKLDGMYECILCACCSTSCP  606
            E+ QSK DRSKLDGMYECILCACCSTSCP
Sbjct  181  EIKQSKKDRSKLDGMYECILCACCSTSCP  209



>ref|XP_010554967.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Tarenaya hassleriana]
Length=554

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 173/207 (84%), Gaps = 10/207 (5%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLARAHASEANA----PQAT---ASAKIKKFQIYRWS  168
            MAS  + RA+ TK +  S AA++  +R  ASE  A    P+A      +K+K FQIYRW+
Sbjct  1    MASGSIGRAVGTKPARLSAAARLIQSRWMASETEAQKVEPKAATGGGGSKMKTFQIYRWN  60

Query  169  PENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKN  348
            P+NP KP+L++Y+IDLKECGPMVLDALIKIKNEIDP++TFRRSCREGICGSCAMNIDG N
Sbjct  61   PDNPSKPQLEDYQIDLKECGPMVLDALIKIKNEIDPSITFRRSCREGICGSCAMNIDGCN  120

Query  349  GLACLTKISSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEV  525
            GLACLTKI SG   + +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+PP +PGKE+
Sbjct  121  GLACLTKIESGSSPTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPPEVPGKEI  180

Query  526  LQSKADRSKLDGMYECILCACCSTSCP  606
            LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  LQSKKDRAKLDGMYECILCACCSTSCP  207


 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 164/195 (84%), Gaps = 8/195 (4%)
 Frame = +1

Query  46   TKVSSSPAAKMTLARAHASEANA----PQAT---ASAKIKKFQIYRWSPENPQKPELQEY  204
             K   S AA++  +R  ASE  A    P+A      +K+K FQIYRW+P+NP KP+L++Y
Sbjct  285  NKTWLSAAARLIQSRWMASETEAQKVEPKAATGGGGSKMKTFQIYRWNPDNPSKPQLEDY  344

Query  205  EIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGP  384
            +IDLKECGPMVLDALIKIKNEIDP++TFRRSCREGICGSCAMNIDG NGLACLTKI SG 
Sbjct  345  QIDLKECGPMVLDALIKIKNEIDPSITFRRSCREGICGSCAMNIDGCNGLACLTKIESGS  404

Query  385  D-SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDG  561
              + +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+PP +PGKE+LQSK DR+KLDG
Sbjct  405  SPTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPPEVPGKEILQSKKDRAKLDG  464

Query  562  MYECILCACCSTSCP  606
            MYECILCACCSTSCP
Sbjct  465  MYECILCACCSTSCP  479



>ref|XP_009151968.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
1, mitochondrial-like [Brassica rapa]
Length=281

 Score =   291 bits (744),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 168/207 (81%), Gaps = 12/207 (6%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKI--------KKFQIYRWS  168
             +   LVR   +++++S  A++  +R  AS    P++ AS+ +        K FQIYRW+
Sbjct  4    GLIGRLVRTKPSRLTTS--ARLIPSRCTAS-VTEPESKASSGVGGGKASNFKTFQIYRWN  60

Query  169  PENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKN  348
            P+NP KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG N
Sbjct  61   PDNPSKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCN  120

Query  349  GLACLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEV  525
            GLACLTKI  G  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP   PGKE+
Sbjct  121  GLACLTKIEEGAKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASEPGKEI  180

Query  526  LQSKADRSKLDGMYECILCACCSTSCP  606
            LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  LQSKKDRAKLDGMYECILCACCSTSCP  207



>ref|XP_008348008.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Malus domestica]
 ref|XP_008365363.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Malus domestica]
Length=285

 Score =   291 bits (744),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 168/209 (80%), Gaps = 12/209 (6%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAA-----KMTLARAHASEANAPQATASAK----IKKFQIYRWS  168
            MA+ L+RRAI   +SS +      +    RA ASEA A Q    A+    IK F IYRW+
Sbjct  1    MATGLIRRAIASAASSGSTAAASFRYXCVRAMASEAQAQQVDLKARDKTDIKTFSIYRWN  60

Query  169  PENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKN  348
            P+NP+KPEL+EYEIDLKECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N
Sbjct  61   PDNPKKPELKEYEIDLKECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGCN  120

Query  349  GLACLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP-IPGK  519
            GLACLTKI  S    SM+TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+P   + GK
Sbjct  121  GLACLTKIAPSEAGASMITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPAAELDGK  180

Query  520  EVLQSKADRSKLDGMYECILCACCSTSCP  606
            E+ QSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  EIKQSKKDRAKLDGMYECILCACCSTSCP  209



>ref|XP_007215620.1| hypothetical protein PRUPE_ppa007934mg [Prunus persica]
 gb|EMJ16819.1| hypothetical protein PRUPE_ppa007934mg [Prunus persica]
Length=351

 Score =   293 bits (750),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 167/211 (79%), Gaps = 13/211 (6%)
 Frame = +1

Query  13   AMASSLVRRAIT------KVSSSPAAKMTLARAHASEANAPQATASAK----IKKFQIYR  162
            A  + L+RRAI         S++ + +  + R  ASE  A Q    A+    +K F IYR
Sbjct  63   ATMAGLIRRAIAAGVSSASRSTAASFRYVVVRGMASEVQAQQVDLKAQDKTSLKTFSIYR  122

Query  163  WSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG  342
            W+PENP+KPEL+EYEIDLKECGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG
Sbjct  123  WNPENPKKPELREYEIDLKECGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDG  182

Query  343  KNGLACLTKI---SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIP  513
             NGLACLTKI   SS   + +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+PP  P
Sbjct  183  CNGLACLTKIAPSSSVGATTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPPTEP  242

Query  514  GKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            GKE+ QSK DR+KLDGMYECILCACCSTSCP
Sbjct  243  GKEIRQSKKDRAKLDGMYECILCACCSTSCP  273



>ref|NP_189374.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1 [Arabidopsis 
thaliana]
 ref|NP_001118718.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1 [Arabidopsis 
thaliana]
 sp|Q8LBZ7.2|SDHB1_ARATH RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur 
subunit 1, mitochondrial; AltName: Full=Iron-sulfur subunit 
of complex II; Short=Ip; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA95713.1| succinate dehydrogenase iron-protein subunit [Arabidopsis thaliana]
 gb|AAK59518.1| putative succinate dehydrogenase iron-protein subunit [Arabidopsis 
thaliana]
 gb|AAL34227.1| putative succinate dehydrogenase iron-protein subunit [Arabidopsis 
thaliana]
 gb|AAX23852.1| hypothetical protein At3g27370 [Arabidopsis thaliana]
 gb|AEE77309.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1 [Arabidopsis 
thaliana]
 gb|AEE77310.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1 [Arabidopsis 
thaliana]
Length=279

 Score =   290 bits (743),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 166/205 (81%), Gaps = 8/205 (4%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLARAHASEANAPQATAS-----AKIKKFQIYRWSPE  174
            MAS L+ R + TK S  + AA++  AR  ++ A A    +S     + +K FQIYRW+P+
Sbjct  1    MASGLIGRLVGTKPSKLATAARLIPARWTSTGAEAETKASSGGGRGSNLKTFQIYRWNPD  60

Query  175  NPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGL  354
            NP KPELQ Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGL
Sbjct  61   NPGKPELQNYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGL  120

Query  355  ACLTKISS-GPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQ  531
            ACLTKI     ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK P  +P KE+LQ
Sbjct  121  ACLTKIQDEASETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPASVPAKEILQ  180

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            SK DR+KLDGMYECILCACCSTSCP
Sbjct  181  SKKDRAKLDGMYECILCACCSTSCP  205



>emb|CDY13709.1| BnaA06g32140D [Brassica napus]
Length=281

 Score =   290 bits (743),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 168/207 (81%), Gaps = 10/207 (5%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLARAHAS----EANAPQATASAK---IKKFQIYRWS  168
            M++ L+ R + TK S  + AA++  +R  AS    E+ +P      K    K FQIYRW+
Sbjct  1    MSTGLIGRLVRTKPSRLTTAARLIPSRFTASVTEPESKSPSGGGGGKASNFKTFQIYRWN  60

Query  169  PENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKN  348
            P+NP KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG N
Sbjct  61   PDNPSKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCN  120

Query  349  GLACLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEV  525
            GLACLTKI  G  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP   PGKE+
Sbjct  121  GLACLTKIEEGAKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASEPGKEI  180

Query  526  LQSKADRSKLDGMYECILCACCSTSCP  606
            LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  181  LQSKKDRAKLDGMYECILCACCSTSCP  207



>ref|XP_002877047.1| succinate dehydrogenase 2-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53306.1| succinate dehydrogenase 2-1 [Arabidopsis lyrata subsp. lyrata]
Length=279

 Score =   290 bits (742),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 167/205 (81%), Gaps = 8/205 (4%)
 Frame = +1

Query  16   MASSLVRRAI-TKVSS-SPAAKMTLARAHASEANAPQATAS-----AKIKKFQIYRWSPE  174
            MAS L+ R + TK S  + AA++  AR  ++ A A    +S     + +K FQIYRW+P+
Sbjct  1    MASGLIGRLVGTKPSKLATAARLIPARWTSTGAEAETKASSGGGRGSNLKTFQIYRWNPD  60

Query  175  NPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGL  354
            NP KPEL++Y++DLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG NGL
Sbjct  61   NPGKPELKDYQVDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGL  120

Query  355  ACLTKISSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQ  531
            ACLTKI  G   + +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK P  +P KE+LQ
Sbjct  121  ACLTKIEDGSSGTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPASVPAKEILQ  180

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            SK DR+KLDGMYECILCACCSTSCP
Sbjct  181  SKKDRAKLDGMYECILCACCSTSCP  205



>emb|CAC19855.1| mitochondrial succinate dehydrogenase iron-sulphur subunit [Arabidopsis 
thaliana]
Length=279

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 163/208 (78%), Gaps = 14/208 (7%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLAR-------AHASEANAPQATASAK---IKKFQIYRW  165
            MAS L+ R    V + P+   T+AR       +  +EA    ++   +   +K FQIYRW
Sbjct  1    MASGLIGRL---VGTKPSKLATVARLIPVRWTSTGAEAETKASSGGGRGSNLKTFQIYRW  57

Query  166  SPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGK  345
            +P+NP KPELQ Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG 
Sbjct  58   NPDNPGKPELQNYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGC  117

Query  346  NGLACLTKISS-GPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKE  522
            NGLACLTKI     ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK P  +P KE
Sbjct  118  NGLACLTKIQDEASETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPASVPAKE  177

Query  523  VLQSKADRSKLDGMYECILCACCSTSCP  606
            +LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  178  ILQSKKDRAKLDGMYECILCACCSTSCP  205



>gb|KCW50658.1| hypothetical protein EUGRSUZ_J00347 [Eucalyptus grandis]
Length=375

 Score =   291 bits (744),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +1

Query  106  ANAPQATASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLT  285
            A  P+A  +  +K F IYRW+P++P KP+L++Y+IDLKECGPMVLDALIKIKNEIDP+LT
Sbjct  132  AVEPKAKPTTSLKTFSIYRWTPDSPSKPKLKDYQIDLKECGPMVLDALIKIKNEIDPSLT  191

Query  286  FRRSCREGICGSCAMNIDGKNGLACLTKISSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQ  462
            FRRSCREGICGSCAMNIDG NGLACLTKI  G D S +TPLPHMFVIKDLVVDMTNFYNQ
Sbjct  192  FRRSCREGICGSCAMNIDGCNGLACLTKIPDGADASTITPLPHMFVIKDLVVDMTNFYNQ  251

Query  463  YKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            YKSIEPWLKRKNPP  PGKE+LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  252  YKSIEPWLKRKNPPSEPGKEILQSKKDRAKLDGMYECILCACCSTSCP  299



>ref|XP_009370320.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial [Pyrus x bretschneideri]
 ref|XP_009371724.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Pyrus x bretschneideri]
Length=283

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 154/185 (83%), Gaps = 7/185 (4%)
 Frame = +1

Query  73   KMTLARAHASEANAPQATASAK----IKKFQIYRWSPENPQKPELQEYEIDLKECGPMVL  240
            +    R  ASEA A Q    A+    +K F IYRW+P+NP+KPEL+EYEIDLKECGPMVL
Sbjct  23   RYVCVRTMASEAQAQQVDLKARDKTDVKTFSIYRWNPDNPKKPELKEYEIDLKECGPMVL  82

Query  241  DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHM  414
            DALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG NGLACLTKI  S+   +M+TPLPHM
Sbjct  83   DALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGCNGLACLTKIAPSNAGATMITPLPHM  142

Query  415  FVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP-IPGKEVLQSKADRSKLDGMYECILCACC  591
            FVIKDLVVDMTNFYNQYKSIEPWLKRK P   + GKE+ QSK DR+KLDGMYECILCACC
Sbjct  143  FVIKDLVVDMTNFYNQYKSIEPWLKRKTPAAELDGKEIRQSKKDRAKLDGMYECILCACC  202

Query  592  STSCP  606
            STSCP
Sbjct  203  STSCP  207



>ref|XP_010034172.1| PREDICTED: uncharacterized protein LOC104423370 [Eucalyptus grandis]
Length=542

 Score =   293 bits (750),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +1

Query  106  ANAPQATASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLT  285
            A  P+A  +  +K F IYRW+P++P KP+L++Y+IDLKECGPMVLDALIKIKNEIDP+LT
Sbjct  299  AVEPKAKPTTSLKTFSIYRWTPDSPSKPKLKDYQIDLKECGPMVLDALIKIKNEIDPSLT  358

Query  286  FRRSCREGICGSCAMNIDGKNGLACLTKISSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQ  462
            FRRSCREGICGSCAMNIDG NGLACLTKI  G D S +TPLPHMFVIKDLVVDMTNFYNQ
Sbjct  359  FRRSCREGICGSCAMNIDGCNGLACLTKIPDGADASTITPLPHMFVIKDLVVDMTNFYNQ  418

Query  463  YKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            YKSIEPWLKRKNPP  PGKE+LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  419  YKSIEPWLKRKNPPSEPGKEILQSKKDRAKLDGMYECILCACCSTSCP  466



>gb|AAM63946.1| succinate dehydrogenase iron-protein subunit, putative [Arabidopsis 
thaliana]
Length=279

 Score =   285 bits (728),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 162/208 (78%), Gaps = 14/208 (7%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLAR-------AHASEANAPQATASAK---IKKFQIYRW  165
            MAS L+ R    V + P+   T+AR       +  +EA    ++   +   +K FQIYRW
Sbjct  1    MASGLIGRL---VGTKPSKLATVARLIPVRWTSTGAEAETKASSGGGRGSNLKTFQIYRW  57

Query  166  SPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGK  345
            +P+NP KPELQ Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG 
Sbjct  58   NPDNPGKPELQNYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGC  117

Query  346  NGLACLTKISS-GPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKE  522
            NGLACLTKI     ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK P  +P KE
Sbjct  118  NGLACLTKIQDEASETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPASVPAKE  177

Query  523  VLQSKADRSKLDGMYECILCACCSTSCP  606
            +LQSK DR+KLDGMYECILCAC STSCP
Sbjct  178  ILQSKKDRAKLDGMYECILCACFSTSCP  205



>ref|XP_008379173.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Malus domestica]
 ref|XP_008341359.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like [Malus domestica]
Length=283

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 153/185 (83%), Gaps = 7/185 (4%)
 Frame = +1

Query  73   KMTLARAHASEANAPQATASAK----IKKFQIYRWSPENPQKPELQEYEIDLKECGPMVL  240
            +    R  ASEA A Q    A+    +K F IYRW+P+NP+KPEL+EYEIDLK+CGPMVL
Sbjct  23   RYVCVRTMASEAQAQQVDLKARDKTDVKTFSIYRWNPDNPKKPELKEYEIDLKDCGPMVL  82

Query  241  DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHM  414
            DALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG NGLACLTKI  S    +M+TPLPHM
Sbjct  83   DALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGCNGLACLTKIAPSEAGATMITPLPHM  142

Query  415  FVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP-IPGKEVLQSKADRSKLDGMYECILCACC  591
            FVIKDLVVDMTNFYNQYKSIEPWLKRK P   + GKE+ QSK DR+KLDGMYECILCACC
Sbjct  143  FVIKDLVVDMTNFYNQYKSIEPWLKRKTPAAELDGKEIRQSKKDRAKLDGMYECILCACC  202

Query  592  STSCP  606
            STSCP
Sbjct  203  STSCP  207



>ref|XP_009111569.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
1, mitochondrial [Brassica rapa]
Length=279

 Score =   283 bits (724),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 161/208 (77%), Gaps = 14/208 (7%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQA----------TASAKIKKFQIYRW  165
            MAS L+ R    V + PA   + AR   S   +                + +K FQIYRW
Sbjct  1    MASGLIGRL---VRTKPAKLTSTARLIPSRCTSSATESKPSSSGGGGRGSNLKTFQIYRW  57

Query  166  SPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGK  345
            +P++P KPELQ+Y+IDLK+CGPMVLDALIKIKNE+DP+LTFRRSCREGICGSCAMNIDG 
Sbjct  58   NPDSPGKPELQDYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGC  117

Query  346  NGLACLTKISSGP-DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKE  522
            NGLACLTKI  G  ++ +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+P   PGKE
Sbjct  118  NGLACLTKIEDGAKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPASEPGKE  177

Query  523  VLQSKADRSKLDGMYECILCACCSTSCP  606
            +LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  178  ILQSKKDRAKLDGMYECILCACCSTSCP  205



>ref|XP_009129421.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
1, mitochondrial-like [Brassica rapa]
 emb|CDY34152.1| BnaA02g28880D [Brassica napus]
Length=281

 Score =   280 bits (716),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 164/210 (78%), Gaps = 16/210 (8%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASE--ANAPQATAS--------AKIKKFQIYRW  165
            MAS L+ +    V ++P+   T AR   S   A+APQ  +         + +K FQIYRW
Sbjct  1    MASGLIGKL---VRTNPSRLTTAARLIPSRCTASAPQPESKPSSNGGKPSNLKTFQIYRW  57

Query  166  SPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGK  345
            +P+NP KPELQ+Y+IDLK+CGPMVLDALIKIKNE DP+LTFRRSCREGICGSCAMNIDG 
Sbjct  58   NPDNPSKPELQDYQIDLKDCGPMVLDALIKIKNETDPSLTFRRSCREGICGSCAMNIDGC  117

Query  346  NGLACLTKISSGPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIP-G  516
            NGLACLTKI  G    + +TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRK+P     G
Sbjct  118  NGLACLTKIEEGAKETTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKSPASDEHG  177

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  178  KEILQSKKDRAKLDGMYECILCACCSTSCP  207



>ref|NP_001136531.1| uncharacterized protein LOC100216648 [Zea mays]
 gb|ACF82109.1| unknown [Zea mays]
 gb|AFW74396.1| (csu474(rpS14)), mRNA [Zea mays]
Length=281

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 165/203 (81%), Gaps = 7/203 (3%)
 Frame = +1

Query  19   ASSLVRR---AITKVSSSPAAKMTLARAHASEANAP--QATASAKIKKFQIYRWSPENPQ  183
            A++L+RR   A   +S + ++++  ++ H+S    P  +A  ++  K F IYRW P++P 
Sbjct  3    AAALLRRSPAARALLSPALSSRLVASKPHSSSPTQPPPEAKGASSTKTFSIYRWDPDSPS  62

Query  184  -KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
             KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICGSCAMNIDG NGLAC
Sbjct  63   TKPHLRDYQVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNIDGDNGLAC  122

Query  361  LTKISSGPDS-MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
            LTKISS   +  V+PLPHMFVIKDLVVDMTNFYNQYKS+EPWLKRK+PPP  GKEV Q+K
Sbjct  123  LTKISSASSASTVSPLPHMFVIKDLVVDMTNFYNQYKSVEPWLKRKDPPPQLGKEVPQTK  182

Query  538  ADRSKLDGMYECILCACCSTSCP  606
            ADR+KLDGMYECILCACCSTSCP
Sbjct  183  ADRAKLDGMYECILCACCSTSCP  205



>ref|XP_009384258.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
1, mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=289

 Score =   273 bits (699),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = +1

Query  85   ARAHASEANAPQATASAK-IKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIK  261
            A+ H+S+ ++  A A  K  K F IYRW+P++P+KP+LQ YEIDL ECGPMVLDALIKIK
Sbjct  39   AQPHSSQTDSAAAAAKPKRTKTFSIYRWNPDHPEKPQLQHYEIDLGECGPMVLDALIKIK  98

Query  262  NEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-SSGPDSMVTPLPHMFVIKDLVV  438
            NE+DP+LTFRRSCREGICGSCAMNIDG NGLACLTKI +S   + +TPLPHM+VIKDLVV
Sbjct  99   NEMDPSLTFRRSCREGICGSCAMNIDGDNGLACLTKIPASSAATTITPLPHMYVIKDLVV  158

Query  439  DMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            DMTNFYNQYKS+EPWLKRK+PPP P KE+ QSK DR+KLDGMYECILCACCSTSCP
Sbjct  159  DMTNFYNQYKSVEPWLKRKDPPPTPPKEIPQSKKDRAKLDGMYECILCACCSTSCP  214



>ref|XP_008647440.1| PREDICTED: uncharacterized protein LOC100216648 isoform X1 [Zea 
mays]
 gb|ACN33958.1| unknown [Zea mays]
 gb|AFW74397.1| hypothetical protein ZEAMMB73_659942 [Zea mays]
Length=350

 Score =   274 bits (701),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 165/203 (81%), Gaps = 7/203 (3%)
 Frame = +1

Query  19   ASSLVRR---AITKVSSSPAAKMTLARAHASEANAP--QATASAKIKKFQIYRWSPENPQ  183
            A++L+RR   A   +S + ++++  ++ H+S    P  +A  ++  K F IYRW P++P 
Sbjct  3    AAALLRRSPAARALLSPALSSRLVASKPHSSSPTQPPPEAKGASSTKTFSIYRWDPDSPS  62

Query  184  -KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
             KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICGSCAMNIDG NGLAC
Sbjct  63   TKPHLRDYQVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNIDGDNGLAC  122

Query  361  LTKISSGPDS-MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
            LTKISS   +  V+PLPHMFVIKDLVVDMTNFYNQYKS+EPWLKRK+PPP  GKEV Q+K
Sbjct  123  LTKISSASSASTVSPLPHMFVIKDLVVDMTNFYNQYKSVEPWLKRKDPPPQLGKEVPQTK  182

Query  538  ADRSKLDGMYECILCACCSTSCP  606
            ADR+KLDGMYECILCACCSTSCP
Sbjct  183  ADRAKLDGMYECILCACCSTSCP  205



>gb|ACG35757.1| succinate dehydrogenase iron-sulfur protein,mitochondrial precursor 
[Zea mays]
Length=282

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 160/210 (76%), Gaps = 20/210 (10%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATA-----------SAKIKKFQIYR  162
            MA++L+RR       SPAA+  L+ A +S   A +  +            +  K F IYR
Sbjct  1    MAAALLRR-------SPAARALLSPALSSRLVASKPHSSSPAPPPPAKADSSTKTFSIYR  53

Query  163  WSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNID  339
            W P++P  KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICGSCAMNID
Sbjct  54   WDPDSPSTKPHLKDYQVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNID  113

Query  340  GKNGLACLTKISSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPG  516
            G NGLACLTKIS     S V+PLPHMFV+KDLVVDMTNFY+QYKS+EPWLKRK+ PP  G
Sbjct  114  GDNGLACLTKISGASSASTVSPLPHMFVVKDLVVDMTNFYSQYKSVEPWLKRKDQPPQQG  173

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+ Q+KADR+KLDGMYECILCACCSTSCP
Sbjct  174  KEIPQTKADRAKLDGMYECILCACCSTSCP  203



>emb|CAD62367.1| succinate dehydrogenase [Triticum aestivum]
Length=281

 Score =   267 bits (683),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 161/210 (77%), Gaps = 21/210 (10%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK-----------IKKFQIYRW  165
            A++L+RR       SPAA+  L+ A +S   A +  +S+             K F IYRW
Sbjct  3    AAALLRR-------SPAARALLSPALSSRLVASKPHSSSPAPPPPSSKPASTKTFSIYRW  55

Query  166  SPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG  342
             P++P  KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICG+CAMNIDG
Sbjct  56   DPDSPSTKPHLKDYKVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGTCAMNIDG  115

Query  343  KNGLACLTKISS--GPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPG  516
             NGLACLTKISS     S ++PLPHMFV+KDLVVDMTNFYNQYKS+EPWLKRK+PP   G
Sbjct  116  DNGLACLTKISSEAAGASTISPLPHMFVVKDLVVDMTNFYNQYKSVEPWLKRKDPPAAGG  175

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+ QSKADR+KLDGMYECILCACCSTSCP
Sbjct  176  KEIYQSKADRAKLDGMYECILCACCSTSCP  205



>gb|AFW61340.1| hypothetical protein ZEAMMB73_203922 [Zea mays]
Length=238

 Score =   265 bits (677),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 160/210 (76%), Gaps = 20/210 (10%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK-----------IKKFQIYR  162
            MA++L+RR       SPA +  L+ A +S   A +  +S+             K F IYR
Sbjct  1    MAAALLRR-------SPAVRALLSPALSSRLVASKPHSSSPAPPPPAKAASSTKTFSIYR  53

Query  163  WSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNID  339
            W P++P  KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICGSCAMNID
Sbjct  54   WDPDSPSTKPHLKDYQVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNID  113

Query  340  GKNGLACLTKISSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPG  516
            G NGLACLTKIS     S V+PLPHMFV+KDLVVDMTNFY+QYKS+EPWLKRK+ PP  G
Sbjct  114  GDNGLACLTKISGASSASTVSPLPHMFVVKDLVVDMTNFYSQYKSVEPWLKRKDQPPQQG  173

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+ Q+KADR+KLDGMYECILCACCSTSCP
Sbjct  174  KEIPQTKADRAKLDGMYECILCACCSTSCP  203



>dbj|BAK03407.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 160/210 (76%), Gaps = 21/210 (10%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK-----------IKKFQIYRW  165
            A++L+RR       SPAA+  L+ A +S   A +  +S+             K F IYRW
Sbjct  3    AAALLRR-------SPAARALLSPALSSRLVASKPHSSSPAPPPPSSKPASTKTFSIYRW  55

Query  166  SPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG  342
             P++P  KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICGSCAMNIDG
Sbjct  56   DPDSPSTKPHLKDYKVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNIDG  115

Query  343  KNGLACLTKISS--GPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPG  516
             NGLACLTKISS     S ++PLPHMFV+KDLVVDMTNFYNQYKS+EPWLKRK+P    G
Sbjct  116  DNGLACLTKISSEAAGASTISPLPHMFVVKDLVVDMTNFYNQYKSVEPWLKRKDPASAGG  175

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+ QSKADR+KLDGMYECILCACCSTSCP
Sbjct  176  KEIYQSKADRAKLDGMYECILCACCSTSCP  205



>ref|XP_003573312.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like isoform X2 [Brachypodium distachyon]
Length=280

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 162/204 (79%), Gaps = 10/204 (5%)
 Frame = +1

Query  19   ASSLVRRAITKVSS--SPA---AKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQ  183
            A++L+RR+ T   +  SPA   +++  ++ H+S         SA  K F IYRW P++P 
Sbjct  3    AAALLRRSQTAARALLSPAPLSSRLVASKPHSSSPAP--PPPSASTKTFSIYRWDPDSPS  60

Query  184  -KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
             KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICGSCAMNIDG NGLAC
Sbjct  61   TKPHLKDYKVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNIDGDNGLAC  120

Query  361  LTKISSGPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            LTKISS     S ++PLPHMFV+KDLVVDMTNFYNQYKS+EPWLKRK+PP   GKE+ Q+
Sbjct  121  LTKISSESKGASTISPLPHMFVVKDLVVDMTNFYNQYKSVEPWLKRKDPPSPEGKEIPQT  180

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            KADR+KLDGMYECILCACCSTSCP
Sbjct  181  KADRAKLDGMYECILCACCSTSCP  204



>emb|CAD62368.1| chimeric SDH2-RPS14 protein [Triticum aestivum]
Length=366

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 161/210 (77%), Gaps = 21/210 (10%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK-----------IKKFQIYRW  165
            A++L+RR       SPAA+  L+ A +S   A +  +S+             K F IYRW
Sbjct  3    AAALLRR-------SPAARALLSPALSSRLVASKPHSSSPAPPPPSSKPASTKTFSIYRW  55

Query  166  SPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG  342
             P++P  KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICG+CAMNIDG
Sbjct  56   DPDSPSTKPHLKDYKVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGTCAMNIDG  115

Query  343  KNGLACLTKISS--GPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPG  516
             NGLACLTKISS     S ++PLPHMFV+KDLVVDMTNFYNQYKS+EPWLKRK+PP   G
Sbjct  116  DNGLACLTKISSEAAGASTISPLPHMFVVKDLVVDMTNFYNQYKSVEPWLKRKDPPAAGG  175

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+ QSKADR+KLDGMYECILCACCSTSCP
Sbjct  176  KEIYQSKADRAKLDGMYECILCACCSTSCP  205



>ref|XP_008677742.1| PREDICTED: iron sulfur subunit of succinate dehydrogenase and 
ribosomal protein S14 Precursor isoform X1 [Zea mays]
 emb|CAB42659.1| iron sulfur subunit of succinate dehydrogenase [Zea mays]
 gb|ACN34814.1| unknown [Zea mays]
 gb|AFW61339.1| succinate dehydrogenase iron-sulfur protein [Zea mays]
Length=282

 Score =   265 bits (676),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 160/210 (76%), Gaps = 20/210 (10%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK-----------IKKFQIYR  162
            MA++L+RR       SPA +  L+ A +S   A +  +S+             K F IYR
Sbjct  1    MAAALLRR-------SPAVRALLSPALSSRLVASKPHSSSPAPPPPAKAASSTKTFSIYR  53

Query  163  WSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNID  339
            W P++P  KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICGSCAMNID
Sbjct  54   WDPDSPSTKPHLKDYQVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNID  113

Query  340  GKNGLACLTKISSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPG  516
            G NGLACLTKIS     S V+PLPHMFV+KDLVVDMTNFY+QYKS+EPWLKRK+ PP  G
Sbjct  114  GDNGLACLTKISGASSASTVSPLPHMFVVKDLVVDMTNFYSQYKSVEPWLKRKDQPPQQG  173

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+ Q+KADR+KLDGMYECILCACCSTSCP
Sbjct  174  KEIPQTKADRAKLDGMYECILCACCSTSCP  203



>gb|ABR16401.1| unknown [Picea sitchensis]
Length=230

 Score =   263 bits (671),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%), Gaps = 3/161 (2%)
 Frame = +1

Query  130  SAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREG  309
            ++K K F IYRW+P++ +KP L+ Y I+ KECGPMVLDALIKIK+E DP+LTFRRSCREG
Sbjct  38   ASKPKTFSIYRWNPDHTEKPRLENYTINTKECGPMVLDALIKIKSETDPSLTFRRSCREG  97

Query  310  ICGSCAMNIDGKNGLACLTKISSGPDS--MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPW  483
            ICGSCAMNI+G NGLACLTKI    DS   +TPLPHMFV+KDLVVDMTNFYNQYKSIEPW
Sbjct  98   ICGSCAMNINGCNGLACLTKIEVASDSATTITPLPHMFVVKDLVVDMTNFYNQYKSIEPW  157

Query  484  LKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            LKRK PP   GKE+LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  158  LKRKTPPQ-DGKEILQSKKDRAKLDGMYECILCACCSTSCP  197



>ref|XP_003573313.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like isoform X1 [Brachypodium distachyon]
Length=349

 Score =   266 bits (681),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 164/204 (80%), Gaps = 10/204 (5%)
 Frame = +1

Query  19   ASSLVRRAITKVSS--SPA---AKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQ  183
            A++L+RR+ T   +  SPA   +++  ++ H+S    P  +AS K   F IYRW P++P 
Sbjct  3    AAALLRRSQTAARALLSPAPLSSRLVASKPHSSSPAPPPPSASTKT--FSIYRWDPDSPS  60

Query  184  -KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
             KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICGSCAMNIDG NGLAC
Sbjct  61   TKPHLKDYKVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNIDGDNGLAC  120

Query  361  LTKISSGPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            LTKISS     S ++PLPHMFV+KDLVVDMTNFYNQYKS+EPWLKRK+PP   GKE+ Q+
Sbjct  121  LTKISSESKGASTISPLPHMFVVKDLVVDMTNFYNQYKSVEPWLKRKDPPSPEGKEIPQT  180

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            KADR+KLDGMYECILCACCSTSCP
Sbjct  181  KADRAKLDGMYECILCACCSTSCP  204



>ref|NP_001183639.1| iron sulfur subunit of succinate dehydrogenase and ribosomal 
protein S14 Precursor [Zea mays]
 emb|CAB42658.1| iron sulfur subunit of succinate dehydrogenase (truncated) and 
ribosomal protein S14 [Zea mays]
 gb|ACR37843.1| unknown [Zea mays]
 gb|AFW61338.1| iron sulfur subunit of succinate dehydrogenase and ribosomal 
protein S14 Precursor [Zea mays]
Length=348

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 160/210 (76%), Gaps = 20/210 (10%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK-----------IKKFQIYR  162
            MA++L+RR       SPA +  L+ A +S   A +  +S+             K F IYR
Sbjct  1    MAAALLRR-------SPAVRALLSPALSSRLVASKPHSSSPAPPPPAKAASSTKTFSIYR  53

Query  163  WSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNID  339
            W P++P  KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICGSCAMNID
Sbjct  54   WDPDSPSTKPHLKDYQVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNID  113

Query  340  GKNGLACLTKISSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPG  516
            G NGLACLTKIS     S V+PLPHMFV+KDLVVDMTNFY+QYKS+EPWLKRK+ PP  G
Sbjct  114  GDNGLACLTKISGASSASTVSPLPHMFVVKDLVVDMTNFYSQYKSVEPWLKRKDQPPQQG  173

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+ Q+KADR+KLDGMYECILCACCSTSCP
Sbjct  174  KEIPQTKADRAKLDGMYECILCACCSTSCP  203



>gb|ABR17434.1| unknown [Picea sitchensis]
Length=275

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%), Gaps = 3/161 (2%)
 Frame = +1

Query  130  SAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREG  309
            ++K K F IYRW+P++ +KP L+ Y I+ KECGPMVLDALIKIK+E DP+LTFRRSCREG
Sbjct  38   ASKPKTFSIYRWNPDHTEKPRLENYTINTKECGPMVLDALIKIKSETDPSLTFRRSCREG  97

Query  310  ICGSCAMNIDGKNGLACLTKISSGPDS--MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPW  483
            ICGSCAMNI+G NGLACLTKI    DS   +TPLPHMFV+KDLVVDMTNFYNQYKSIEPW
Sbjct  98   ICGSCAMNINGCNGLACLTKIEVASDSATTITPLPHMFVVKDLVVDMTNFYNQYKSIEPW  157

Query  484  LKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            LKRK PP   GKE+LQSK DR+KLDGMYECILCACCSTSCP
Sbjct  158  LKRKTPPQ-DGKEILQSKKDRAKLDGMYECILCACCSTSCP  197



>ref|XP_004972987.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like isoform X2 [Setaria italica]
Length=284

 Score =   262 bits (669),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 141/158 (89%), Gaps = 2/158 (1%)
 Frame = +1

Query  139  IKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGIC  315
            +K F IYRW P++P  KP L++Y+IDL +CGPMVLDAL+KIKNE DP+LTFRRSCREGIC
Sbjct  51   VKTFSIYRWDPDSPSTKPHLKDYQIDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGIC  110

Query  316  GSCAMNIDGKNGLACLTKISSGPDS-MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKR  492
            GSCAMNIDG NGLACLTKISS   +  V+PLPHMFV+KDLVVDMTNFY+QYKS+EPWLKR
Sbjct  111  GSCAMNIDGDNGLACLTKISSASSASTVSPLPHMFVVKDLVVDMTNFYSQYKSVEPWLKR  170

Query  493  KNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            K+PPP  GKE+ Q+KADR+KLDGMYECILCACCSTSCP
Sbjct  171  KDPPPQEGKEIPQTKADRAKLDGMYECILCACCSTSCP  208



>gb|AFW61337.1| iron sulfur subunit of succinate dehydrogenase and ribosomal 
protein S14 Precursor [Zea mays]
Length=407

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 160/210 (76%), Gaps = 20/210 (10%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK-----------IKKFQIYR  162
            MA++L+RR       SPA +  L+ A +S   A +  +S+             K F IYR
Sbjct  1    MAAALLRR-------SPAVRALLSPALSSRLVASKPHSSSPAPPPPAKAASSTKTFSIYR  53

Query  163  WSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNID  339
            W P++P  KP L++Y++DL +CGPMVLDAL+KIKNE DP+LTFRRSCREGICGSCAMNID
Sbjct  54   WDPDSPSTKPHLKDYQVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNID  113

Query  340  GKNGLACLTKISSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPG  516
            G NGLACLTKIS     S V+PLPHMFV+KDLVVDMTNFY+QYKS+EPWLKRK+ PP  G
Sbjct  114  GDNGLACLTKISGASSASTVSPLPHMFVVKDLVVDMTNFYSQYKSVEPWLKRKDQPPQQG  173

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+ Q+KADR+KLDGMYECILCACCSTSCP
Sbjct  174  KEIPQTKADRAKLDGMYECILCACCSTSCP  203



>ref|NP_001060876.1| Os08g0120000 [Oryza sativa Japonica Group]
 sp|Q9S827.1|SDHB1_ORYSJ RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur 
subunit 1, mitochondrial; AltName: Full=Iron-sulfur subunit 
of complex II; Short=Ip; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA82749.1| succinate dehydrogenase iron-protein subunit (SDHB) [Oryza sativa 
Japonica Group]
 dbj|BAA82750.1| succinate dehydrogenase iron-protein subunit [Oryza sativa Japonica 
Group]
 dbj|BAD09055.1| succinate dehydrogenase iron-protein subunit (SDHB) [Oryza sativa 
Japonica Group]
 dbj|BAF22790.1| Os08g0120000 [Oryza sativa Japonica Group]
 dbj|BAG96585.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96586.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87144.1| unnamed protein product [Oryza sativa Japonica Group]
Length=281

 Score =   259 bits (661),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 158/210 (75%), Gaps = 21/210 (10%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATA------------SAKIKKFQIYR  162
            A++L+RR       SPAA+  L+ A +S   A +  +             A  K F IYR
Sbjct  3    AAALLRR-------SPAARALLSPALSSRLVASKPHSSSPAPPPPPSKAGANTKTFSIYR  55

Query  163  WSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNID  339
            W P++P  KP L++Y++DL +CGPMVLD L+KIKNE DP+LTFRRSCREGICGSCAMNID
Sbjct  56   WDPDSPSTKPHLKDYKVDLSDCGPMVLDVLLKIKNEQDPSLTFRRSCREGICGSCAMNID  115

Query  340  GKNGLACLTKISSGPDSMVT-PLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPG  516
            G NGLACLTKISS   +    PLPHMFVIKDLVVDMTNFYNQYKS+EPWLKRK+ PP PG
Sbjct  116  GDNGLACLTKISSASSASTISPLPHMFVIKDLVVDMTNFYNQYKSVEPWLKRKDAPPQPG  175

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+ Q+KADR+KLDGMYECILCACCSTSCP
Sbjct  176  KEIPQTKADRAKLDGMYECILCACCSTSCP  205



>ref|XP_004972986.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like isoform X1 [Setaria italica]
Length=409

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 141/158 (89%), Gaps = 2/158 (1%)
 Frame = +1

Query  139  IKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGIC  315
            +K F IYRW P++P  KP L++Y+IDL +CGPMVLDAL+KIKNE DP+LTFRRSCREGIC
Sbjct  51   VKTFSIYRWDPDSPSTKPHLKDYQIDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGIC  110

Query  316  GSCAMNIDGKNGLACLTKISSGPDS-MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKR  492
            GSCAMNIDG NGLACLTKISS   +  V+PLPHMFV+KDLVVDMTNFY+QYKS+EPWLKR
Sbjct  111  GSCAMNIDGDNGLACLTKISSASSASTVSPLPHMFVVKDLVVDMTNFYSQYKSVEPWLKR  170

Query  493  KNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            K+PPP  GKE+ Q+KADR+KLDGMYECILCACCSTSCP
Sbjct  171  KDPPPQEGKEIPQTKADRAKLDGMYECILCACCSTSCP  208



>ref|XP_006659072.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like isoform X2 [Oryza brachyantha]
 ref|XP_006659073.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like isoform X3 [Oryza brachyantha]
Length=278

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 156/200 (78%), Gaps = 11/200 (6%)
 Frame = +1

Query  40   AITKVSSSPAAKMTLARAHASEANAPQATAS---------AKIKKFQIYRWSPENPQ-KP  189
            A+  +  SPAA+  L+ A +S   A +  +S         A  K F IYRW P++P  KP
Sbjct  3    AVALLRRSPAARALLSPALSSRLVASKPHSSSPAPPPPSRANTKTFSIYRWDPDSPSTKP  62

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
            +L++Y++DL +CGPMVLD L+KIKNE DP+LTFRRSCREGICGSCAMNIDG NGLACLTK
Sbjct  63   QLKDYKVDLSDCGPMVLDVLLKIKNEQDPSLTFRRSCREGICGSCAMNIDGDNGLACLTK  122

Query  370  ISSGPDSMVT-PLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADR  546
            ISS   +    PLPHMFVIKDLVVDMTNFY+QYKS+EPWLKRK+ PP PGKE+ Q+KADR
Sbjct  123  ISSASSASTISPLPHMFVIKDLVVDMTNFYSQYKSVEPWLKRKDSPPQPGKEIPQTKADR  182

Query  547  SKLDGMYECILCACCSTSCP  606
            +KLDGMYECILCACCSTSCP
Sbjct  183  AKLDGMYECILCACCSTSCP  202



>dbj|BAA82748.1| mitochondrial ribosomal protein S14 [Oryza sativa Japonica Group]
 dbj|BAA82751.1| mitochondrial ribosomal portein S14 [Oryza sativa Japonica Group]
 dbj|BAD09056.1| mitochondrial ribosomal protein S14 [Oryza sativa Japonica Group]
 dbj|BAG95632.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87128.1| unnamed protein product [Oryza sativa Japonica Group]
Length=350

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 158/210 (75%), Gaps = 21/210 (10%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATA------------SAKIKKFQIYR  162
            A++L+RR       SPAA+  L+ A +S   A +  +             A  K F IYR
Sbjct  3    AAALLRR-------SPAARALLSPALSSRLVASKPHSSSPAPPPPPSKAGANTKTFSIYR  55

Query  163  WSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNID  339
            W P++P  KP L++Y++DL +CGPMVLD L+KIKNE DP+LTFRRSCREGICGSCAMNID
Sbjct  56   WDPDSPSTKPHLKDYKVDLSDCGPMVLDVLLKIKNEQDPSLTFRRSCREGICGSCAMNID  115

Query  340  GKNGLACLTKISSGPDSMVT-PLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPG  516
            G NGLACLTKISS   +    PLPHMFVIKDLVVDMTNFYNQYKS+EPWLKRK+ PP PG
Sbjct  116  GDNGLACLTKISSASSASTISPLPHMFVIKDLVVDMTNFYNQYKSVEPWLKRKDAPPQPG  175

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+ Q+KADR+KLDGMYECILCACCSTSCP
Sbjct  176  KEIPQTKADRAKLDGMYECILCACCSTSCP  205



>ref|XP_006659071.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit 
2, mitochondrial-like isoform X1 [Oryza brachyantha]
Length=347

 Score =   260 bits (664),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 156/200 (78%), Gaps = 11/200 (6%)
 Frame = +1

Query  40   AITKVSSSPAAKMTLARAHASEANAPQATAS---------AKIKKFQIYRWSPENPQ-KP  189
            A+  +  SPAA+  L+ A +S   A +  +S         A  K F IYRW P++P  KP
Sbjct  3    AVALLRRSPAARALLSPALSSRLVASKPHSSSPAPPPPSRANTKTFSIYRWDPDSPSTKP  62

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
            +L++Y++DL +CGPMVLD L+KIKNE DP+LTFRRSCREGICGSCAMNIDG NGLACLTK
Sbjct  63   QLKDYKVDLSDCGPMVLDVLLKIKNEQDPSLTFRRSCREGICGSCAMNIDGDNGLACLTK  122

Query  370  ISSGPDSMVT-PLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADR  546
            ISS   +    PLPHMFVIKDLVVDMTNFY+QYKS+EPWLKRK+ PP PGKE+ Q+KADR
Sbjct  123  ISSASSASTISPLPHMFVIKDLVVDMTNFYSQYKSVEPWLKRKDSPPQPGKEIPQTKADR  182

Query  547  SKLDGMYECILCACCSTSCP  606
            +KLDGMYECILCACCSTSCP
Sbjct  183  AKLDGMYECILCACCSTSCP  202



>ref|XP_007398019.1| hypothetical protein PHACADRAFT_259610 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM53327.1| hypothetical protein PHACADRAFT_259610 [Phanerochaete carnosa 
HHB-10118-sp]
Length=274

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 154/203 (76%), Gaps = 11/203 (5%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENP-Q  183
            M S + R A  +   S AA++ + R  AS A   QAT + K    K+F+IYRW+P+ P +
Sbjct  1    MQSLIARSAFVR---SQAARVPVVRTFASSAARFQATPAEKPVLQKEFKIYRWNPDQPAE  57

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KP LQ Y IDL +CGPM+LDALIKIKNEIDPTLTFRRSCREGICGSCAMNI+G+N LACL
Sbjct  58   KPTLQSYTIDLNQCGPMILDALIKIKNEIDPTLTFRRSCREGICGSCAMNINGQNTLACL  117

Query  364  TKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
             +I   SG DS + PLPHM+++KDLV D+T FY QYKSIEP+LK  NPP   G+E LQS+
Sbjct  118  CRIERDSGKDSKIYPLPHMYIVKDLVPDLTLFYKQYKSIEPYLKNDNPP--QGREFLQSQ  175

Query  538  ADRSKLDGMYECILCACCSTSCP  606
             DR KLDGMYECILCACCSTSCP
Sbjct  176  EDRRKLDGMYECILCACCSTSCP  198



>gb|EAZ05419.1| hypothetical protein OsI_27631 [Oryza sativa Indica Group]
 gb|EAZ41337.1| hypothetical protein OsJ_25852 [Oryza sativa Japonica Group]
Length=406

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 158/210 (75%), Gaps = 21/210 (10%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATA------------SAKIKKFQIYR  162
            A++L+RR       SPAA+  L+ A +S   A +  +             A  K F IYR
Sbjct  3    AAALLRR-------SPAARALLSPALSSRLVASKPHSSSPAPPPPPSKAGANTKTFSIYR  55

Query  163  WSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNID  339
            W P++P  KP L++Y++DL +CGPMVLD L+KIKNE DP+LTFRRSCREGICGSCAMNID
Sbjct  56   WDPDSPSTKPHLKDYKVDLSDCGPMVLDVLLKIKNEQDPSLTFRRSCREGICGSCAMNID  115

Query  340  GKNGLACLTKISSGPDSMVT-PLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPG  516
            G NGLACLTKISS   +    PLPHMFVIKDLVVDMTNFYNQYKS+EPWLKRK+ PP PG
Sbjct  116  GDNGLACLTKISSASSASTISPLPHMFVIKDLVVDMTNFYNQYKSVEPWLKRKDAPPQPG  175

Query  517  KEVLQSKADRSKLDGMYECILCACCSTSCP  606
            KE+ Q+KADR+KLDGMYECILCACCSTSCP
Sbjct  176  KEIPQTKADRAKLDGMYECILCACCSTSCP  205



>gb|ABF83897.1| succinate dehydrogenase [Mangifera indica]
Length=159

 Score =   250 bits (638),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 136/159 (86%), Gaps = 4/159 (3%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANA----PQATASAKIKKFQIYRWSPENPQ  183
            MAS L+RR ++    +P+A+  +AR HASE +A    P+A+   K+KKFQIYRW+P+ P 
Sbjct  1    MASGLIRRVVSASRVAPSARYVVARLHASEVDAQKVEPKASGGTKLKKFQIYRWNPDRPS  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KP+LQEYEI+LK+CGPMVLDALIKIKNEIDP+LTFRRSCREGICGSCAMNIDG NGLACL
Sbjct  61   KPQLQEYEINLKDCGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACL  120

Query  364  TKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEP  480
            TKISSG +  +TPLPHM+VIKDLVVDMTNFYNQYKSIEP
Sbjct  121  TKISSGGELTITPLPHMYVIKDLVVDMTNFYNQYKSIEP  159



>ref|XP_007412483.1| hypothetical protein MELLADRAFT_117110 [Melampsora larici-populina 
98AG31]
 gb|EGG04354.1| hypothetical protein MELLADRAFT_117110 [Melampsora larici-populina 
98AG31]
Length=291

 Score =   250 bits (638),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 148/202 (73%), Gaps = 10/202 (5%)
 Frame = +1

Query  16   MASSLV--RRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QK  186
            + SSL+  +R I+  S  P A  T A+ HA+   A   +   K K+F IYRW+P+ P QK
Sbjct  19   ITSSLIPRQRFISSTSVKPFA--TPAQEHAT-PEASNTSTDTKTKQFSIYRWNPDEPSQK  75

Query  187  PELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLT  366
            P LQ Y ID+K+CGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG N LACL 
Sbjct  76   PSLQTYSIDMKKCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGVNTLACLK  135

Query  367  KI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKA  540
            +I   S  D  V PLPHM++IKDLV DMT FY QYKSIEP+LK  NPP     E LQS  
Sbjct  136  RIPKESSSDVKVYPLPHMYIIKDLVPDMTQFYKQYKSIEPFLKNDNPP--AQGEFLQSPE  193

Query  541  DRSKLDGMYECILCACCSTSCP  606
            DR KLDGMYECILCACCSTSCP
Sbjct  194  DRKKLDGMYECILCACCSTSCP  215



>ref|XP_011120355.1| hypothetical protein AOL_s00054g737 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX51001.1| hypothetical protein AOL_s00054g737 [Arthrobotrys oligospora 
ATCC 24927]
Length=281

 Score =   249 bits (636),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 149/200 (75%), Gaps = 10/200 (5%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPE  192
            +ASS +RR    + +S     TLA+        P       +KKF IYRWSP+ P +KP+
Sbjct  12   LASSNIRRFSPTIINSTRCLATLAKEEIVTKKEPL------VKKFSIYRWSPDEPTKKPQ  65

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            +QEY +DL ECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G N LACL++I
Sbjct  66   MQEYSLDLNECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIEGTNTLACLSRI  125

Query  373  SSGPDSM--VTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADR  546
            +    S   + PLPHM+V+KDLV D+TNFY QYKSI+P+L+ K P P  GKE LQ+K DR
Sbjct  126  NRDASSTTRIYPLPHMYVVKDLVPDLTNFYKQYKSIQPYLQSKEPAP-EGKEFLQTKEDR  184

Query  547  SKLDGMYECILCACCSTSCP  606
             KLDG+YECILCACCSTSCP
Sbjct  185  KKLDGLYECILCACCSTSCP  204



>ref|XP_007306928.1| succinate dehydrogenase and fumarate r [Stereum hirsutum FP-91666 
SS1]
 gb|EIM83774.1| succinate dehydrogenase and fumarate r [Stereum hirsutum FP-91666 
SS1]
Length=271

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 142/181 (78%), Gaps = 7/181 (4%)
 Frame = +1

Query  79   TLARAHASEANAPQATASAK---IKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDA  246
            TLAR  A+ +   QA  + K    K+F+IYRW+P+ P +KPELQ Y I+L ECGPMVLDA
Sbjct  17   TLARTFATSSARRQAVPTEKPALNKQFKIYRWNPDEPAKKPELQTYNINLNECGPMVLDA  76

Query  247  LIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGP-DSMVTPLPHMFVI  423
            LIKIKNEIDPTLTFRRSCREGICGSCAMNIDG+N LACL +I   P DS + PLPHM+V+
Sbjct  77   LIKIKNEIDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDRSPKDSKIYPLPHMYVV  136

Query  424  KDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSC  603
            KDLV D+T FY QYKSIEP+L+  NPP     E LQS+ DR KLDGMYECILCACCSTSC
Sbjct  137  KDLVPDLTLFYKQYKSIEPYLQNDNPP--AEGEFLQSQEDRRKLDGMYECILCACCSTSC  194

Query  604  P  606
            P
Sbjct  195  P  195



>ref|XP_007261901.1| succinate dehydrogenase iron-sulfur subunit, mitochondrial [Fomitiporia 
mediterranea MF3/22]
 gb|EJD07949.1| succinate dehydrogenase iron-sulfur subunit, mitochondrial [Fomitiporia 
mediterranea MF3/22]
Length=275

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 145/199 (73%), Gaps = 8/199 (4%)
 Frame = +1

Query  28   LVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENP-QKPEL  195
            L R ++     +  +  T+ R  AS A   QA    K    K+F+IYRW PENP +KPEL
Sbjct  3    LARSSLLNTLRTARSTSTVVRTFASSAARAQAEPVQKPEMYKEFKIYRWDPENPSKKPEL  62

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q Y+IDL +CGPMVLDALIK+KNE+D TLTFRRSCREGICGSCAMNIDG N LACL +I 
Sbjct  63   QSYKIDLNQCGPMVLDALIKVKNEMDSTLTFRRSCREGICGSCAMNIDGVNTLACLCRID  122

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
             ++  +S + PLPHM+V+KDLV D+T FY QYKSIEPWLK  NPP     E LQS  DR 
Sbjct  123  RNTSKNSKIYPLPHMYVVKDLVPDLTQFYKQYKSIEPWLKNDNPP--EKGEYLQSPEDRK  180

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCSTSCP
Sbjct  181  KLDGMYECILCACCSTSCP  199



>gb|KIO21745.1| hypothetical protein M407DRAFT_15770 [Tulasnella calospora MUT 
4182]
Length=280

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 153/200 (77%), Gaps = 8/200 (4%)
 Frame = +1

Query  19   ASSLVR-RAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPE  192
            A SL+R +A   VSSS  +K   A+A   +++AP A     +K F+IYRW+P+ P +KP 
Sbjct  8    ARSLIRSQAWRSVSSSAPSK--YAQASKDQSSAPPAGKEPLMKTFKIYRWNPDEPSKKPY  65

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            LQ Y +DL +CGPM+LDA+IKIKNE+DPTLTFRRSCREGICGSCAMNIDG+N LACL +I
Sbjct  66   LQSYSVDLNQCGPMILDAIIKIKNEMDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRI  125

Query  373  --SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADR  546
              + G ++ + PLPHM+++KDLV DMT FY QYKSIEPWL+    PP  GKE  QS  DR
Sbjct  126  DRAGGKETKLYPLPHMYIVKDLVPDMTQFYKQYKSIEPWLQAD--PPADGKEHRQSIDDR  183

Query  547  SKLDGMYECILCACCSTSCP  606
            +KLDGMYECILCACCSTSCP
Sbjct  184  AKLDGMYECILCACCSTSCP  203



>ref|XP_007350046.1| succinate dehydrogenase iron-sulfur subunit [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD41865.1| succinate dehydrogenase iron-sulfur subunit [Auricularia delicata 
TFB-10046 SS5]
Length=267

 Score =   246 bits (629),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 146/192 (76%), Gaps = 6/192 (3%)
 Frame = +1

Query  40   AITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDL  216
            +I + S++  A    + + A+   AP       +K+F+IYRW+P+ P +KP LQ Y++DL
Sbjct  3    SILRRSTATTATRAFSTSRAALLAAP-VEKQPLVKEFKIYRWNPDEPDKKPHLQSYKVDL  61

Query  217  KECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGP--DS  390
             +CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G+N LACL +I   P  DS
Sbjct  62   NQCGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIDRNPSKDS  121

Query  391  MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYE  570
             + PLPHM+++KDLV D+T FY QYKSIEPWL+  NPP    +E LQS+ DR KLDGMYE
Sbjct  122  KIYPLPHMYIVKDLVPDLTQFYKQYKSIEPWLQNDNPP--ADREHLQSQEDRKKLDGMYE  179

Query  571  CILCACCSTSCP  606
            CILCACCSTSCP
Sbjct  180  CILCACCSTSCP  191



>ref|XP_001784121.1| predicted protein [Physcomitrella patens]
 gb|EDQ51045.1| predicted protein, partial [Physcomitrella patens]
Length=229

 Score =   245 bits (626),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 132/158 (84%), Gaps = 3/158 (2%)
 Frame = +1

Query  139  IKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICG  318
            IKKF IYRWSP++ +KP L+ Y I+  ECGPMVLDALIKIKNEID  LTFRRSCREGICG
Sbjct  2    IKKFSIYRWSPDSSEKPYLKTYSINTNECGPMVLDALIKIKNEIDTGLTFRRSCREGICG  61

Query  319  SCAMNIDGKNGLACLTKISSGP--DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKR  492
            SCAMNI G NGLACLT I   P  +++++PLPHM+VIKDLVVDMT FY+QYKSIEPWLK 
Sbjct  62   SCAMNIGGSNGLACLTPIEPDPKSETIISPLPHMYVIKDLVVDMTQFYSQYKSIEPWLKT  121

Query  493  KNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            K P P  GKE LQ+K DR KLDGMYECILCACC+TSCP
Sbjct  122  KKPAP-GGKEYLQTKKDRLKLDGMYECILCACCTTSCP  158



>gb|EWM29428.1| succinate dehydrogenase iron sulfur protein [Nannochloropsis 
gaditana]
Length=282

 Score =   247 bits (630),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 144/201 (72%), Gaps = 15/201 (7%)
 Frame = +1

Query  34   RRAITKVSSSPAAKMTLARAHASEANAP--------QATASAKIKKFQIYRWSPENPQKP  189
            RR    V  SPA      RA +S A  P        +++A   IK F++YRW PE  QKP
Sbjct  10   RRIAAAVVGSPAF-----RAVSSSATTPAPQQDLKLKSSAKGNIKFFKVYRWDPEQNQKP  64

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             L  Y +DL +CGPMVLDAL KIKNE DPTLTFRRSCREGICGSCAMNIDG N LACL+ 
Sbjct  65   YLSTYPVDLDDCGPMVLDALFKIKNEQDPTLTFRRSCREGICGSCAMNIDGTNTLACLSY  124

Query  370  ISSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKN-PPPIPGKEVLQSKAD  543
            I+ GP+ + + PLPHM+V+KDLV DMTNFY+QYKSIEPWL+ K      P KE LQSK D
Sbjct  125  INKGPEPTKIYPLPHMYVLKDLVPDMTNFYDQYKSIEPWLQTKAVEAKDPNKEHLQSKED  184

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDGMYECILCACCST+CP
Sbjct  185  RKKLDGMYECILCACCSTACP  205



>ref|XP_503189.1| YALI0D23397p [Yarrowia lipolytica]
 emb|CAG81389.1| YALI0D23397p [Yarrowia lipolytica CLIB122]
Length=268

 Score =   246 bits (628),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 143/179 (80%), Gaps = 5/179 (3%)
 Frame = +1

Query  79   TLARAHASEANAPQATASAKIKKFQIYRWSPENPQK-PELQEYEIDLKECGPMVLDALIK  255
              AR  AS A AP+  A  +IKKF IYRW+P+ P+K PEL+EYE+DL +CGPMVLDALIK
Sbjct  16   VFARGLASTAEAPKVPAP-RIKKFGIYRWNPDTPEKKPELKEYEVDLSQCGPMVLDALIK  74

Query  256  IKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISS--GPDSMVTPLPHMFVIKD  429
            IKNE DPTLTFRRSCREGICGSCAMNI+G+N LACL +I+     +  + PLPHMFV++D
Sbjct  75   IKNEQDPTLTFRRSCREGICGSCAMNIEGRNTLACLCRINPDIAKEEKIYPLPHMFVVRD  134

Query  430  LVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            LV D+T FY QYKSIEP+L+R +  P  GKE LQS ADR KLDG+YECILCACCSTSCP
Sbjct  135  LVPDLTQFYKQYKSIEPYLQR-DEVPADGKENLQSIADRRKLDGLYECILCACCSTSCP  192



>dbj|BAJ24098.1| succinate dehydrogenase iron-sulphur protein [Helicobasidium 
mompa]
Length=291

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 152/205 (74%), Gaps = 6/205 (3%)
 Frame = +1

Query  1    IGFPAMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP  180
            +G    A  +  +A +  SS+PA   T A   A++ +A  A+    IK F IYRW+P+ P
Sbjct  9    LGGMRTAKVMAPQARSIYSSAPALFATPAEEQATQ-DAGGASKPPAIKTFSIYRWNPDEP  67

Query  181  Q-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
              KP+LQ+Y+ID+ +CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N LA
Sbjct  68   AVKPKLQKYDIDMNKCGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGVNTLA  127

Query  358  CLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQ  531
            CL +I   SGPD  + PLPHM+VIKDLV DMT FY QYKSIEP+LK  + P    +E LQ
Sbjct  128  CLKRIPKESGPDVKIYPLPHMYVIKDLVPDMTLFYKQYKSIEPYLKNDSVP--ENREFLQ  185

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            S+ DR KLDGMYECILCACCSTSCP
Sbjct  186  SQEDRKKLDGMYECILCACCSTSCP  210



>emb|CEG01696.1| Succinate dehydrogenase/fumarate reductase iron-sulphur protein 
[Ostreococcus tauri]
Length=276

 Score =   246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 146/195 (75%), Gaps = 2/195 (1%)
 Frame = +1

Query  28   LVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQKPELQEYE  207
            L R    +++++     T      +  ++  A+   +I++F++YRW+P++ ++P  + Y+
Sbjct  9    LARELGGRLATTATVHGTRREGQRACVSSSSASRGKEIQRFKVYRWNPDSGEEPRYKTYD  68

Query  208  IDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGP-  384
            +D+ ECGPM+LD L KIK+E D TL+FRRSCREGICGSCAMNI+GKNGLACLTK+  G  
Sbjct  69   VDVGECGPMMLDVLFKIKDEQDQTLSFRRSCREGICGSCAMNINGKNGLACLTKVDRGQS  128

Query  385  -DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDG  561
             D  + PLPHMFV++DLVVDM NFY QYKSIEP+LK K+  P  GKE LQ+K DR+KLDG
Sbjct  129  GDQTIAPLPHMFVVRDLVVDMANFYAQYKSIEPFLKTKSDAPADGKERLQTKEDRAKLDG  188

Query  562  MYECILCACCSTSCP  606
            +YECILCACCSTSCP
Sbjct  189  LYECILCACCSTSCP  203



>dbj|GAA97382.1| hypothetical protein E5Q_04060 [Mixia osmundae IAM 14324]
 gb|KEI39369.1| hypothetical protein L969DRAFT_87328 [Mixia osmundae IAM 14324]
Length=294

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 151/206 (73%), Gaps = 8/206 (4%)
 Frame = +1

Query  10   PAMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATAS-----AKIKKFQIYRWSPE  174
            P   + + +  +   ++SP A++    + AS+       A+     +K K+FQIYRW+P+
Sbjct  12   PLGQNGIAKYGMRTFATSPVARLATPASEASQDKGSSMAAAPNKKPSKPKQFQIYRWNPD  71

Query  175  NP-QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNG  351
             P +KP LQ Y +DL +CGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG N 
Sbjct  72   KPAEKPYLQTYTLDLAQCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGVNT  131

Query  352  LACLTKISS-GPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVL  528
            LACL +I++ G D  + PLPHM++IKD+V DMT FY QYKSIEP+LK  +  P  GKE L
Sbjct  132  LACLKRINAEGKDVKIYPLPHMYIIKDIVPDMTQFYKQYKSIEPFLK-ADSEPADGKEHL  190

Query  529  QSKADRSKLDGMYECILCACCSTSCP  606
            QS+ DR KLDGMYECILCACCST+CP
Sbjct  191  QSREDRQKLDGMYECILCACCSTACP  216



>gb|KDE06101.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit [Microbotryum 
violaceum p1A1 Lamole]
Length=270

 Score =   244 bits (623),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 152/200 (76%), Gaps = 12/200 (6%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKP  189
            +M SS+ +R+    S+S  A  TLA A AS ++ P     A++K FQIYRW+P+ P +KP
Sbjct  4    SMFSSVAKRSFQ--STSRQATRTLATA-ASSSDKP-----AQLKTFQIYRWNPDQPTKKP  55

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             LQ Y+ID+ +CGPMVLDA++KIKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +
Sbjct  56   YLQSYQIDMAKCGPMVLDAILKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLKR  115

Query  370  IS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADR  546
            I     D  + PLPHM++IKDLV DMT FY QYK+IEP+L+ + P    GKE LQS+ DR
Sbjct  116  IEKDNKDMKIYPLPHMYIIKDLVPDMTQFYKQYKAIEPFLQAEKPA--DGKEHLQSREDR  173

Query  547  SKLDGMYECILCACCSTSCP  606
             KLDGMYECILCACCSTSCP
Sbjct  174  KKLDGMYECILCACCSTSCP  193



>gb|EPS94983.1| hypothetical protein FOMPIDRAFT_1133380 [Fomitopsis pinicola 
FP-58527 SS1]
Length=273

 Score =   244 bits (623),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 153/203 (75%), Gaps = 12/203 (6%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENPQ-  183
            M S + R+A+ +    P+A  + AR  A+ +   QA  + K    K+F+IYRW+P+ P  
Sbjct  1    MQSLVARQAVLR----PSALKSSARTFATSSVRAQAVPTEKPVLKKEFKIYRWNPDEPAA  56

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KP+LQ Y IDL +CGPM+LDALIKIKNEIDPTLTFRRSCREGICGSCAMNI+G+N LACL
Sbjct  57   KPKLQTYSIDLNQCGPMILDALIKIKNEIDPTLTFRRSCREGICGSCAMNINGQNTLACL  116

Query  364  TKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
             +I  ++  D+ + PLPHM+++KDLV D+T FY QYKSIEP+L+  NPP    +E LQS+
Sbjct  117  CRIDRNASKDTKIYPLPHMYIVKDLVPDLTQFYKQYKSIEPYLQNDNPP--ADREFLQSQ  174

Query  538  ADRSKLDGMYECILCACCSTSCP  606
             DR KLDGMYECILCACCSTSCP
Sbjct  175  EDRRKLDGMYECILCACCSTSCP  197



>ref|XP_004992280.1| succinate dehydrogenase [Salpingoeca rosetta]
 gb|EGD75227.1| succinate dehydrogenase [Salpingoeca rosetta]
Length=262

 Score =   244 bits (622),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 139/187 (74%), Gaps = 3/187 (2%)
 Frame = +1

Query  52   VSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECG  228
            +S   AA+  LA+     A    +T +  +KKF IYRW PE P  KP  Q YEIDL +CG
Sbjct  2    LSRVVAARGLLAQTPVLTAVRCSSTKTPLMKKFSIYRWDPEKPGDKPHQQTYEIDLNDCG  61

Query  229  PMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKIS-SGPDSMVTPL  405
            PMVLDALIKIKNE+DPTLTFRRSCREGICGSC+MNIDG N LACL  I+  G +  + PL
Sbjct  62   PMVLDALIKIKNEVDPTLTFRRSCREGICGSCSMNIDGTNNLACLCPITRDGSEMKIRPL  121

Query  406  PHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCA  585
            PHM+V+KDLV DMTNFY QYK+IEPWL+    P   GKE LQS ADR KLDGMYECILCA
Sbjct  122  PHMYVVKDLVPDMTNFYQQYKAIEPWLQTSKQPE-DGKEFLQSIADRKKLDGMYECILCA  180

Query  586  CCSTSCP  606
            CCSTSCP
Sbjct  181  CCSTSCP  187



>ref|XP_002979741.1| hypothetical protein SELMODRAFT_57580, partial [Selaginella moellendorffii]
 gb|EFJ19143.1| hypothetical protein SELMODRAFT_57580, partial [Selaginella moellendorffii]
Length=234

 Score =   242 bits (618),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = +1

Query  130  SAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREG  309
            S+ IK+F IYRW+P+    P+ Q Y+IDL ECGPMVLDALIKIKNE+D  LTFRRSCREG
Sbjct  2    SSNIKEFSIYRWNPDGSSNPQQQVYKIDLNECGPMVLDALIKIKNEVDQGLTFRRSCREG  61

Query  310  ICGSCAMNIDGKNGLACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWL  486
            ICGSCAMNI+GKNGLACLTKI      + V PLPHM+VIKDLVVD+TNFY QYKS+EPWL
Sbjct  62   ICGSCAMNINGKNGLACLTKIEKDAAQTSVLPLPHMYVIKDLVVDLTNFYQQYKSVEPWL  121

Query  487  KRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            K K       KE LQSK +R KLDGMYECILCACC++SCP
Sbjct  122  KTKTMLEAGQKEHLQSKKERLKLDGMYECILCACCTSSCP  161



>gb|ACE98099.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98102.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98117.1| 2Fe-2S ferredoxin, partial [Populus tremula]
Length=160

 Score =   239 bits (611),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 120/134 (90%), Gaps = 1/134 (1%)
 Frame = +1

Query  124  TASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCR  303
            T    +K FQIYRW+P+NP KPELQ YEIDL +CGPMVLDALIKIKNEIDPTLTFRRSCR
Sbjct  27   TKPQHLKTFQIYRWNPDNPTKPELQNYEIDLNKCGPMVLDALIKIKNEIDPTLTFRRSCR  86

Query  304  EGICGSCAMNIDGKNGLACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEP  480
            EGICGSCAMN+DG NGLACLTKI  SGP SM+ PLPHMFVIKDLVVDMTNFYNQYKSIEP
Sbjct  87   EGICGSCAMNMDGCNGLACLTKIDKSGPPSMINPLPHMFVIKDLVVDMTNFYNQYKSIEP  146

Query  481  WLKRKNPPPIPGKE  522
            WLKRKNPPP+ GKE
Sbjct  147  WLKRKNPPPVEGKE  160



>gb|ACE98095.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98096.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98098.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98100.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98103.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98104.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98106.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98107.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98108.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98109.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98111.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98112.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98113.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98114.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98115.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98116.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98118.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98119.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98120.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98121.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98122.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98123.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98124.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98125.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98126.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98128.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98129.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98130.1| 2Fe-2S ferredoxin, partial [Populus tremula]
Length=160

 Score =   239 bits (611),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 120/134 (90%), Gaps = 1/134 (1%)
 Frame = +1

Query  124  TASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCR  303
            T    +K FQIYRW+P+NP KPELQ YEIDL +CGPMVLDALIKIKNEIDPTLTFRRSCR
Sbjct  27   TKPQHLKTFQIYRWNPDNPTKPELQNYEIDLNKCGPMVLDALIKIKNEIDPTLTFRRSCR  86

Query  304  EGICGSCAMNIDGKNGLACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEP  480
            EGICGSCAMN+DG NGLACLTKI  SGP SM+ PLPHMFVIKDLVVDMTNFYNQYKSIEP
Sbjct  87   EGICGSCAMNMDGCNGLACLTKIDKSGPPSMINPLPHMFVIKDLVVDMTNFYNQYKSIEP  146

Query  481  WLKRKNPPPIPGKE  522
            WLKRKNPPP+ GKE
Sbjct  147  WLKRKNPPPVEGKE  160



>emb|CCG83181.1| Probable succinate dehydrogenase [Taphrina deformans PYCC 5710]
Length=276

 Score =   244 bits (622),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 151/200 (76%), Gaps = 7/200 (4%)
 Frame = +1

Query  28   LVRRAITKVSSSPAAK--MTLARAHASEANAPQATASAK---IKKFQIYRWSPENP-QKP  189
            + RRA+ ++  +  A+   T A A+AS A + QA  + K   +KKF IYRWSPE P +KP
Sbjct  2    IARRALQQLPKASFARCISTTAPANASVATSEQAPTTGKAPKMKKFSIYRWSPETPDKKP  61

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             +Q+Y+IDL  CGPMVLDA+IKIKN+IDPTLTFRRSCREGICGSCAMNIDG+N LACL +
Sbjct  62   TMQDYDIDLNTCGPMVLDAIIKIKNDIDPTLTFRRSCREGICGSCAMNIDGQNTLACLCR  121

Query  370  ISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP-PIPGKEVLQSKADR  546
            I     + + PLPH +V+KD+V D+T+FY QYKSI+P+L+R     P  G E+ QSK DR
Sbjct  122  IEPEKQTKIYPLPHTYVVKDIVPDLTHFYKQYKSIKPYLQRNEADFPADGTEIRQSKEDR  181

Query  547  SKLDGMYECILCACCSTSCP  606
             KLDG+YECILCACCSTSCP
Sbjct  182  RKLDGLYECILCACCSTSCP  201



>gb|KIP11285.1| hypothetical protein PHLGIDRAFT_27998 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=269

 Score =   243 bits (621),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 143/191 (75%), Gaps = 8/191 (4%)
 Frame = +1

Query  52   VSSSPAAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENP-QKPELQEYEIDLK  219
            V+ S   +    R  AS A   QAT S K    K+F+IYRW+P+ P +KP LQ Y +DL 
Sbjct  5    VARSALKRTPAVRTFASSAARLQATPSEKPVLNKEFKIYRWNPDTPAEKPTLQSYTLDLN  64

Query  220  ECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGP--DSM  393
            +CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G+N LACL +I   P  DS 
Sbjct  65   QCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIDRNPSKDSK  124

Query  394  VTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYEC  573
            + PLPHM+++KDLV D+T FY QYKSIEP+LK  N P   G+E LQS  DR KLDGMYEC
Sbjct  125  IYPLPHMYIVKDLVPDLTLFYKQYKSIEPYLKNDNVP--EGREFLQSVEDRKKLDGMYEC  182

Query  574  ILCACCSTSCP  606
            ILCACCSTSCP
Sbjct  183  ILCACCSTSCP  193



>gb|ACE98127.1| 2Fe-2S ferredoxin, partial [Populus tremula]
Length=160

 Score =   239 bits (611),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 120/134 (90%), Gaps = 1/134 (1%)
 Frame = +1

Query  124  TASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCR  303
            T    +K FQIYRW+P+NP KPELQ YEIDL +CGPMVLDALIKIKNEIDPTLTFRRSCR
Sbjct  27   TKPQHLKTFQIYRWNPDNPTKPELQNYEIDLNKCGPMVLDALIKIKNEIDPTLTFRRSCR  86

Query  304  EGICGSCAMNIDGKNGLACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEP  480
            EGICGSCAMN+DG NGLACLTKI  SGP SM+ PLPHMFVIKDLVVDMTNFYNQYKSIEP
Sbjct  87   EGICGSCAMNMDGCNGLACLTKIDKSGPPSMINPLPHMFVIKDLVVDMTNFYNQYKSIEP  146

Query  481  WLKRKNPPPIPGKE  522
            WLKRKNPPP+ GKE
Sbjct  147  WLKRKNPPPVEGKE  160



>ref|XP_006456222.1| succinate dehydrogenase iron-sulfur subunit [Agaricus bisporus 
var. bisporus H97]
 ref|XP_007331635.1| SDH2 iron-sulfur protein subunit of succinate dehydrogenase [Agaricus 
bisporus var. burnettii JB137-S8]
 gb|EKM77791.1| SDH2 iron-sulfur protein subunit of succinate dehydrogenase [Agaricus 
bisporus var. burnettii JB137-S8]
 gb|EKV43230.1| succinate dehydrogenase iron-sulfur subunit [Agaricus bisporus 
var. bisporus H97]
Length=267

 Score =   243 bits (620),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 147/201 (73%), Gaps = 14/201 (7%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKK-FQIYRWSPENP-QKP  189
            M S+  R A T+ +        L R+ A+ A A QA     ++K F+IYRW+P+ P +KP
Sbjct  1    MLSASSRSAFTRANH-------LTRSFATTARAAQAVQKPVLEKEFKIYRWNPDEPSKKP  53

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             LQ Y+IDL +CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+N LACL +
Sbjct  54   TLQSYKIDLNQCGPMILDALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGQNTLACLCR  113

Query  370  IS--SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            I      D+ V PLPHM+V+KDLV D+T FY QYKSI+PWL+  NP   P  E LQS  D
Sbjct  114  IDREGSKDTKVYPLPHMYVVKDLVPDLTLFYKQYKSIQPWLQNDNP---PAHEHLQSIED  170

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDG+YECILCACCSTSCP
Sbjct  171  RKKLDGLYECILCACCSTSCP  191



>ref|XP_006564033.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Apis mellifera]
Length=254

 Score =   243 bits (619),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 138/183 (75%), Gaps = 3/183 (2%)
 Frame = +1

Query  67   AAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLD  243
            A +    +      +A Q  + AK+K F +YRW+P+ P +KP +QEY++DL  CGPMVLD
Sbjct  8    ACRNVFRQVRGFHISANQNASEAKLKSFAVYRWNPDKPDEKPYMQEYKVDLNTCGPMVLD  67

Query  244  ALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPDSM--VTPLPHMF  417
            ALIKIKNEIDPTLTFRRSCREGICGSCAMNI G N LAC++KI +  +S   + PLPHM+
Sbjct  68   ALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDTNLNSTSKIYPLPHMY  127

Query  418  VIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCST  597
            ++KDLV D+ NFYNQYKSI+PWL+R +      K+ LQS  DR KLDG+YECILCACCST
Sbjct  128  IVKDLVPDLNNFYNQYKSIQPWLQRGDAKETGAKQYLQSVEDRKKLDGLYECILCACCST  187

Query  598  SCP  606
            SCP
Sbjct  188  SCP  190



>gb|KDE06102.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, variant 
[Microbotryum violaceum p1A1 Lamole]
Length=269

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 151/200 (76%), Gaps = 13/200 (7%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKP  189
            +M SS+ +R+     S+  A  TLA A AS ++ P     A++K FQIYRW+P+ P +KP
Sbjct  4    SMFSSVAKRSF---QSTSRATRTLATA-ASSSDKP-----AQLKTFQIYRWNPDQPTKKP  54

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             LQ Y+ID+ +CGPMVLDA++KIKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +
Sbjct  55   YLQSYQIDMAKCGPMVLDAILKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLKR  114

Query  370  IS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADR  546
            I     D  + PLPHM++IKDLV DMT FY QYK+IEP+L+ + P    GKE LQS+ DR
Sbjct  115  IEKDNKDMKIYPLPHMYIIKDLVPDMTQFYKQYKAIEPFLQAEKPA--DGKEHLQSREDR  172

Query  547  SKLDGMYECILCACCSTSCP  606
             KLDGMYECILCACCSTSCP
Sbjct  173  KKLDGMYECILCACCSTSCP  192



>gb|KIL56467.1| hypothetical protein M378DRAFT_113413 [Amanita muscaria Koide 
BX008]
Length=277

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 153/205 (75%), Gaps = 12/205 (6%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQA--TASAK---IKKFQIYRWSPENP  180
            M+ SL  +A++ ++  P  +    R  +S   A QA   ++ K   +K+F+IYRW+P+ P
Sbjct  1    MSFSLPSKALSTIT--PNLRRQSTRLFSSTQKACQAEPVSTGKPELVKEFKIYRWNPDEP  58

Query  181  -QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
             +KP LQ Y +DL +CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+N LA
Sbjct  59   TKKPHLQSYHVDLNQCGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGQNTLA  118

Query  358  CLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQ  531
            CL +I  ++G +S + PLPHM+++KDLV DMT FY QYKSI+PWL+  NPP     E LQ
Sbjct  119  CLCRIDRNAGKNSKIYPLPHMYIVKDLVPDMTLFYKQYKSIQPWLQNDNPP--EKGEFLQ  176

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            S  DR KLDGMYECILCACCSTSCP
Sbjct  177  SPEDRKKLDGMYECILCACCSTSCP  201



>gb|KGB76525.1| succinate dehydrogenase iron-sulfur subunit [Cryptococcus gattii 
R265]
 gb|KIR27684.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii LA55]
 gb|KIR73150.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii CA1014]
 gb|KIR90073.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii CBS 10090]
Length=280

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 150/199 (75%), Gaps = 9/199 (5%)
 Frame = +1

Query  31   VRRAITKVSSSPAAKMTLARAHASEANAPQAT----ASAKIKKFQIYRWSPENP-QKPEL  195
            + R+   + S+       AR+  S A+A  AT       +IK+F+IYRW+P+ P +KP+L
Sbjct  7    ILRSFNAIPSTSRPLAAAARSFHSTASAQLATPVEGKKPQIKEFKIYRWNPDVPSEKPKL  66

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q Y++DL +CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I 
Sbjct  67   QTYKVDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIP  126

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
              +  +S + PLPHM+V+KDLV D+T+FY QYKSIEP+LK  NPP     E LQS+ADR 
Sbjct  127  KDTSKESKIYPLPHMYVVKDLVPDLTHFYKQYKSIEPYLKNDNPP--EKGEFLQSQADRK  184

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCSTSCP
Sbjct  185  KLDGMYECILCACCSTSCP  203



>gb|KIR31702.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii MMRL2647]
 gb|KIR42026.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii Ram5]
 gb|KIR98905.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii 2001/935-1]
 gb|KIY55921.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii 99/473]
Length=280

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 150/199 (75%), Gaps = 9/199 (5%)
 Frame = +1

Query  31   VRRAITKVSSSPAAKMTLARAHASEANAPQAT----ASAKIKKFQIYRWSPENP-QKPEL  195
            + R+   + S+       AR+  S A+A  AT       +IK+F+IYRW+P+ P +KP+L
Sbjct  7    ILRSFNAIPSTSRPLAAAARSFHSTASAQLATPVEGKKPQIKEFKIYRWNPDVPNEKPKL  66

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q Y++DL +CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I 
Sbjct  67   QTYKVDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIP  126

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
              +  +S + PLPHM+V+KDLV D+T+FY QYKSIEP+LK  NPP     E LQS+ADR 
Sbjct  127  KDTSKESKIYPLPHMYVVKDLVPDLTHFYKQYKSIEPYLKNDNPP--EKGEFLQSQADRK  184

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCSTSCP
Sbjct  185  KLDGMYECILCACCSTSCP  203



>gb|ACE98101.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98105.1| 2Fe-2S ferredoxin, partial [Populus tremula]
Length=160

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 120/134 (90%), Gaps = 1/134 (1%)
 Frame = +1

Query  124  TASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCR  303
            T    +K FQIYRW+P+NP KPELQ YEIDL +CGPMVLDALIKIKNEIDPTLTFRRSCR
Sbjct  27   TKPQHLKTFQIYRWNPDNPTKPELQNYEIDLNKCGPMVLDALIKIKNEIDPTLTFRRSCR  86

Query  304  EGICGSCAMNIDGKNGLACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEP  480
            EGICGSCAMN+DG NGLACLTKI  SGP SM+ PLPHMFVIKDLVVDMTNFYNQYKS+EP
Sbjct  87   EGICGSCAMNMDGCNGLACLTKIDKSGPPSMINPLPHMFVIKDLVVDMTNFYNQYKSMEP  146

Query  481  WLKRKNPPPIPGKE  522
            WLKRKNPPP+ GKE
Sbjct  147  WLKRKNPPPVEGKE  160



>gb|ACE98097.1| 2Fe-2S ferredoxin, partial [Populus tremula]
 gb|ACE98110.1| 2Fe-2S ferredoxin, partial [Populus tremula]
Length=160

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 120/134 (90%), Gaps = 1/134 (1%)
 Frame = +1

Query  124  TASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCR  303
            T    +K FQIYRW+P+NP KPELQ YEIDL +CGPMVLDALIKIKNEIDPTLTFRRSCR
Sbjct  27   TKPQHLKTFQIYRWNPDNPTKPELQNYEIDLNKCGPMVLDALIKIKNEIDPTLTFRRSCR  86

Query  304  EGICGSCAMNIDGKNGLACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEP  480
            EGICGSCAMN+DG NGLACLTKI  SGP SM+ PLPHMFVIKDLVVDMTNFYNQYKS+EP
Sbjct  87   EGICGSCAMNMDGCNGLACLTKIDKSGPPSMINPLPHMFVIKDLVVDMTNFYNQYKSMEP  146

Query  481  WLKRKNPPPIPGKE  522
            WLKRKNPPP+ GKE
Sbjct  147  WLKRKNPPPVEGKE  160



>emb|CDF89482.1| ZYBA0S04-05336g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=262

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = +1

Query  61   SPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMV  237
            +P  K ++ R     + A  A A  ++K F+IYRWSP++P +KP LQ +++DL +CGPMV
Sbjct  3    NPVLKKSVCRLTLQRSLATTAAAEPRLKNFKIYRWSPDHPTEKPHLQTFQVDLNDCGPMV  62

Query  238  LDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSG--PDSMVTPLPH  411
            LDAL+KIKNE D TLT RRSCREGICGSCAMNI G+N LACL KI      D  + PLPH
Sbjct  63   LDALLKIKNEQDATLTLRRSCREGICGSCAMNIGGRNTLACLCKIDQNVSKDLKIYPLPH  122

Query  412  MFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACC  591
            M+++KDLV D+TNFY QYKSI+PWL+RK  P   GKEVLQS  DR KLDG+YECILCACC
Sbjct  123  MYIVKDLVPDLTNFYQQYKSIQPWLQRKTFPK-DGKEVLQSVEDRKKLDGLYECILCACC  181

Query  592  STSCP  606
            STSCP
Sbjct  182  STSCP  186



>emb|CDH08447.1| probable Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial [Zygosaccharomyces bailii ISA1307]
Length=261

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = +1

Query  61   SPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMV  237
            +P  K ++ R     + A  A A  ++K F+IYRWSP++P +KP LQ +++DL +CGPMV
Sbjct  2    NPVLKKSVCRLTLQRSLATTAAAEPRLKNFKIYRWSPDHPTEKPHLQTFQVDLNDCGPMV  61

Query  238  LDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSG--PDSMVTPLPH  411
            LDAL+KIKNE D TLT RRSCREGICGSCAMNI G+N LACL KI      D  + PLPH
Sbjct  62   LDALLKIKNEQDATLTLRRSCREGICGSCAMNIGGRNTLACLCKIDQNVSKDLKIYPLPH  121

Query  412  MFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACC  591
            M+++KDLV D+TNFY QYKSI+PWL+RK  P   GKEVLQS  DR KLDG+YECILCACC
Sbjct  122  MYIVKDLVPDLTNFYQQYKSIQPWLQRKTFPK-DGKEVLQSVEDRKKLDGLYECILCACC  180

Query  592  STSCP  606
            STSCP
Sbjct  181  STSCP  185



>ref|XP_006617552.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Apis dorsata]
Length=278

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 138/183 (75%), Gaps = 3/183 (2%)
 Frame = +1

Query  67   AAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLD  243
            A +    +      +A Q  + AK+K F +YRW+P+ P +KP +QEY++DL  CGPMVLD
Sbjct  8    ACRNVFRQVRGFHISANQNASEAKLKSFAVYRWNPDKPDEKPYMQEYKVDLNTCGPMVLD  67

Query  244  ALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPDSM--VTPLPHMF  417
            ALIKIKNEIDPTLTFRRSCREGICGSCAMNI G N LAC++KI +  +S   + PLPHM+
Sbjct  68   ALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDTNLNSTSKIYPLPHMY  127

Query  418  VIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCST  597
            ++KDLV D+ NFYNQYKSI+PWL+R +      K+ LQS  DR KLDG+YECILCACCST
Sbjct  128  IVKDLVPDLNNFYNQYKSIQPWLQRGDAKETGAKQYLQSVEDRKKLDGLYECILCACCST  187

Query  598  SCP  606
            SCP
Sbjct  188  SCP  190



>emb|CDH57720.1| iron-sulfur protein subunit of succinatedehydrogenase ( sdh4p) 
[Lichtheimia corymbifera JMRC:FSU:9682]
Length=285

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 153/208 (74%), Gaps = 7/208 (3%)
 Frame = +1

Query  1    IGFPAMASSLVRRAITKVSSSPAAKM---TLARAHASEANAPQATASAKIKKFQIYRWSP  171
            I   ++ +S +R  +    ++P A+M   + +   AS  +AP       +K F+IYRW+P
Sbjct  3    IALASLRTSAIRARVAPSVAAPVARMLNTSTSSNMASPTDAPATKKQPLLKTFEIYRWNP  62

Query  172  ENP-QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKN  348
            + P +KP L++Y+IDL +CGPMVLDALIKIKNE DP+LTFRRSCREGICGSCAMNI+G N
Sbjct  63   DKPTEKPYLEKYQIDLNQCGPMVLDALIKIKNEQDPSLTFRRSCREGICGSCAMNIEGGN  122

Query  349  GLACLTKISSGPDS--MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKE  522
             LAC++KI+        + PLPHM+++KDLV D+T+FY QYKSIEP+LK +N PP  GKE
Sbjct  123  TLACISKINRDASKPVKIYPLPHMYIVKDLVPDLTHFYKQYKSIEPYLK-QNTPPADGKE  181

Query  523  VLQSKADRSKLDGMYECILCACCSTSCP  606
             LQS  DR KLDG+YECILCACCSTSCP
Sbjct  182  NLQSIEDRKKLDGLYECILCACCSTSCP  209



>ref|XP_007870368.1| hypothetical protein GLOTRDRAFT_133076 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ51413.1| hypothetical protein GLOTRDRAFT_133076 [Gloeophyllum trabeum 
ATCC 11539]
Length=318

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 141/180 (78%), Gaps = 8/180 (4%)
 Frame = +1

Query  85   ARAHASEANAPQATASAK---IKKFQIYRWSPENPQK-PELQEYEIDLKECGPMVLDALI  252
            AR  AS A   QA A  K   +K+F+IYRW+P+ P+K P LQ Y IDL +CGPMVLDALI
Sbjct  65   ARTFASSATRAQAAAVEKQPLLKEFKIYRWNPDEPEKKPTLQSYTIDLNQCGPMVLDALI  124

Query  253  KIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHMFVIK  426
            KIKNEIDPTLTFRRSCREGICGSCAMNI+G+N LACL +I  ++  DS + PLPHM+++K
Sbjct  125  KIKNEIDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIDRNASKDSKIYPLPHMYIVK  184

Query  427  DLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            DLV D+T FY QYKSIEP+LK  NPP     E LQS+ DR KLDG+YECILCACCSTSCP
Sbjct  185  DLVPDLTLFYKQYKSIEPYLKNDNPP--EKGEFLQSQEDRKKLDGLYECILCACCSTSCP  242



>gb|AFR96451.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus neoformans var. grubii H99]
Length=280

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 149/197 (76%), Gaps = 9/197 (5%)
 Frame = +1

Query  37   RAITKVSSSPAAKMTLARAHASEANAPQAT----ASAKIKKFQIYRWSPENP-QKPELQE  201
            R++  + S+       AR+  + A+A  AT       +IK+F+IYRW+P+ P +KP+LQ 
Sbjct  9    RSLNAIPSTSRPLAAAARSFHATASAQLATPVEGKQPQIKEFKIYRWNPDVPNEKPKLQT  68

Query  202  YEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--S  375
            Y++DL +CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I   
Sbjct  69   YKVDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGINTLACLCRIPKD  128

Query  376  SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKL  555
            +  DS + PLPHM+V+KDLV D+T+FY QYKSIEP+LK  NPP     E LQS+ADR KL
Sbjct  129  TSKDSKIYPLPHMYVVKDLVPDLTHFYKQYKSIEPYLKNDNPP--EKGEFLQSQADRKKL  186

Query  556  DGMYECILCACCSTSCP  606
            DGMYECILCACCS SCP
Sbjct  187  DGMYECILCACCSASCP  203



>gb|KIR88650.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii IND107]
Length=280

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 150/199 (75%), Gaps = 9/199 (5%)
 Frame = +1

Query  31   VRRAITKVSSSPAAKMTLARAHASEANAPQAT----ASAKIKKFQIYRWSPENP-QKPEL  195
            + R+   + S+       AR+  + A+A  AT       +IK+F+IYRW+P+ P +KP+L
Sbjct  7    IFRSFNAIPSTSRPLAAAARSFHATASAQLATPVEGKEPQIKEFKIYRWNPDVPNEKPKL  66

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q Y++DL +CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I 
Sbjct  67   QTYKVDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIP  126

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
              +  +S + PLPHM+V+KDLV D+T+FY QYKSIEP+LK  NPP     E LQS+ADR 
Sbjct  127  KDTSKESKIYPLPHMYVVKDLVPDLTHFYKQYKSIEPYLKNDNPP--EKGEFLQSQADRK  184

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCSTSCP
Sbjct  185  KLDGMYECILCACCSTSCP  203



>ref|XP_003441476.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Oreochromis niloticus]
Length=283

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 145/201 (72%), Gaps = 8/201 (4%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKP  189
            A  +SL R  +    S PA  + +  A  + A A Q     +IKKFQ+YRW P+ P  KP
Sbjct  4    ASFTSLTRCGVLAFRS-PAGLLAVRYAQTAAAPAVQP----RIKKFQVYRWDPDTPGDKP  58

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             +Q YEIDL  CGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNI+G N LACL K
Sbjct  59   RMQTYEIDLNTCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIEGGNTLACLNK  118

Query  370  ISSGPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            I S     + + PLPHM+V+KDLV DM+NFY QYKSIEP+LK+K+      ++ LQS  D
Sbjct  119  IDSNVSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESKEGKEQYLQSVED  178

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDG+YECILCACCSTSCP
Sbjct  179  RQKLDGLYECILCACCSTSCP  199



>ref|XP_001747850.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ87237.1| predicted protein [Monosiga brevicollis MX1]
Length=312

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 143/201 (71%), Gaps = 15/201 (7%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKP  189
            AMA   +R A  K  S  A      RA ++EA AP      K+K F IYRW PE P  KP
Sbjct  48   AMALRTLRSASMKAVSFSAV-----RAASTEAAAP------KMKSFSIYRWDPERPGDKP  96

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             +QEY ID+  CGPMVLDALIKIKNE DPTLTFRRSCREGICGSC+MNIDG N LACL +
Sbjct  97   RMQEYSIDMNSCGPMVLDALIKIKNEQDPTLTFRRSCREGICGSCSMNIDGTNTLACLCR  156

Query  370  ISSGPDSM--VTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            +++   S   + PLPHM+V+KDLV DM NFY QY++IEPWL+  +  P  G+E LQS  D
Sbjct  157  VTTESSSAMKINPLPHMYVVKDLVPDMANFYQQYQAIEPWLQ-TDKAPEDGREYLQSVED  215

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDGMYECILCACCSTSCP
Sbjct  216  RKKLDGMYECILCACCSTSCP  236



>ref|XP_007387437.1| iron-sulphar subunit protein of succinate dehydrogenase [Punctularia 
strigosozonata HHB-11173 SS5]
 gb|EIN05619.1| iron-sulphar subunit protein of succinate dehydrogenase [Punctularia 
strigosozonata HHB-11173 SS5]
Length=272

 Score =   241 bits (614),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 143/189 (76%), Gaps = 8/189 (4%)
 Frame = +1

Query  58   SSPAAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENP-QKPELQEYEIDLKEC  225
            SS   + T ARA AS A   QA  + K    K+F+IYRW PE P +KP LQ YE+DL +C
Sbjct  10   SSLKIRPTGARAFASSATRRQAVPTEKPVLKKQFKIYRWDPEEPAKKPTLQTYEVDLNQC  69

Query  226  GPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGP--DSMVT  399
            GPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+N LACL +I      D+ + 
Sbjct  70   GPMILDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDRNEKKDTKIY  129

Query  400  PLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECIL  579
            PLPHM+++KDLV D++ FY QYKSI+P+L+  NPP     E LQS+ DR KLDG+YECIL
Sbjct  130  PLPHMYIVKDLVPDLSLFYKQYKSIQPYLQNDNPP--EKGEYLQSQEDRRKLDGLYECIL  187

Query  580  CACCSTSCP  606
            CACCSTSCP
Sbjct  188  CACCSTSCP  196



>gb|KIY45193.1| iron-sulfur subunit protein of succinate dehydrogenase [Fistulina 
hepatica ATCC 64428]
Length=271

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 146/196 (74%), Gaps = 8/196 (4%)
 Frame = +1

Query  37   RAITKVSSSPAAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENP-QKPELQEY  204
            +++   S     +++ ARA ++ A   QA    K    K+F+IYRW+P+ P +KPELQ Y
Sbjct  2    QSLASSSLRATQRLSAARAFSTSALRLQAVPVQKPVHNKEFKIYRWNPDEPAKKPELQSY  61

Query  205  EIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKIS--S  378
             IDL + GPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+N LACL +I   S
Sbjct  62   TIDLNQTGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDRKS  121

Query  379  GPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLD  558
              D+ + PLPHM+V+KDLV D+TNFY QYKSIEP+L+  NPP     E LQS  DR KLD
Sbjct  122  SKDTKIYPLPHMYVVKDLVPDLTNFYKQYKSIEPYLQNDNPP--EKGEFLQSPEDRKKLD  179

Query  559  GMYECILCACCSTSCP  606
            G+YECILCACCSTSCP
Sbjct  180  GLYECILCACCSTSCP  195



>emb|CAT00089.1| succinate dehydrogenase iron-sulfur subunit [Hebeloma cylindrosporum]
Length=270

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 148/192 (77%), Gaps = 9/192 (5%)
 Frame = +1

Query  52   VSSSPAAKMTLA-RAHASEANAPQATASAK---IKKFQIYRWSPENPQK-PELQEYEIDL  216
            ++++ + +++L  RA +S  +  QA    K   +K+F+IYRW+P+ P+K PEL+ ++IDL
Sbjct  5    LTATRSNQLSLGKRAFSSSVSRWQAVPQQKPVLMKEFKIYRWNPDQPEKKPELESFKIDL  64

Query  217  KECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKIS--SGPDS  390
             + GPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+N LACL +I      D+
Sbjct  65   NQTGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDREGSKDT  124

Query  391  MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYE  570
             + PLPHM+V+KDLV DMT FY QYKSI+PWL+  NPP   G E LQS  DR KLDGMYE
Sbjct  125  KIYPLPHMYVVKDLVPDMTLFYKQYKSIQPWLQNDNPP--SGTEHLQSPEDRKKLDGMYE  182

Query  571  CILCACCSTSCP  606
            CILCACCSTSCP
Sbjct  183  CILCACCSTSCP  194



>emb|CEJ90179.1| Putative Succinate dehydrogenase iron-sulfur protein [Torrubiella 
hemipterigena]
Length=277

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 148/199 (74%), Gaps = 7/199 (4%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPEL  195
            +S+ V  A ++ +  PA     + A  SE   P A  + K+K FQIYRW+P+ P +KP+L
Sbjct  6    SSTRVLSATSRSAIRPATVFARSMASVSE---PAAEKTPKLKTFQIYRWNPDTPTEKPKL  62

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q Y IDL + GPM+LDALI++KNE+DPTLTFRRSCREGICGSCAMNI+G+N LACL +I 
Sbjct  63   QSYTIDLNKTGPMILDALIRVKNELDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIP  122

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
              S  D  + PLPH +V+KDLV D+T+FY QYKSI+P+L+R  P P  GKE  QSK DR 
Sbjct  123  AESSSDVKIYPLPHTYVVKDLVPDLTHFYKQYKSIKPYLQRDTPAP-DGKEYRQSKEDRK  181

Query  550  KLDGMYECILCACCSTSCP  606
            KLDG+YECILCACCSTSCP
Sbjct  182  KLDGLYECILCACCSTSCP  200



>ref|XP_572035.1| succinate dehydrogenase iron-sulfur subunit [Cryptococcus neoformans 
var. neoformans JEC21]
 ref|XP_774483.1| hypothetical protein CNBG1290 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL19836.1| hypothetical protein CNBG1290 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW44728.1| succinate dehydrogenase iron-sulfur subunit, putative [Cryptococcus 
neoformans var. neoformans JEC21]
Length=280

 Score =   241 bits (615),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 9/199 (5%)
 Frame = +1

Query  31   VRRAITKVSSSPAAKMTLARAHASEANAPQAT----ASAKIKKFQIYRWSPENP-QKPEL  195
            V R++  + S+       AR+  + A+A  AT        IK+F+IYRW+P+ P +KP+L
Sbjct  7    VLRSLNAIPSTSRPLAAAARSFHATASAQLATPVEGKQPPIKEFKIYRWNPDVPNEKPKL  66

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q Y+IDL +CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I 
Sbjct  67   QTYKIDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIP  126

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
              +  DS + PLPHM+V+KDLV D+T+FY QYK+IEP+LK  NPP     E LQS+ADR 
Sbjct  127  KDTSKDSKIYPLPHMYVVKDLVPDLTHFYKQYKAIEPYLKNDNPP--EKGEFLQSQADRK  184

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCS SCP
Sbjct  185  KLDGMYECILCACCSASCP  203



>dbj|GAM84698.1| hypothetical protein ANO11243_026970 [fungal sp. No.11243]
Length=291

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 146/203 (72%), Gaps = 5/203 (2%)
 Frame = +1

Query  10   PAMASSLVRRAITKVSSSPA-AKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-Q  183
            P  A S+ RRA+   +  P+  +  +  +  S    P     AKIK F IYRW+P+ P  
Sbjct  14   PRAAPSVFRRAMATATEVPSPNRGVVPDSKTSTVKEPAPEKEAKIKTFHIYRWNPDEPTS  73

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KP +Q Y +DL + GPM+LDALI+IKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL
Sbjct  74   KPRMQSYTLDLNKTGPMMLDALIRIKNEVDPTLTFRRSCREGICGSCAMNIDGVNTLACL  133

Query  364  TKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
             +I   +  +S + PLPH +V+KDLV DMT+FY QYKSI+P+L+R  P P  G+E  QSK
Sbjct  134  CRIPTETTKESRIYPLPHTYVVKDLVPDMTHFYKQYKSIKPYLQRDTPAP-DGREFRQSK  192

Query  538  ADRSKLDGMYECILCACCSTSCP  606
            ADR KLDG+YECILCACCSTSCP
Sbjct  193  ADRKKLDGLYECILCACCSTSCP  215



>gb|KIR49148.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii CA1280]
 gb|KIR68207.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii CA1873]
Length=280

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 149/199 (75%), Gaps = 9/199 (5%)
 Frame = +1

Query  31   VRRAITKVSSSPAAKMTLARAHASEANAPQAT----ASAKIKKFQIYRWSPENP-QKPEL  195
            + R+   + S+       AR+  + A+A  AT       +IK+F+IYRW+P+ P +KP+L
Sbjct  7    ILRSFNAIPSTSRPLAAAARSFHATASAQLATPVEGKEPQIKEFKIYRWNPDVPNEKPKL  66

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q Y++DL +CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I 
Sbjct  67   QTYKVDLSQCGPMILDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIP  126

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
              +  +S + PLPHM+V+KDLV D+T FY QYKSIEP+LK  NPP     E LQS+ADR 
Sbjct  127  KDTSKESKIYPLPHMYVVKDLVPDLTYFYKQYKSIEPYLKNDNPP--EKGEFLQSQADRK  184

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCST+CP
Sbjct  185  KLDGMYECILCACCSTACP  203



>gb|KIM43854.1| hypothetical protein M413DRAFT_390042 [Hebeloma cylindrosporum 
h7]
Length=270

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 148/192 (77%), Gaps = 9/192 (5%)
 Frame = +1

Query  52   VSSSPAAKMTLA-RAHASEANAPQATASAK---IKKFQIYRWSPENPQK-PELQEYEIDL  216
            ++++ + +++L  RA +S  +  QA    K   +K+F+IYRW+P+ P+K PEL+ ++IDL
Sbjct  5    LTATRSNQLSLGKRAFSSSVSRWQAVPQQKPVLMKEFKIYRWNPDQPEKKPELESFKIDL  64

Query  217  KECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKIS--SGPDS  390
             + GPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+N LACL +I      D+
Sbjct  65   NQTGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDREGSKDT  124

Query  391  MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYE  570
             + PLPHM+V+KDLV DMT FY QYKSI+PWL+  NPP   G E LQS  DR KLDGMYE
Sbjct  125  KIYPLPHMYVVKDLVPDMTLFYKQYKSIQPWLQNDNPP--SGTEHLQSPEDRKKLDGMYE  182

Query  571  CILCACCSTSCP  606
            CILCACCSTSCP
Sbjct  183  CILCACCSTSCP  194



>ref|XP_004544823.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Maylandia zebra]
Length=283

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 144/201 (72%), Gaps = 8/201 (4%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKP  189
            A  +SL R  +    S PA  + +  A  + A A Q     ++KKFQ+YRW PE P  KP
Sbjct  4    ASFTSLTRCGVLAFRS-PAGLLAVRYAQTAAAPAGQP----RVKKFQVYRWDPETPGDKP  58

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             +Q YEIDL  CGPMVLD LIKIKNEIDPTLTFRRSCREGICGSCAMNI+G N LACL K
Sbjct  59   RMQTYEIDLNTCGPMVLDVLIKIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNK  118

Query  370  ISSGPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            I S     + + PLPHM+V+KDLV DM+NFY QYKSIEP+LK+K+      ++ LQS  D
Sbjct  119  IDSSLSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESKEGKEQYLQSVED  178

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDG+YECILCACCSTSCP
Sbjct  179  REKLDGLYECILCACCSTSCP  199



>gb|KDR70285.1| hypothetical protein GALMADRAFT_255190 [Galerina marginata CBS 
339.88]
Length=270

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 148/192 (77%), Gaps = 9/192 (5%)
 Frame = +1

Query  52   VSSSPAAKMTLA-RAHASEANAPQATASAK---IKKFQIYRWSPENPQK-PELQEYEIDL  216
            V+++ + ++ L  RA +S  +  QA    K   +K+F+IYRW+P+ P+K PELQ ++IDL
Sbjct  5    VAATRSRQLALGKRAFSSSLSRWQAVPQEKPVLMKEFKIYRWNPDQPEKKPELQSFKIDL  64

Query  217  KECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKIS--SGPDS  390
             + GPM+LDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG+N LACL +I    G ++
Sbjct  65   NQTGPMILDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDREGGKNT  124

Query  391  MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYE  570
             + PLPHM+V+KDLV DMT FY QYKSI+PWL+ +NPP     E LQS  DR KLDGMYE
Sbjct  125  KIYPLPHMYVVKDLVPDMTLFYKQYKSIQPWLQNENPP--EQGEFLQSPEDRRKLDGMYE  182

Query  571  CILCACCSTSCP  606
            CILCACCSTSCP
Sbjct  183  CILCACCSTSCP  194



>ref|XP_002050487.1| GJ22180 [Drosophila virilis]
 gb|EDW61680.1| GJ22180 [Drosophila virilis]
Length=296

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 152/205 (74%), Gaps = 8/205 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANA---PQATASAKIKKFQIYRWSPENP-Q  183
            M  +  R+ +++ SS  A     A ++ ++      P+A    +IKKF+IYRWSP+N  +
Sbjct  1    MLVNEARQVLSRASSLAARHQLRAISNTTQLEQQAQPKAAQEPQIKKFEIYRWSPDNAGE  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KP +Q YE++++ECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNI G N LAC+
Sbjct  61   KPHMQTYEVNMRECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGVNTLACI  120

Query  364  TKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP-PIPGK-EVLQ  531
            +KI  +S     V PLPHM+V++DLV DM NFY QYK+I+PWL+RKN      GK + LQ
Sbjct  121  SKIDATSSKPLKVYPLPHMYVVRDLVPDMNNFYEQYKNIQPWLQRKNEAVEQKGKAQYLQ  180

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            S  DRSKLDG+YECILCACCST+CP
Sbjct  181  SVEDRSKLDGLYECILCACCSTACP  205



>ref|XP_011307280.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial [Fopius arisanus]
Length=279

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 141/187 (75%), Gaps = 4/187 (2%)
 Frame = +1

Query  55   SSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGP  231
            S  PA +    +  +  A++ Q  A A++K F IYRW+P+ P +KP +Q+Y +DL  CGP
Sbjct  3    SIRPAWRQCFQQVRSLHASSCQ-NAEARLKTFSIYRWNPDKPDEKPYMQDYSVDLNTCGP  61

Query  232  MVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSG--PDSMVTPL  405
            MVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNI G N LAC++KI S     S + PL
Sbjct  62   MVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDSDVKSSSKIYPL  121

Query  406  PHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCA  585
            PHM+++KDLV DM NFYNQY+SI+PWL+R +   +  ++ LQS  DR KLDG+YECILCA
Sbjct  122  PHMYIVKDLVPDMNNFYNQYRSIQPWLQRTDGKKVGTQQYLQSVDDRKKLDGLYECILCA  181

Query  586  CCSTSCP  606
            CCSTSCP
Sbjct  182  CCSTSCP  188



>ref|XP_002988385.1| hypothetical protein SELMODRAFT_47515, partial [Selaginella moellendorffii]
 gb|EFJ10475.1| hypothetical protein SELMODRAFT_47515, partial [Selaginella moellendorffii]
Length=234

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 128/160 (80%), Gaps = 1/160 (1%)
 Frame = +1

Query  130  SAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREG  309
            S+ IK+F IYRW+P+    P+ Q Y+IDL +CGPMVLDALIKIKNE+D  LTFRRSCREG
Sbjct  2    SSNIKEFSIYRWNPDGSSNPQQQVYKIDLNDCGPMVLDALIKIKNEVDQGLTFRRSCREG  61

Query  310  ICGSCAMNIDGKNGLACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWL  486
            ICGSCAMNI+GKN LACLTKI      + V PLPHM+VIKDLVVD+TNFY QYKS+EPWL
Sbjct  62   ICGSCAMNINGKNALACLTKIEKDAAQTSVLPLPHMYVIKDLVVDLTNFYQQYKSVEPWL  121

Query  487  KRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            K K       KE LQSK +R KLDGMYECILCACC++SCP
Sbjct  122  KTKTMLEAGQKEHLQSKKERLKLDGMYECILCACCTSSCP  161



>ref|XP_001838873.1| succinate dehydrogenase iron-sulfur subunit [Coprinopsis cinerea 
okayama7#130]
 gb|EAU82988.1| succinate dehydrogenase iron-sulfur subunit [Coprinopsis cinerea 
okayama7#130]
 gb|ACA25433.1| succinate dehydrogenase [Coprinopsis cinerea]
Length=266

 Score =   240 bits (612),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 142/182 (78%), Gaps = 10/182 (5%)
 Frame = +1

Query  70   AKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDA  246
            A++TLAR  A+    P       +K+F+IYRW+P+ P+ KP+L+ Y+IDL + GPM+LDA
Sbjct  16   ARLTLARTLATATEKP-----VLLKEFKIYRWNPDKPEEKPKLESYKIDLNQTGPMILDA  70

Query  247  LIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHMFV  420
            LIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+N LACL +I  ++  D+ + PLPHM++
Sbjct  71   LIKIKNEVDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDRNASKDTKIYPLPHMYI  130

Query  421  IKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTS  600
            +KDLV DMT FY QYKSI+PWL+  NPP     E LQS  DR KLDG+YECILCACCSTS
Sbjct  131  VKDLVPDMTQFYKQYKSIQPWLQNDNPP--EKGEHLQSPEDRKKLDGLYECILCACCSTS  188

Query  601  CP  606
            CP
Sbjct  189  CP  190



>ref|XP_572036.1| succinate dehydrogenase iron-sulfur subunit [Cryptococcus neoformans 
var. neoformans JEC21]
 gb|AAW44729.1| succinate dehydrogenase iron-sulfur subunit, putative [Cryptococcus 
neoformans var. neoformans JEC21]
Length=289

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 9/199 (5%)
 Frame = +1

Query  31   VRRAITKVSSSPAAKMTLARAHASEANAPQAT----ASAKIKKFQIYRWSPENP-QKPEL  195
            V R++  + S+       AR+  + A+A  AT        IK+F+IYRW+P+ P +KP+L
Sbjct  7    VLRSLNAIPSTSRPLAAAARSFHATASAQLATPVEGKQPPIKEFKIYRWNPDVPNEKPKL  66

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q Y+IDL +CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I 
Sbjct  67   QTYKIDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIP  126

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
              +  DS + PLPHM+V+KDLV D+T+FY QYK+IEP+LK  NPP     E LQS+ADR 
Sbjct  127  KDTSKDSKIYPLPHMYVVKDLVPDLTHFYKQYKAIEPYLKNDNPP--EKGEFLQSQADRK  184

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCS SCP
Sbjct  185  KLDGMYECILCACCSASCP  203



>gb|KIR52001.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii Ru294]
Length=280

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 149/199 (75%), Gaps = 9/199 (5%)
 Frame = +1

Query  31   VRRAITKVSSSPAAKMTLARAHASEANAPQAT----ASAKIKKFQIYRWSPENP-QKPEL  195
            + R+   + S+       AR+  + A+A  AT       +IK+F+IYRW+P+ P +KP+L
Sbjct  7    ILRSFNAIPSTSRPVAAAARSFHATASAQLATPVEGKEPQIKEFKIYRWNPDVPNEKPKL  66

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q Y++DL +CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I 
Sbjct  67   QTYKVDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIP  126

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
              +  +S + PLPHM+V+KDLV D+T FY QYKSIEP+LK  NPP     E LQS+ADR 
Sbjct  127  KDTSKESKIYPLPHMYVVKDLVPDLTLFYKQYKSIEPYLKNDNPP--AKGEFLQSQADRK  184

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCSTSCP
Sbjct  185  KLDGMYECILCACCSTSCP  203



>gb|KIK01904.1| hypothetical protein K443DRAFT_678046 [Laccaria amethystina LaAM-08-1]
Length=263

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 138/179 (77%), Gaps = 8/179 (4%)
 Frame = +1

Query  88   RAHASEANAPQATASAK---IKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIK  255
            RA +S A   QA  + K    K+F+IYRW+P+ P  KP LQ Y+IDL + GPM+LDALIK
Sbjct  11   RAFSSSARKFQAVPTQKPVLEKEFKIYRWNPDEPATKPTLQSYKIDLNQTGPMILDALIK  70

Query  256  IKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGP--DSMVTPLPHMFVIKD  429
            IKNEIDPTLTFRRSCREGICGSCAMNIDG+N LACL +I   P  D+ + PLPHM+++KD
Sbjct  71   IKNEIDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDREPSKDTKIYPLPHMYIVKD  130

Query  430  LVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            LV D+T FY QYKSIEPWL+  NPP     E LQS+ DR KLDGMYECILCACCSTSCP
Sbjct  131  LVPDLTLFYKQYKSIEPWLQNDNPP--AEGEFLQSQEDRKKLDGMYECILCACCSTSCP  187



>gb|KIJ49079.1| hypothetical protein M422DRAFT_28092 [Sphaerobolus stellatus 
SS14]
Length=273

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 143/201 (71%), Gaps = 11/201 (5%)
 Frame = +1

Query  22   SSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENPQK-P  189
            S + R A   +   P  +    R  A+     QA  + K    K F+IYRW+P+ P+K P
Sbjct  2    SGVARAAFRNI---PVRRALTTRTFATSVARTQAVPTEKPVLQKTFKIYRWNPDEPEKKP  58

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             LQEY++DL +CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+N LACL +
Sbjct  59   TLQEYKVDLNQCGPMILDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGQNTLACLCR  118

Query  370  ISSGP--DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            I   P  DS + PLPHM+++KDLV D+T FY QYKSIEP+LK  NPP     E LQS   
Sbjct  119  IDREPSKDSKIYPLPHMYIVKDLVPDLTQFYKQYKSIEPYLKNDNPPAT--GEFLQSPEQ  176

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDG+YECILCACCSTSCP
Sbjct  177  RRKLDGLYECILCACCSTSCP  197



>ref|XP_003195122.1| succinate dehydrogenase iron-sulfur subunit [Cryptococcus gattii 
WM276]
 gb|ADV23335.1| Succinate dehydrogenase iron-sulfur subunit, putative [Cryptococcus 
gattii WM276]
 gb|KIR77927.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii EJB2]
 gb|KIY32010.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii E566]
 gb|KJE03276.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cryptococcus gattii NT-10]
Length=280

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 149/199 (75%), Gaps = 9/199 (5%)
 Frame = +1

Query  31   VRRAITKVSSSPAAKMTLARAHASEANAPQAT----ASAKIKKFQIYRWSPENP-QKPEL  195
            + R+   + S+       AR+  + A+A  AT       +IK+F+IYRW+P+ P +KP+L
Sbjct  7    ILRSFNAIPSTSRPLAAAARSFHATASAQLATPVEGKEPQIKEFKIYRWNPDVPNEKPKL  66

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q Y++DL +CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I 
Sbjct  67   QTYKVDLSQCGPMMLDALIKIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIP  126

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
              +  +S + PLPHM+V+KDLV D+T FY QYKSIEP+LK  NPP     E LQS+ADR 
Sbjct  127  KDTSKESKIYPLPHMYVVKDLVPDLTLFYKQYKSIEPYLKNDNPP--AKGEFLQSQADRK  184

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCSTSCP
Sbjct  185  KLDGMYECILCACCSTSCP  203



>gb|AAY63983.1| succinate dehydrogenase iron sulfur subunit B [Lysiphlebus testaceipes]
Length=279

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = +1

Query  61   SPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMV  237
            +PA +  L +  +   +A Q  A A++K F IYRW+P+ P  KP +QEY++DL +CGPMV
Sbjct  5    APACRNALKQVRSFHVSAVQ-NAEARLKTFSIYRWNPDKPDDKPTMQEYKVDLNKCGPMV  63

Query  238  LDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPH  411
            LDALIKIKNEIDP+LTFRRSCREGICGSCAMNI G N LAC++KI   +   S + PLPH
Sbjct  64   LDALIKIKNEIDPSLTFRRSCREGICGSCAMNIGGTNTLACISKIDNDTSKKSKIYPLPH  123

Query  412  MFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACC  591
            M+++KDLV DM+NFY QYKSI+PWL+R +   +  ++ LQS  DR KLDG+YECILCACC
Sbjct  124  MYIVKDLVPDMSNFYAQYKSIQPWLQRDDNKKVGTQQYLQSVEDRKKLDGLYECILCACC  183

Query  592  STSCP  606
            STSCP
Sbjct  184  STSCP  188



>ref|NP_477101.1| succinate dehydrogenase B [Drosophila melanogaster]
 ref|XP_002080335.1| GD10425 [Drosophila simulans]
 sp|P21914.2|SDHB_DROME RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur 
subunit, mitochondrial; AltName: Full=Iron-sulfur subunit 
of complex II; Short=Ip; Flags: Precursor [Drosophila melanogaster]
 gb|AAA61925.1| succinate dehydrogenase iron-protein subunit [Drosophila melanogaster]
 gb|AAF57396.1| succinate dehydrogenase B [Drosophila melanogaster]
 gb|AAM50783.1| LD23740p [Drosophila melanogaster]
 gb|EDX05920.1| GD10425 [Drosophila simulans]
 gb|ACL84491.1| SdhB-PA, partial [synthetic construct]
 gb|ACL89428.1| SdhB-PA [synthetic construct]
Length=297

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 149/200 (75%), Gaps = 12/200 (6%)
 Frame = +1

Query  22   SSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQ  198
             SLV R   +  S+  A++   +A   EA  PQ      IKKF+IYRW+P+N  +KP +Q
Sbjct  14   GSLVARNQMRAISNGTAQLE-QQAQPKEAQEPQ------IKKFEIYRWNPDNAGEKPYMQ  66

Query  199  EYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK--I  372
             YE+DL+ECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI G N LAC++K  I
Sbjct  67   TYEVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDI  126

Query  373  SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP-PIPGK-EVLQSKADR  546
            ++     V PLPHM+V++DLV DM NFY QY++I+PWL+RKN      GK + LQS  DR
Sbjct  127  NTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAGEKKGKAQYLQSVEDR  186

Query  547  SKLDGMYECILCACCSTSCP  606
            SKLDG+YECILCACCSTSCP
Sbjct  187  SKLDGLYECILCACCSTSCP  206



>ref|XP_002433069.1| succinate dehydrogenase, iron-sulfur subunit [Pediculus humanus 
corporis]
 gb|EEB20331.1| succinate dehydrogenase, iron-sulfur subunit [Pediculus humanus 
corporis]
Length=292

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 140/199 (70%), Gaps = 6/199 (3%)
 Frame = +1

Query  28   LVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK-----IKKFQIYRWSPEN-PQKP  189
            +V   + +  S      ++ R H+S+A    A    K      K F IYRW P+   +KP
Sbjct  1    MVWEFVIRFRSLSPTYSSVRRLHSSKALLAAAREEVKEKSPQYKTFSIYRWDPDAVNEKP  60

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             +Q YE+DL  CGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNI G N LAC++K
Sbjct  61   RMQSYEVDLNSCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGVNTLACISK  120

Query  370  ISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
            IS    + + PLPHM+V+KDLV DMTNFYNQYKSI+PWL+RKN      ++ LQS  DR 
Sbjct  121  ISQSGTTKIYPLPHMYVVKDLVPDMTNFYNQYKSIQPWLQRKNEAEPGTEQYLQSVKDRD  180

Query  550  KLDGMYECILCACCSTSCP  606
             LDG+YECILCACCSTSCP
Sbjct  181  VLDGLYECILCACCSTSCP  199



>ref|XP_002089380.1| GE19076 [Drosophila yakuba]
 gb|EDW89092.1| GE19076 [Drosophila yakuba]
Length=297

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 149/200 (75%), Gaps = 12/200 (6%)
 Frame = +1

Query  22   SSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQ  198
             SLV R   +  S+  A++   +A   EA  PQ      IKKF+IYRW+P+N  +KP +Q
Sbjct  14   GSLVARNQLRAISNGTAQLE-QQAQPKEAQEPQ------IKKFEIYRWNPDNAGEKPYMQ  66

Query  199  EYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK--I  372
             YE+DL+ECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI G N LAC++K  I
Sbjct  67   TYEVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDI  126

Query  373  SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP-PIPGK-EVLQSKADR  546
            ++     V PLPHM+V++DLV DM NFY QY++I+PWL+RKN      GK + LQS  DR
Sbjct  127  NTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAGEKKGKAQYLQSVEDR  186

Query  547  SKLDGMYECILCACCSTSCP  606
            SKLDG+YECILCACCSTSCP
Sbjct  187  SKLDGLYECILCACCSTSCP  206



>ref|XP_002032650.1| GM20899 [Drosophila sechellia]
 gb|EDW46663.1| GM20899 [Drosophila sechellia]
Length=297

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 149/201 (74%), Gaps = 12/201 (6%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPEL  195
              SLV R   +  S+  A++   +A   EA  PQ      IKKF+IYRW+P+N  +KP +
Sbjct  13   VGSLVARNQMRAISNGTAQLE-QQAQPKEAQEPQ------IKKFEIYRWNPDNAGEKPYM  65

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK--  369
            Q YE+DL+ECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI G N LAC++K  
Sbjct  66   QTYEVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACISKID  125

Query  370  ISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP-PIPGK-EVLQSKAD  543
            I++     V PLPHM+V++DLV DM NFY QY++I+PWL+RKN      GK + LQS  D
Sbjct  126  INTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAGEKKGKAQYLQSVED  185

Query  544  RSKLDGMYECILCACCSTSCP  606
            RSKLDG+YECILCACCSTSCP
Sbjct  186  RSKLDGLYECILCACCSTSCP  206



>ref|XP_003005289.1| succinate dehydrogenase iron-sulfur subunit [Verticillium alfalfae 
VaMs.102]
 gb|EEY18786.1| succinate dehydrogenase iron-sulfur subunit [Verticillium alfalfae 
VaMs.102]
Length=274

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 146/197 (74%), Gaps = 6/197 (3%)
 Frame = +1

Query  31   VRRAITKVSSS---PAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQ  198
            +R + T+V  S   PA +  L     +  N P  T   K+K FQIYRW+P+ P +KP +Q
Sbjct  4    LRSSSTRVLGSAVRPAFRPALFARTMATVNEPATTPEPKMKSFQIYRWNPDQPTEKPRMQ  63

Query  199  EYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-S  375
             Y +DL + GPMVLDAL++IKNEIDPTLTFRRSCREGICGSCAMNI+G+N LACL +I +
Sbjct  64   TYTLDLNKTGPMVLDALVRIKNEIDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIPT  123

Query  376  SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKL  555
              P+  + PLPH +V+KDLV D+T FY QYKSI+P+L+R  P P  GKE  Q+KADR KL
Sbjct  124  ETPEMKIYPLPHTYVVKDLVPDLTQFYKQYKSIKPYLQRDTPSP-DGKEYRQTKADRRKL  182

Query  556  DGMYECILCACCSTSCP  606
            DG+YECILCACCSTSCP
Sbjct  183  DGLYECILCACCSTSCP  199



>ref|XP_001360158.1| GA17170 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002015525.1| GL11120 [Drosophila persimilis]
 gb|EAL24732.1| GA17170 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW31415.1| GL11120 [Drosophila persimilis]
Length=297

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 149/201 (74%), Gaps = 12/201 (6%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPEL  195
            ASSL  R   +  S+  A++   +A   EA  PQ      IKKF+IYRWSP+N  +KP +
Sbjct  13   ASSLAARHQLRAISNGTAQLD-QQAQPKEAKEPQ------IKKFEIYRWSPDNAGEKPHM  65

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKIS  375
            Q YE++L++CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI G N LAC++KI 
Sbjct  66   QTYEVNLRDCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGINTLACISKID  125

Query  376  SGPDS--MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP-PIPGK-EVLQSKAD  543
            +       V PLPHM+V++DLV DM NFY QYK+I+PWL+RKN      G+ + LQS  D
Sbjct  126  TNTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYKNIQPWLQRKNEAGEKKGRAQYLQSVED  185

Query  544  RSKLDGMYECILCACCSTSCP  606
            RSKLDG+YECILCACCSTSCP
Sbjct  186  RSKLDGLYECILCACCSTSCP  206



>ref|XP_008292151.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Stegastes partitus]
Length=281

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPE  192
            M++  + R ++ + SS    + + R HA  A AP      +IKKFQIYRW P+    KP 
Sbjct  1    MSAVCLSRNVSSIKSSGVMVIQMVR-HAQTAAAP--APEPRIKKFQIYRWDPDTSGDKPR  57

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            +Q Y+IDL  CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G N LACL KI
Sbjct  58   MQTYDIDLNNCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGGNTLACLNKI  117

Query  373  SSGPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADR  546
             +     + + PLPHM+V+KDLV DM+NFY QYKSIEP+LK+K+      ++  QS  DR
Sbjct  118  DTNTSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDEAQEGKEQYFQSVEDR  177

Query  547  SKLDGMYECILCACCSTSCP  606
             KLDG+YECILCACCSTSCP
Sbjct  178  QKLDGLYECILCACCSTSCP  197



>ref|XP_003485289.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Bombus impatiens]
Length=277

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = +1

Query  67   AAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLD  243
            A K  L +      +A Q  A+AK+K F +YRW+P+ P +KP +QEY++DL  CGPM+LD
Sbjct  8    ACKNALRQVRRFHISANQ-NAAAKLKTFAVYRWNPDKPDEKPYMQEYKVDLNTCGPMILD  66

Query  244  ALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPDSM--VTPLPHMF  417
            ALIKIKNEIDPTLTFRRSCREGICGSCAMNI G N LAC++KI +  +S   + PLPHM+
Sbjct  67   ALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDTDTNSTSKIYPLPHMY  126

Query  418  VIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCST  597
            ++KDLV D+ NFYNQYKSI+PWL+R +      K+ LQS  DR KLDG+YECILCACCST
Sbjct  127  IVKDLVPDLNNFYNQYKSIQPWLQRGDGQESGSKQYLQSVEDRKKLDGLYECILCACCST  186

Query  598  SCP  606
            SCP
Sbjct  187  SCP  189



>ref|XP_001793919.1| hypothetical protein SNOG_03351 [Phaeosphaeria nodorum SN15]
 gb|EAT88556.1| hypothetical protein SNOG_03351 [Phaeosphaeria nodorum SN15]
Length=306

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 149/207 (72%), Gaps = 7/207 (3%)
 Frame = +1

Query  4    GFPAMASSLVRRAITKVSSS---PAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPE  174
            GF +++    R  I+K + +    AA+  +     S    P+    AK+K F IYRW+P+
Sbjct  25   GFASVSDVHAREPISKTAEAIVPDAARKPVPETKTSTQGEPELEKGAKVKTFHIYRWNPD  84

Query  175  NP-QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNG  351
             P  KP++Q YE+DL + GPM+LDALI+IKNE+DPTLTFRRSCREGICGSCAMNIDG N 
Sbjct  85   EPTSKPKMQSYELDLNKTGPMMLDALIRIKNEVDPTLTFRRSCREGICGSCAMNIDGVNT  144

Query  352  LACLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEV  525
            LACL +I   +  ++ + PLPHM+V+KDLV DMT FY QY+S++P+L+R  P P  G+E 
Sbjct  145  LACLCRIPTDTAKETRIYPLPHMYVVKDLVPDMTLFYKQYRSVKPYLQRTTPAP-DGREY  203

Query  526  LQSKADRSKLDGMYECILCACCSTSCP  606
             Q+K DR KLDG+YECILCACCSTSCP
Sbjct  204  RQTKEDRKKLDGLYECILCACCSTSCP  230



>emb|CDR47313.1| CYFA0S31e00210g1_1 [Cyberlindnera fabianii]
Length=272

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 148/190 (78%), Gaps = 12/190 (6%)
 Frame = +1

Query  55   SSSPAAKMTLA---RAHASEANAPQATASAKIKKFQIYRWSPENPQ-KPELQEYEIDLKE  222
            S+  A + T+A   R  A+ A+ P     A +K F+IYRWSP++PQ KP+LQEY+I+L E
Sbjct  13   STRAATRATMALNSRGLATTADKP-----ALMKTFKIYRWSPDHPQEKPKLQEYKINLNE  67

Query  223  CGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD--SMV  396
            CGPMVLDALIKIKNE D TLTFRRSCREGICGSCAMNI G+N LACL +I +  +  + +
Sbjct  68   CGPMVLDALIKIKNEQDATLTFRRSCREGICGSCAMNIGGRNTLACLCRIDTNVNKTTKI  127

Query  397  TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECI  576
             PLPHMFV+KDLV D+T+FY QYKSI+P+L+R + P   GKE LQS ADR KLDG+YECI
Sbjct  128  YPLPHMFVVKDLVPDLTHFYKQYKSIQPYLQRDSVPE-DGKENLQSIADRKKLDGLYECI  186

Query  577  LCACCSTSCP  606
            LCACCSTSCP
Sbjct  187  LCACCSTSCP  196



>ref|XP_002004991.1| GI19303 [Drosophila mojavensis]
 gb|EDW08926.1| GI19303 [Drosophila mojavensis]
Length=296

 Score =   240 bits (612),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 152/205 (74%), Gaps = 8/205 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANA---PQATASAKIKKFQIYRWSPENP-Q  183
            M  +  R+ +++ SS  A     A ++ ++      P+A    +IKKF+IYRW+P+N  +
Sbjct  1    MLVNEARQVLSRASSLAARHQLRAISNTTQLEQQAQPKAAQEPQIKKFEIYRWNPDNAGE  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KP +Q YEI+++ECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI G N LAC+
Sbjct  61   KPYMQTYEINMRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACI  120

Query  364  TKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP-PIPGK-EVLQ  531
            +KI  +S     V PLPHM+V++DLV DM NFY QYK+I+PWL+RKN      GK + LQ
Sbjct  121  SKIDATSSKPLKVYPLPHMYVVRDLVPDMNNFYEQYKNIQPWLQRKNEAGEKKGKAQYLQ  180

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            S  DRSKLDG+YECILCACCSTSCP
Sbjct  181  SVEDRSKLDGLYECILCACCSTSCP  205



>ref|WP_006954635.1| Succinate dehydrogenase iron-sulfur protein [Sphingobium japonicum]
 emb|CCW17539.1| Succinate dehydrogenase iron-sulfur protein [Sphingobium japonicum 
BiD32]
Length=262

 Score =   239 bits (609),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  115  PQATASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRR  294
            P    + K++ F++YR+ P++ Q P    YEIDL  CGPMVLDALIKIKNE DPTLTFRR
Sbjct  20   PAPAGATKVRSFKVYRYDPDSGQNPRYDTYEIDLDSCGPMVLDALIKIKNEYDPTLTFRR  79

Query  295  SCREGICGSCAMNIDGKNGLACLTKIS--SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYK  468
            SCREGICGSC+MN++GKNGLAC T I   SG D  +TPLPHM VIKDLV D T+FY QY 
Sbjct  80   SCREGICGSCSMNMNGKNGLACTTAIEECSGKDVRITPLPHMDVIKDLVPDFTHFYAQYN  139

Query  469  SIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            SI+PWLK  +PPP  GKE LQS ADR KLDG+YECILCACCSTSCP
Sbjct  140  SIQPWLKTVSPPP-SGKERLQSPADREKLDGLYECILCACCSTSCP  184



>ref|XP_005741497.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Pundamilia nyererei]
 ref|XP_005941543.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Haplochromis burtoni]
Length=283

 Score =   239 bits (611),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 144/201 (72%), Gaps = 8/201 (4%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKP  189
            A  +SL R  +    S PA  + +  A  + A A Q     ++KKFQ+YRW P+ P  KP
Sbjct  4    ASFTSLTRCGVLAFRS-PAGLLAVRYAQTAAAPAGQP----RVKKFQVYRWDPDTPGDKP  58

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             +Q YEIDL  CGPMVLD LIKIKNEIDPTLTFRRSCREGICGSCAMNI+G N LACL K
Sbjct  59   RMQTYEIDLNTCGPMVLDVLIKIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNK  118

Query  370  ISSGPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            I S     + + PLPHM+V+KDLV DM+NFY QYKSIEP+LK+K+      ++ LQS  D
Sbjct  119  IDSSLSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESKEGKEQYLQSVED  178

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDG+YECILCACCSTSCP
Sbjct  179  RQKLDGLYECILCACCSTSCP  199



>gb|EMF10018.1| succinate dehydrogenase iron-sulfur protein,mitochondrial precursor 
[Sphaerulina musiva SO2202]
Length=300

 Score =   240 bits (612),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 144/188 (77%), Gaps = 7/188 (4%)
 Frame = +1

Query  61   SPAAKMTLARAHASEANA---PQATASAKIKKFQIYRWSPENPQ-KPELQEYEIDLKECG  228
            S A   + A   AS++N    P A  +AKIK FQIYRW+P+ PQ KP++Q Y +DL + G
Sbjct  38   SEATSASTAPKPASQSNTIRDPTADPNAKIKTFQIYRWNPDEPQTKPKMQSYTLDLNKTG  97

Query  229  PMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTP  402
            PM+LDALI+IKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I   +  +S + P
Sbjct  98   PMMLDALIRIKNEVDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIPTDTAKESRIYP  157

Query  403  LPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILC  582
            LPH +V+KDLV D+T FY QYKSI+P+L+R + P   GKEV QSK DR KLDGMYECILC
Sbjct  158  LPHTYVVKDLVPDLTQFYKQYKSIKPYLQRDSLPE-DGKEVRQSKEDRRKLDGMYECILC  216

Query  583  ACCSTSCP  606
            ACCSTSCP
Sbjct  217  ACCSTSCP  224



>ref|WP_017182650.1| succinate dehydrogenase iron-sulfur subunit [Sphingobium xenophagum]
Length=262

 Score =   239 bits (609),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  115  PQATASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRR  294
            P    + K++ F++YR+ P++ Q P    YEIDL  CGPMVLDALIKIKNE DPTLTFRR
Sbjct  20   PAPAGATKVRSFKVYRYDPDSGQNPRYDTYEIDLDNCGPMVLDALIKIKNEYDPTLTFRR  79

Query  295  SCREGICGSCAMNIDGKNGLACLTKIS--SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYK  468
            SCREGICGSC+MN++GKNGLAC T I   SG D  +TPLPHM VIKDLV D T+FY QY 
Sbjct  80   SCREGICGSCSMNMNGKNGLACTTAIEECSGKDVRITPLPHMDVIKDLVPDFTHFYAQYN  139

Query  469  SIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            SI+PWLK  +PPP  GKE LQS ADR KLDG+YECILCACCSTSCP
Sbjct  140  SIQPWLKTVSPPP-SGKERLQSPADREKLDGLYECILCACCSTSCP  184



>ref|XP_001987146.1| GH21756 [Drosophila grimshawi]
 gb|EDW02013.1| GH21756 [Drosophila grimshawi]
Length=296

 Score =   240 bits (612),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 154/205 (75%), Gaps = 8/205 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANA---PQATASAKIKKFQIYRWSPENP-Q  183
            M  +  R+ +++ SS  A     A +++S+      P+ + + +IKKF+IYRW+P+N  +
Sbjct  1    MLVNEARQILSRASSLAARHQLRAISNSSQLEQQAQPKESQAPQIKKFEIYRWNPDNAGE  60

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KP +Q YEI+++ECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI G N LAC+
Sbjct  61   KPYMQTYEINMRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACI  120

Query  364  TKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP-PIPGK-EVLQ  531
            +KI  +S     V PLPHM+V++DLV DM NFY QYK+I+PWL+RKN      GK + LQ
Sbjct  121  SKIDATSSKPLKVYPLPHMYVVRDLVPDMNNFYEQYKNIQPWLQRKNEAGEKKGKAQYLQ  180

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            S  DRSKLDG+YECILCACCSTSCP
Sbjct  181  SVEDRSKLDGLYECILCACCSTSCP  205



>gb|AEE63557.1| unknown [Dendroctonus ponderosae]
Length=228

 Score =   238 bits (606),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 136/171 (80%), Gaps = 7/171 (4%)
 Frame = +1

Query  115  PQATASAKIKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFR  291
            PQ     KIK   IYRW+P+ PQ KP +Q+Y++DL +CGPMVLDALIKIKNE+DPTLTFR
Sbjct  37   PQQQKPPKIKTVSIYRWNPDKPQQKPYMQDYKVDLSQCGPMVLDALIKIKNEMDPTLTFR  96

Query  292  RSCREGICGSCAMNIDGKNGLACLTKISS--GPDSMVTPLPHMFVIKDLVVDMTNFYNQY  465
            RSCREGICGSCAMNI G N LAC++KI +  G  + + PLPHM+V+KDLV DMTNFYNQY
Sbjct  97   RSCREGICGSCAMNIGGVNTLACISKIDTNLGKKAKIYPLPHMYVVKDLVPDMTNFYNQY  156

Query  466  KSIEPWLKRKNPPPIPG-KEV---LQSKADRSKLDGMYECILCACCSTSCP  606
            KSIEPWL+R +     G KEV   LQS  DR+KLDG+YECILCACCSTSCP
Sbjct  157  KSIEPWLQRDDAVAAKGTKEVTQYLQSVDDRAKLDGLYECILCACCSTSCP  207



>ref|XP_010773596.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial [Notothenia coriiceps]
Length=283

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 146/201 (73%), Gaps = 8/201 (4%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKP  189
            A  SSL R  +    S PA    +A  +A  A AP   A  +IKKFQIYRW P+ P  KP
Sbjct  4    ACLSSLSRCGVLSFRS-PAG--LVAVRYAQTAAAP--VAEPRIKKFQIYRWDPDTPGDKP  58

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             +Q Y+IDL  CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G N LACL K
Sbjct  59   RMQTYDIDLNTCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGGNTLACLNK  118

Query  370  ISSGPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            I +     S + PLPHM+V+KDLV DM+NFY QYKSIEP+LK+K+      ++ LQ+  D
Sbjct  119  IDTNTSKPSKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDEANEGKEQYLQTVED  178

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDG+YECILCACCSTSCP
Sbjct  179  RQKLDGLYECILCACCSTSCP  199



>ref|XP_009552678.1| hypothetical protein HETIRDRAFT_481926 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW75241.1| hypothetical protein HETIRDRAFT_481926 [Heterobasidion irregulare 
TC 32-1]
Length=271

 Score =   239 bits (609),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 143/200 (72%), Gaps = 13/200 (7%)
 Frame = +1

Query  25   SLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENPQK-PE  192
            SLV R  T      A      R   S A   QA  + K    K+F+IYRW+P+ P+K PE
Sbjct  3    SLVARCATNNFRRAAV-----RGFVSSAATRQAVPTEKPVLNKEFKIYRWNPDQPEKKPE  57

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            LQ Y I+L ECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNI+G+N LACL +I
Sbjct  58   LQSYNINLNECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNINGQNTLACLCRI  117

Query  373  --SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADR  546
              +   DS + PLPHM+++KDLV D+T FY QYKSIEP+L+  NPP     E LQS  DR
Sbjct  118  DRTENKDSKIYPLPHMYIVKDLVPDLTQFYKQYKSIEPYLQNDNPP--AQGEFLQSPEDR  175

Query  547  SKLDGMYECILCACCSTSCP  606
             KLDGMYECILCACCSTSCP
Sbjct  176  RKLDGMYECILCACCSTSCP  195



>ref|XP_005454159.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Oreochromis niloticus]
Length=279

 Score =   239 bits (610),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 138/183 (75%), Gaps = 6/183 (3%)
 Frame = +1

Query  67   AAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLD  243
            ++ M + R HA  A AP      +IKKFQ+YRW P+ P  KP +Q YEIDL  CGPMVLD
Sbjct  16   SSMMVMVR-HAQTAAAP--APEPRIKKFQVYRWDPDKPGDKPRMQTYEIDLNTCGPMVLD  72

Query  244  ALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD--SMVTPLPHMF  417
            ALIKIKNEIDPTLTFRRSCREGICGSCAMNI+G N LACL KI +     + + PLPHM+
Sbjct  73   ALIKIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNKIDTNTSKPTKIYPLPHMY  132

Query  418  VIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCST  597
            V+KDLV DM+NFY QYKSIEP+LK+K+      ++  QS  DR KLDG+YECILCACCST
Sbjct  133  VVKDLVPDMSNFYAQYKSIEPYLKKKDESQEGKEQYFQSVEDRQKLDGLYECILCACCST  192

Query  598  SCP  606
            SCP
Sbjct  193  SCP  195



>gb|AGO11201.1| AaceriACL065Cp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=261

 Score =   238 bits (608),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 143/188 (76%), Gaps = 7/188 (4%)
 Frame = +1

Query  52   VSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECG  228
            V  +   ++ L R  A++A    AT   + K F+IYRW+P+ P +KP +QEY++DL +CG
Sbjct  2    VFRAGIGRIGLVRGLATQAAEVSAT---RYKSFKIYRWNPDTPAEKPRMQEYKVDLNKCG  58

Query  229  PMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTP  402
            PMVLDALIKIKNE DPTLTFRRSCREGICGSCAMNI G+N LACL KI  +   D  + P
Sbjct  59   PMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNIGGRNTLACLCKIDQAESKDVKIYP  118

Query  403  LPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILC  582
            LPHM+V+KDLV D+TNFY QYKSI+P+L+ K   P  GKE LQS ADR KLDG+YECILC
Sbjct  119  LPHMYVVKDLVPDLTNFYKQYKSIQPFLQ-KAAKPADGKEHLQSIADRKKLDGLYECILC  177

Query  583  ACCSTSCP  606
            ACCST+CP
Sbjct  178  ACCSTACP  185



>ref|XP_006695818.1| succinate dehydrogenase-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS18873.1| succinate dehydrogenase-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=287

 Score =   239 bits (610),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 146/194 (75%), Gaps = 11/194 (6%)
 Frame = +1

Query  46   TKVSSSPAAKMTLARAHASEANAPQATASA----KIKKFQIYRWSPENP-QKPELQEYEI  210
            T V+SS AA +   R  A  A+A Q TA++    ++K FQ+YRW+P+ P +KP +Q Y +
Sbjct  23   TAVTSSTAAAV---RGMAQVADAAQQTATSSEKPRLKTFQVYRWNPDKPTEKPRMQSYTL  79

Query  211  DLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGP  384
            DL + GPMVLDAL++IKNE+DPTLTFRRSCREGICGSCAMNI+G N LACL +I      
Sbjct  80   DLNKTGPMVLDALLRIKNELDPTLTFRRSCREGICGSCAMNINGTNTLACLCRIPKEDNS  139

Query  385  DSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGM  564
            D  + PLPH +VIKDLV D+T+FY QYKSI+P+L+R  P P  GKE  QSK DR KLDG+
Sbjct  140  DVKIYPLPHTYVIKDLVPDLTHFYKQYKSIKPYLQRDTPAP-DGKEYRQSKEDRKKLDGL  198

Query  565  YECILCACCSTSCP  606
            YECILCACCSTSCP
Sbjct  199  YECILCACCSTSCP  212



>ref|XP_006783450.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Neolamprologus brichardi]
Length=283

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = +1

Query  82   LARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIKI  258
            LA  +A  A AP      ++KKFQ+YRW P+ P  KP +Q +EIDL  CGPMVLDALIKI
Sbjct  24   LAVRYAQTAAAP--AGQPRVKKFQVYRWDPDTPGDKPRMQTFEIDLNTCGPMVLDALIKI  81

Query  259  KNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD--SMVTPLPHMFVIKDL  432
            KNEIDPTLTFRRSCREGICGSCAMNI+G N LACL KI S     + + PLPHM+V+KDL
Sbjct  82   KNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNKIDSSLSKPTKIYPLPHMYVVKDL  141

Query  433  VVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            V DM+NFY QYKSIEP+LK+K+      ++ LQS  DR KLDG+YECILCACCSTSCP
Sbjct  142  VPDMSNFYAQYKSIEPYLKKKDESKEGKEQYLQSVEDRQKLDGLYECILCACCSTSCP  199



>ref|XP_001961283.1| GF11072 [Drosophila ananassae]
 gb|EDV38105.1| GF11072 [Drosophila ananassae]
Length=297

 Score =   239 bits (610),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 150/206 (73%), Gaps = 9/206 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAK----MTLARAHASEANAPQATASAKIKKFQIYRWSPENP-  180
            M  +  R+ +++V S  A +    +T   A   +   P+     +IKKF+IYRW+P+N  
Sbjct  1    MLVNEARQILSRVGSLTARQQLRTITNGTAQLEQQAQPKEAKEPQIKKFEIYRWNPDNAG  60

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
            +KP +Q Y++DL+ECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI G N LAC
Sbjct  61   EKPYMQTYDVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLAC  120

Query  361  LTKISSGPDS--MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP-PIPGK-EVL  528
            ++KI +       V PLPHM+V++DLV DM NFY QY++I+PWL+RKN      GK + L
Sbjct  121  ISKIDTNTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAVEEKGKAQYL  180

Query  529  QSKADRSKLDGMYECILCACCSTSCP  606
            QS  DRSKLDG+YECILCACCSTSCP
Sbjct  181  QSVEDRSKLDGLYECILCACCSTSCP  206



>gb|KIV95381.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Exophiala mesophila]
Length=291

 Score =   239 bits (610),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKP  189
            A  SS   R+   V  + A++     + ++    P AT  AKIK FQIYRW+P+ P  KP
Sbjct  17   AFRSSFAARSYATVVDTSASRPATPASQSTPVEEPAATKDAKIKTFQIYRWNPDEPTSKP  76

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
            ++Q Y +DL + GPM+LDALI+IKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +
Sbjct  77   KMQSYTLDLNKTGPMMLDALIRIKNEVDPTLTFRRSCREGICGSCAMNIDGVNTLACLCR  136

Query  370  I--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            I   +  +S + PLPH +V+KDLV DMT FY QYKSI+P+L+R +  P  GKE  QS  +
Sbjct  137  IPTDTSKESRIYPLPHTYVVKDLVPDMTQFYKQYKSIKPFLQRDSKSP-DGKEFRQSPTE  195

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDG+YECILCACCSTSCP
Sbjct  196  RKKLDGLYECILCACCSTSCP  216



>ref|XP_004535794.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Ceratitis capitata]
Length=297

 Score =   239 bits (610),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 137/176 (78%), Gaps = 5/176 (3%)
 Frame = +1

Query  94   HASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIKIKNEI  270
            H  +   PQ   + +IK FQIYRW+P+N  +KP +Q YE++L+ECGPMVLDALIKIKNE+
Sbjct  31   HLDQQAQPQEVKAPQIKTFQIYRWNPDNAGEKPYMQTYEVNLRECGPMVLDALIKIKNEV  90

Query  271  DPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPDS--MVTPLPHMFVIKDLVVDM  444
            DPTLTFRRSCREGICGSCAMNI G N LAC++KI +       V PLPHM+V++DLV D+
Sbjct  91   DPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDTNLSKPLKVYPLPHMYVVRDLVPDL  150

Query  445  TNFYNQYKSIEPWLKRKNP-PPIPGK-EVLQSKADRSKLDGMYECILCACCSTSCP  606
             NFY QY+SI+PWL+RKN      GK + LQS  DRSKLDG+YECILCACCSTSCP
Sbjct  151  NNFYEQYRSIQPWLQRKNEVSESKGKAQYLQSVEDRSKLDGLYECILCACCSTSCP  206



>ref|XP_007570175.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial [Poecilia formosa]
Length=279

 Score =   239 bits (609),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 143/200 (72%), Gaps = 8/200 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPE  192
            M+   + R I  V +S    M + R HA  A  P      +IKKFQ+YRW P+ P  KP 
Sbjct  1    MSVVCLSRNILAVRNS--GIMVMVR-HAQTATVP--APEPRIKKFQVYRWDPDTPGDKPR  55

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            +Q YEIDL +CGPMVLDALIKIKNE DPTLTFRRSCREGICGSCAMNI+G N LACL KI
Sbjct  56   MQTYEIDLNKCGPMVLDALIKIKNEFDPTLTFRRSCREGICGSCAMNINGGNTLACLNKI  115

Query  373  SSGPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADR  546
             +     + + PLPHM+V+KDLV DM+NFY QYKSIEP+LK+K+      ++  QS  DR
Sbjct  116  DTNTSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESQEGKQQYFQSMEDR  175

Query  547  SKLDGMYECILCACCSTSCP  606
             KLDG+YECILCACCSTSCP
Sbjct  176  QKLDGLYECILCACCSTSCP  195



>gb|ACO15487.1| Succinate dehydrogenase iron-sulfur subunit, mitochondrial precursor 
[Caligus clemensi]
Length=298

 Score =   239 bits (610),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 149/198 (75%), Gaps = 8/198 (4%)
 Frame = +1

Query  37   RAITKVSSSPAAKMTLA-RAHASEANAPQATASA----KIKKFQIYRWSPENP-QKPELQ  198
            R  +K   S A  ++++ R  ++ ++AP+   +     K+K F IYRW+P+NP +KP LQ
Sbjct  6    RHSSKALLSNAGPLSISTRGSSAASSAPKEGVTGLRTDKVKTFAIYRWNPDNPGEKPRLQ  65

Query  199  EYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISS  378
            EY+++L +CGPMVLDAL+KIKNE+DPTLTFRRSCREGICGSC+MNI G N LAC+ K+  
Sbjct  66   EYKVNLNDCGPMVLDALLKIKNEMDPTLTFRRSCREGICGSCSMNIGGVNTLACINKVDP  125

Query  379  GPDSMVT--PLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSK  552
             P+  +   PLPHM+V+KDLV DM NFY Q++SI+PWL+R+N       ++LQS  DRSK
Sbjct  126  NPNKAIKIYPLPHMYVVKDLVPDMNNFYEQHRSIQPWLQRENEDTSGNNQILQSVEDRSK  185

Query  553  LDGMYECILCACCSTSCP  606
            LDG+YECILCACCSTSCP
Sbjct  186  LDGLYECILCACCSTSCP  203



>ref|XP_007774143.1| iron-sulphar subunit protein of succinate dehydrogenase [Coniophora 
puteana RWD-64-598 SS2]
 gb|EIW75414.1| iron-sulphar subunit protein of succinate dehydrogenase [Coniophora 
puteana RWD-64-598 SS2]
Length=274

 Score =   238 bits (608),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 144/190 (76%), Gaps = 8/190 (4%)
 Frame = +1

Query  55   SSSPAAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENP-QKPELQEYEIDLKE  222
            +S  AA    AR  AS A   QA    K    K+F+IYRW+P+ P +KPELQ Y IDL +
Sbjct  11   ASRSAAWRLPARTFASSAARAQAEPLEKPVLNKEFKIYRWNPDEPAKKPELQSYTIDLNQ  70

Query  223  CGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMV  396
             GPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG+N LACL +I  ++G DS +
Sbjct  71   TGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDRNAGKDSKI  130

Query  397  TPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECI  576
             PLPHM+++KDLV D+T FY QYKSI+P+L+  NPP     E LQS+ +R KLDG+YECI
Sbjct  131  YPLPHMYIVKDLVPDLTLFYKQYKSIKPYLQNDNPP--EQGEFLQSREERQKLDGLYECI  188

Query  577  LCACCSTSCP  606
            LCACCSTSCP
Sbjct  189  LCACCSTSCP  198



>gb|KDQ53949.1| hypothetical protein JAAARDRAFT_38932 [Jaapia argillacea MUCL 
33604]
Length=267

 Score =   238 bits (607),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +1

Query  67   AAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENPQK-PELQEYEIDLKECGPM  234
            +A+ +  R  A+ A   QA A  K    K+F+IYRW+P+ P+K P LQ Y+IDL +CGPM
Sbjct  10   SARPSAIRGFATSAARSQAAAVQKPIQTKEFKIYRWNPDEPEKKPTLQSYKIDLNQCGPM  69

Query  235  VLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGP-DSMVTPLPH  411
            VLDALIKIK ++DPTLTFRRSCREGICGSCAMNIDG+N LACL +I  G  D+ + PLPH
Sbjct  70   VLDALIKIKTDLDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDRGAKDTKIYPLPH  129

Query  412  MFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACC  591
            M+++KDLV D+T FY QYKSIEP+LK  NPP    +E  QS+ DR KLDG+YECILCACC
Sbjct  130  MYIVKDLVPDLTLFYKQYKSIEPYLKHPNPPE---REFYQSQEDRKKLDGLYECILCACC  186

Query  592  STSCP  606
            +TSCP
Sbjct  187  TTSCP  191



>ref|XP_002165357.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Hydra vulgaris]
Length=265

 Score =   238 bits (607),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 133/166 (80%), Gaps = 4/166 (2%)
 Frame = +1

Query  118  QATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRR  294
            Q +AS+ +K FQIYRW+PE P  KP LQEYE+DL +CGPMVLDAL+ +KNE DPTLTFRR
Sbjct  24   QTSASSAVKVFQIYRWNPEKPGDKPRLQEYEVDLNKCGPMVLDALLAVKNEQDPTLTFRR  83

Query  295  SCREGICGSCAMNIDGKNGLACLTKISSG--PDSMVTPLPHMFVIKDLVVDMTNFYNQYK  468
            SCREGICGSCAMNI+G N LAC  KI +     + + PLPHM+V+KDLV DMTNFY QY+
Sbjct  84   SCREGICGSCAMNINGTNTLACTCKIDANLSKKTKIYPLPHMYVVKDLVPDMTNFYEQYR  143

Query  469  SIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
             IEP+LKR N  P  GKE +QS  DR+KLDG+YECILCACCSTSCP
Sbjct  144  YIEPYLKR-NTLPADGKENIQSIKDRAKLDGLYECILCACCSTSCP  188



>ref|XP_003840583.1| similar to succinate dehydrogenase iron-sulfur protein subunit 
[Leptosphaeria maculans JN3]
 emb|CBX97104.1| similar to succinate dehydrogenase iron-sulfur protein subunit 
[Leptosphaeria maculans JN3]
Length=306

 Score =   239 bits (610),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 147/207 (71%), Gaps = 7/207 (3%)
 Frame = +1

Query  4    GFPAMASSLVRRAITKVSSS---PAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPE  174
            GF ++     R  I+KV       AA+  ++    S    P+ T  AK K F IYRW+P+
Sbjct  25   GFASVTDVHARDPISKVGEKIVPDAARKPVSEKETSTIKEPEPTKDAKTKTFHIYRWNPD  84

Query  175  NPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNG  351
             P  KP++Q Y +DL + GPM+LDALI+IKNE+DPTLTFRRSCREGICGSCAMNIDG N 
Sbjct  85   EPSSKPKMQSYTLDLNKTGPMMLDALIRIKNEVDPTLTFRRSCREGICGSCAMNIDGVNT  144

Query  352  LACLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEV  525
            LACL +I   +  +S + PLPHM+V+KDLV DMT FY QY+S++P+L+R  P P  G+E 
Sbjct  145  LACLCRIPTDTTKESRIYPLPHMYVVKDLVPDMTLFYKQYRSVKPYLQRTTPAP-DGREY  203

Query  526  LQSKADRSKLDGMYECILCACCSTSCP  606
             Q+K DR KLDG+YECILCACCSTSCP
Sbjct  204  RQTKEDRKKLDGLYECILCACCSTSCP  230



>emb|CAG01723.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=281

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 138/183 (75%), Gaps = 7/183 (4%)
 Frame = +1

Query  67   AAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLD  243
             A + +  A  + A AP+     +IKKFQ+YRW P+ P  KP +Q YEIDL  CGPMVLD
Sbjct  19   GALVMVRYAQTAAALAPEP----RIKKFQVYRWDPDTPGDKPRMQTYEIDLNACGPMVLD  74

Query  244  ALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHMF  417
            ALIKIKNEIDPTLTFRRSCREGICGSCAMNI+G N LACL KI  ++   + + PLPHM+
Sbjct  75   ALIKIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNKIDPNTNKTTKIYPLPHMY  134

Query  418  VIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCST  597
            V+KDLV DM+NFY QYKSIEP+LK+K+      K+  QS  DR KLDG+YECILCACCST
Sbjct  135  VVKDLVPDMSNFYAQYKSIEPYLKKKDETREGKKQYFQSVEDRQKLDGLYECILCACCST  194

Query  598  SCP  606
            SCP
Sbjct  195  SCP  197



>ref|XP_003034564.1| Iron-sulfur subunit protein of succinate dehydrogenase [Schizophyllum 
commune H4-8]
 gb|EFI99661.1| Iron-sulfur subunit protein of succinate dehydrogenase [Schizophyllum 
commune H4-8]
Length=271

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 144/196 (73%), Gaps = 8/196 (4%)
 Frame = +1

Query  37   RAITKVSSSPAAKMTLARAHASEANAPQATAS---AKIKKFQIYRWSPENP-QKPELQEY  204
            +A+   S    A +  +R  A+ A   QA  +    K K+F+IYRW+P+ P +KP LQ Y
Sbjct  2    QALVSSSRRAPAALRASRGFATSALRAQAVPTDKPVKAKEFKIYRWNPDEPAKKPTLQSY  61

Query  205  EIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SS  378
             IDL +CGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNI+G+N LACL +I    
Sbjct  62   TIDLNQCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIERDE  121

Query  379  GPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLD  558
              D+ + PLPHM+++KDLV D+T FY QYKSI+P+L+  NPP     E LQS+ DR KLD
Sbjct  122  SKDTKIYPLPHMYIVKDLVPDLTYFYKQYKSIQPYLQNDNPP--AEGEFLQSQEDRRKLD  179

Query  559  GMYECILCACCSTSCP  606
            G+YECILCACCSTSCP
Sbjct  180  GLYECILCACCSTSCP  195



>ref|XP_011109617.1| hypothetical protein H072_3647 [Dactylellina haptotyla CBS 200.50]
 gb|EPS42437.1| hypothetical protein H072_3647 [Dactylellina haptotyla CBS 200.50]
Length=282

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 151/200 (76%), Gaps = 9/200 (5%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPE  192
            +ASS  RRA   V ++  +  ++A    ++A  P A     +KKF IYRWSP+ P +KP 
Sbjct  12   LASSSFRRASPTVFNTTRSLASIA----TDAPTP-AKKEPLLKKFTIYRWSPDEPTKKPH  66

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            +QEY +DL E GPMVLDALI+IKNE+DPTLTFRRSCREGICGSCAMNI+G N LACL +I
Sbjct  67   MQEYTLDLNETGPMVLDALIRIKNELDPTLTFRRSCREGICGSCAMNIEGTNTLACLCRI  126

Query  373  S--SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADR  546
            S  +   + + PLPHM+++KDLV D+TNFY QYKSI+P+L+RK P    GKE+ QSK +R
Sbjct  127  SRDTSQATRIYPLPHMYIVKDLVPDLTNFYKQYKSIKPYLQRKEPTE-DGKEIRQSKEER  185

Query  547  SKLDGMYECILCACCSTSCP  606
             KLDG+YECILCACCSTSCP
Sbjct  186  KKLDGLYECILCACCSTSCP  205



>ref|XP_005805822.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Xiphophorus maculatus]
Length=279

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 136/183 (74%), Gaps = 6/183 (3%)
 Frame = +1

Query  67   AAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLD  243
            +  M + R HA  A  P      +IKKFQ+YRW P+ P  KP +Q YEIDL  CGPMVLD
Sbjct  16   SGMMVMVR-HAQTAAVP--APEPRIKKFQVYRWDPDTPGDKPRMQTYEIDLNTCGPMVLD  72

Query  244  ALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD--SMVTPLPHMF  417
            ALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G N LACL KI +     + + PLPHM+
Sbjct  73   ALIKIKNELDPTLTFRRSCREGICGSCAMNINGGNTLACLNKIDTNTSKPTKIYPLPHMY  132

Query  418  VIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCST  597
            V+KDLV DM+NFY QYKSIEP+LK+K+      K+  QS  DR KLDG+YECILCACCST
Sbjct  133  VVKDLVPDMSNFYAQYKSIEPYLKKKDESQEGKKQYFQSVEDRQKLDGLYECILCACCST  192

Query  598  SCP  606
            SCP
Sbjct  193  SCP  195



>gb|ACQ58465.1| Succinate dehydrogenase iron-sulfur subunit, mitochondrial precursor 
[Anoplopoma fimbria]
Length=281

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 136/180 (76%), Gaps = 6/180 (3%)
 Frame = +1

Query  76   MTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALI  252
            M + R HA  A AP     ++IKKFQIYRW P+    KP +Q YEIDL  CGPMVLDALI
Sbjct  21   MVMVR-HAQTAAAP--APESRIKKFQIYRWDPDTSGDKPRMQTYEIDLNTCGPMVLDALI  77

Query  253  KIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD--SMVTPLPHMFVIK  426
            KIKNEIDPTLTFRRSCREGICGSCAMNI+G N LACL KI +     + + PLPHM+V+K
Sbjct  78   KIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNKIDTNTSKPTKIYPLPHMYVVK  137

Query  427  DLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            DLV DM+NFY QYKSIEP+LK+K+      ++  QS  DR KLDG+YECILCACCSTSCP
Sbjct  138  DLVPDMSNFYAQYKSIEPYLKKKDGAQEGKEQYFQSVEDRQKLDGLYECILCACCSTSCP  197



>ref|XP_002066043.1| GK22142 [Drosophila willistoni]
 gb|EDW77029.1| GK22142 [Drosophila willistoni]
Length=297

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 146/201 (73%), Gaps = 5/201 (2%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPEL  195
            A  ++ RA + V       +T   A   +   P+     +IKKF+IYRW+P+N  +KP +
Sbjct  6    ARQVLSRASSLVGRHQLRSITNGTAQLDQQAQPKEAKEPQIKKFEIYRWNPDNAGEKPYM  65

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKIS  375
            Q YE++L+ECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI G N LAC++KI 
Sbjct  66   QTYEVNLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACISKID  125

Query  376  SGPDS--MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP-PIPGK-EVLQSKAD  543
            +       V PLPHM+V++DLV DM NFY QY++I+PWL+RK+      GK + LQS  D
Sbjct  126  TNASKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKDEAGEQKGKAQYLQSVED  185

Query  544  RSKLDGMYECILCACCSTSCP  606
            RSKLDG+YECILCACCSTSCP
Sbjct  186  RSKLDGLYECILCACCSTSCP  206



>ref|NP_983339.1| ACL065Cp [Ashbya gossypii ATCC 10895]
 sp|Q75CI4.1|SDHB_ASHGO RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur 
subunit, mitochondrial; AltName: Full=Iron-sulfur subunit 
of complex II; Short=Ip; Flags: Precursor [Ashbya gossypii ATCC 
10895]
 gb|AAS51163.1| ACL065Cp [Ashbya gossypii ATCC 10895]
 gb|AEY95454.1| FACL065Cp [Ashbya gossypii FDAG1]
Length=261

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 143/188 (76%), Gaps = 7/188 (4%)
 Frame = +1

Query  52   VSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECG  228
            V  +   ++ L R  A++A    AT   + K F+IYRW+P+ P +KP +QEY++DL +CG
Sbjct  2    VFRAGIGRIGLIRGLATQAAEVSAT---RYKSFKIYRWNPDTPAEKPRMQEYKVDLNKCG  58

Query  229  PMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTP  402
            PMVLDALIKIKNE DPTLTFRRSCREGICGSCAMNI G+N LACL KI  +   D  + P
Sbjct  59   PMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNIGGRNTLACLCKIDQAENKDVKIYP  118

Query  403  LPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILC  582
            LPHM+V+KDLV D+TNFY QYKSI+P+L+ K   P  G+E LQS ADR KLDG+YECILC
Sbjct  119  LPHMYVVKDLVPDLTNFYKQYKSIQPYLQ-KASKPADGREHLQSIADRKKLDGLYECILC  177

Query  583  ACCSTSCP  606
            ACCST+CP
Sbjct  178  ACCSTACP  185



>sp|Q70KF8.1|SDHB_UROFA RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur 
subunit, mitochondrial; AltName: Full=Iron-sulfur subunit 
of complex II; Short=Ip; Flags: Precursor [Uromyces viciae-fabae]
 emb|CAE02642.1| succinate dehydrogenase [Uromyces viciae-fabae]
Length=283

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 135/173 (78%), Gaps = 5/173 (3%)
 Frame = +1

Query  97   ASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIKIKNEID  273
            A E    Q +++  +K+F IYRW+P+ P +KP LQ Y IDLK+CGPMVLDALIKIKNE+D
Sbjct  37   AEEHAGKQPSSAVPVKEFSIYRWNPDEPSKKPTLQTYSIDLKKCGPMVLDALIKIKNELD  96

Query  274  PTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPDS--MVTPLPHMFVIKDLVVDMT  447
            PTLTFRRSCREGICGSCAMNIDG N LACL +I+    +   + PLPHM++IKDLV DMT
Sbjct  97   PTLTFRRSCREGICGSCAMNIDGVNTLACLKRINKETSAPVKIYPLPHMYIIKDLVPDMT  156

Query  448  NFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            +FY QYKSIEP+LK  NPP     E LQS  DR KLDGMYECILCACCSTSCP
Sbjct  157  HFYKQYKSIEPFLKNDNPP--AQGEFLQSPEDRKKLDGMYECILCACCSTSCP  207



>emb|CCX04392.1| Similar to Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial; acc. no. O42772 [Pyronema omphalodes 
CBS 100304]
Length=283

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 147/201 (73%), Gaps = 5/201 (2%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASE-ANAPQATASAKIKKFQIYRWSPENPQK-P  189
             A S +R A T  ++ P +   LA    S+ A A   T    +KKFQ+YRW+P+ P+K P
Sbjct  6    FARSALRAAATSRTAVPVSVRGLASVATSQTAPATPETKKPLMKKFQVYRWNPDEPEKKP  65

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             +QEYE+DL + GPM LDALI++KNE+DPTLTFRRSCREGICGSCAMNI+G N LACL +
Sbjct  66   YMQEYELDLNQTGPMFLDALIRMKNEVDPTLTFRRSCREGICGSCAMNIEGTNTLACLCR  125

Query  370  ISSGPDSM--VTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            I      +  + PLPH +V+KDLV D+T FY QYKSI+P+L+RK+  P P KE LQS AD
Sbjct  126  IDRDTSKVAKIYPLPHTYVVKDLVPDLTQFYKQYKSIKPYLQRKD-APTPMKENLQSIAD  184

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDGMYECILCACCSTSCP
Sbjct  185  RKKLDGMYECILCACCSTSCP  205



>gb|KDR22350.1| Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Zootermopsis nevadensis]
Length=284

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 137/180 (76%), Gaps = 5/180 (3%)
 Frame = +1

Query  76   MTLARAHASEANAPQATASAKIKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDALI  252
            + + + H S   A +A    ++KKF IYRW+P+ P+ KP++Q+Y +DL  CGPM+LDALI
Sbjct  16   VQVRKVHVSAVVASEA--GQRLKKFDIYRWNPDKPEEKPQMQQYSVDLNTCGPMILDALI  73

Query  253  KIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSG--PDSMVTPLPHMFVIK  426
            KIKNE+DPTLTFRRSCREGICGSCAMNI G N LAC++KI +     S + PLPHM+VIK
Sbjct  74   KIKNEVDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDTNLSKSSKIYPLPHMYVIK  133

Query  427  DLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            DLV DM NFY QY SI+PWL+RK+      ++ LQS  DR KLDG+YECILCACCSTSCP
Sbjct  134  DLVPDMNNFYTQYHSIQPWLQRKDEKKTGNRQYLQSIDDRKKLDGLYECILCACCSTSCP  193



>ref|XP_004343434.1| succinate dehydrogenase iron-sulfur subunit [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE97089.1| succinate dehydrogenase iron-sulfur subunit [Capsaspora owczarzaki 
ATCC 30864]
Length=285

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 129/162 (80%), Gaps = 7/162 (4%)
 Frame = +1

Query  136  KIKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGI  312
            ++K F IYRW PENP  KP LQ Y++DL  CGPMVLDALIKIKN+IDPTLTFRRSCREGI
Sbjct  50   RLKTFAIYRWDPENPTVKPRLQNYQVDLNTCGPMVLDALIKIKNDIDPTLTFRRSCREGI  109

Query  313  CGSCAMNIDGKNGLACLTKISSGPD----SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEP  480
            CGSC+MNI G N LAC++ I   PD      + PLPHM+V+KDLV DM+NFY QY+ IEP
Sbjct  110  CGSCSMNIGGSNTLACISHID--PDLSKPVKIYPLPHMYVVKDLVPDMSNFYQQYRRIEP  167

Query  481  WLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            +L+RK P P   KE LQS+ADR KLDG+YECILCACCSTSCP
Sbjct  168  YLQRKTPAPDAAKENLQSRADRKKLDGLYECILCACCSTSCP  209



>ref|XP_001970722.1| GG23224 [Drosophila erecta]
 gb|EDV59781.1| GG23224 [Drosophila erecta]
Length=297

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 148/201 (74%), Gaps = 12/201 (6%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPEL  195
              SLV R   +  S+  A++   +A   E   PQ      IKKF+IYRW+P+N  +KP +
Sbjct  13   VGSLVARNQLRAISNGTAQLQ-QQAQPKEDQEPQ------IKKFEIYRWNPDNAGEKPYM  65

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK--  369
            Q YE+DL+ECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI G N LAC++K  
Sbjct  66   QTYEVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACISKID  125

Query  370  ISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPP-PIPGK-EVLQSKAD  543
            I++     V PLPHM+V++DLV DM NFY QY++I+PWL+RKN      GK + LQS  D
Sbjct  126  INTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAGEKKGKAQYLQSVED  185

Query  544  RSKLDGMYECILCACCSTSCP  606
            RSKLDG+YECILCACCSTSCP
Sbjct  186  RSKLDGLYECILCACCSTSCP  206



>gb|KIY72291.1| iron-sulfur subunit protein of succinate dehydrogenase [Cylindrobasidium 
torrendii FP15055 ss-10]
Length=267

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 143/193 (74%), Gaps = 6/193 (3%)
 Frame = +1

Query  37   RAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEID  213
            +++ +  SS A++   A   A+   AP        K F+IYRW+P+ P +KPELQ Y ID
Sbjct  2    QSVARRLSSTASRRGFATTSAAFQAAPLEKPVLN-KTFKIYRWNPDEPAKKPELQSYTID  60

Query  214  LKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGP--D  387
            L + GPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G+N LACL +I   P  +
Sbjct  61   LNQTGPMILDALIKIKNEMDPTLTFRRSCREGICGSCAMNIEGRNTLACLCRIDRNPAKE  120

Query  388  SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMY  567
            S + PLPHM+++KDLV D+T FY QYKSIEP+L+  NPP  P  E LQS  DR KLDGMY
Sbjct  121  SKIYPLPHMYIVKDLVPDLTYFYKQYKSIEPYLQNDNPP--PQGEFLQSPEDRKKLDGMY  178

Query  568  ECILCACCSTSCP  606
            ECILCACCSTSCP
Sbjct  179  ECILCACCSTSCP  191



>emb|CBI17705.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  232  MVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPDSMVTPLPH  411
            MVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG NGLACLTKI SG  S VTPLPH
Sbjct  1    MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGCNGLACLTKIPSGESSTVTPLPH  60

Query  412  MFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACC  591
            MFVIKDLVVDMTNFYNQYKSIEPWLKRK PPP PGKE+ QSK DR+KLDGMYECILCACC
Sbjct  61   MFVIKDLVVDMTNFYNQYKSIEPWLKRKTPPPTPGKEIPQSKKDRAKLDGMYECILCACC  120

Query  592  STSCP  606
            STSCP
Sbjct  121  STSCP  125



>ref|XP_003394586.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Bombus terrestris]
Length=277

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = +1

Query  67   AAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLD  243
            A K  L +      +A Q  A+AK+K F +YRW+P+ P +KP +QEY++DL  CGPM+LD
Sbjct  8    ACKNALRQVRRFHISANQ-NAAAKLKTFAVYRWNPDKPDEKPYMQEYKVDLNTCGPMILD  66

Query  244  ALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPDSM--VTPLPHMF  417
            ALIKIKNEIDPTLTFRRSCREGICGSCAMNI G N LAC++KI +  +S   + PLPHM+
Sbjct  67   ALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDTDTNSTSKIYPLPHMY  126

Query  418  VIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCST  597
            ++KDLV D+ NFYNQYKSI+PWL+  +      K+ LQS  DR KLDG+YECILCACCST
Sbjct  127  IVKDLVPDLNNFYNQYKSIQPWLQHGDGQESGSKQYLQSVEDRKKLDGLYECILCACCST  186

Query  598  SCP  606
            SCP
Sbjct  187  SCP  189



>ref|XP_003869443.1| Sdh2 Fe-S subunit of succinate dehydrogenase [Candida orthopsilosis 
Co 90-125]
 emb|CCG23308.1| Sdh2 Fe-S subunit of succinate dehydrogenase [Candida orthopsilosis]
Length=257

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 137/160 (86%), Gaps = 4/160 (3%)
 Frame = +1

Query  136  KIKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGI  312
            ++KKFQIYRW+P+ P+ +P+++EYE+DL +CGPMVLDAL+KIKNE D TLTFRRSCREGI
Sbjct  23   RLKKFQIYRWNPDTPEVQPKMKEYEVDLNKCGPMVLDALLKIKNEEDATLTFRRSCREGI  82

Query  313  CGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWL  486
            CGSCAMNI G+N LACL +I   +  D+ + PLPHMFV++DLV D+T+FY QYKSIEP+L
Sbjct  83   CGSCAMNIGGRNTLACLCRIDTDTSKDTKIYPLPHMFVVRDLVPDLTHFYKQYKSIEPYL  142

Query  487  KRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            +R++ P   G+E LQS ADR+KLDG+YECILCACCSTSCP
Sbjct  143  QREDQPA-DGRENLQSIADRAKLDGLYECILCACCSTSCP  181



>ref|XP_007681605.1| hypothetical protein BAUCODRAFT_134827 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC91160.1| hypothetical protein BAUCODRAFT_134827 [Baudoinia compniacensis 
UAMH 10762]
Length=300

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 135/174 (78%), Gaps = 4/174 (2%)
 Frame = +1

Query  94   HASEANAPQATASAKIKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEI  270
            H +    P     +KIK F IYRW+P+ P  KP++Q Y +DL + GPM+LDALI+IKNE+
Sbjct  52   HTTTIKEPSPDPESKIKTFHIYRWNPDEPSSKPKMQSYTLDLNKTGPMILDALIRIKNEV  111

Query  271  DPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHMFVIKDLVVDM  444
            DPTLTFRRSCREGICGSCAMNIDG N LACL +I   +G ++ + PLPH +V+KDLV D+
Sbjct  112  DPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIPTDAGKETRIYPLPHTYVVKDLVPDL  171

Query  445  TNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            T FY QYKSI+P+L+R  PPP  G+E  QSK+DR KLDG+YECILCACCSTSCP
Sbjct  172  TQFYKQYKSIKPYLQRDTPPP-DGREYRQSKSDRRKLDGLYECILCACCSTSCP  224



>ref|XP_011445975.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Crassostrea gigas]
Length=285

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 145/197 (74%), Gaps = 15/197 (8%)
 Frame = +1

Query  31   VRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYE  207
            VRR++ ++       M    A  S A AP+    A++KKF +YRW PE P  KP++Q YE
Sbjct  12   VRRSLVQL-------MQTRCAQTSAATAPEP---ARMKKFAVYRWDPEKPGDKPKMQTYE  61

Query  208  IDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISS--G  381
            +DL  CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSC+MNI G N LACL KI    G
Sbjct  62   VDLNTCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCSMNIGGSNTLACLCKIDDNLG  121

Query  382  PDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPP--IPGKEVLQSKADRSKL  555
              + + PLPHM+VIKDLV DM+NFY QY+SIEP+LK+K+     I  K+ LQ+  DR+KL
Sbjct  122  KATKIYPLPHMYVIKDLVPDMSNFYAQYRSIEPYLKKKDGSDKNIGDKQYLQTTGDRAKL  181

Query  556  DGMYECILCACCSTSCP  606
            DG+YECILCACCSTSCP
Sbjct  182  DGLYECILCACCSTSCP  198



>gb|ADV91179.1| mitochondrial succinate dehydrogenase iron-sulphur subunit-like 
protein 2 [Karlodinium veneficum]
Length=291

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +1

Query  124  TASAKIKKFQIYRWSPENPQKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCR  303
            +A+ +++KF IYR+ PE   +P LQEY+IDLK+CGPM+LDALIK+K+E+DPTLTFRRSCR
Sbjct  28   SAATQMQKFAIYRYDPEKTARPFLQEYDIDLKQCGPMILDALIKVKDEVDPTLTFRRSCR  87

Query  304  EGICGSCAMNIDGKNGLACLTKISSGPDSM---VTPLPHMFVIKDLVVDMTNFYNQYKSI  474
            EGICGSCAMNI+GKNGLACL  I   PD+    + PLPH +V+KDLV D+TNFYNQYKSI
Sbjct  88   EGICGSCAMNINGKNGLACLIYIE--PDAKPIEIQPLPHSYVVKDLVPDLTNFYNQYKSI  145

Query  475  EPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            EPWLKRK+      KE  QS  DR KLDGMYECILCA C TSCP
Sbjct  146  EPWLKRKDEKAPGEKEYYQSHEDRLKLDGMYECILCASCMTSCP  189



>ref|XP_011196731.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial [Bactrocera cucurbitae]
Length=297

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 138/176 (78%), Gaps = 5/176 (3%)
 Frame = +1

Query  94   HASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIKIKNEI  270
            + ++   PQ   + +IK FQIYRW+P+N  +KP +Q YE++L+ECGPMVLDALIKIKNE+
Sbjct  31   YLAQQVEPQDIKAPQIKTFQIYRWNPDNAGEKPYMQTYEVNLRECGPMVLDALIKIKNEV  90

Query  271  DPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPDS--MVTPLPHMFVIKDLVVDM  444
            DPTLTFRRSCREGICGSCAMNI G N LAC++KI +       V PLPHM+V++DLV DM
Sbjct  91   DPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDTNLSKPLKVYPLPHMYVVRDLVPDM  150

Query  445  TNFYNQYKSIEPWLKRKNP-PPIPGK-EVLQSKADRSKLDGMYECILCACCSTSCP  606
             NFY QY+SI+PWL+RKN      GK + LQS  DRSKLDG+YECILCACCSTSCP
Sbjct  151  NNFYEQYRSIQPWLQRKNEVAESKGKAQYLQSVEDRSKLDGLYECILCACCSTSCP  206



>gb|ENN70482.1| hypothetical protein YQE_12985, partial [Dendroctonus ponderosae]
 gb|ERL90079.1| hypothetical protein D910_07434 [Dendroctonus ponderosae]
Length=298

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 136/171 (80%), Gaps = 7/171 (4%)
 Frame = +1

Query  115  PQATASAKIKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFR  291
            PQ     KIK   IYRW+P+ PQ KP +Q+Y++DL +CGPMVLDALIKIKNE+DPTLTFR
Sbjct  37   PQQQKPPKIKTVSIYRWNPDKPQQKPYMQDYKVDLSQCGPMVLDALIKIKNEMDPTLTFR  96

Query  292  RSCREGICGSCAMNIDGKNGLACLTKISS--GPDSMVTPLPHMFVIKDLVVDMTNFYNQY  465
            RSCREGICGSCAMNI G N LAC++KI +  G  + + PLPHM+V+KDLV DMTNFYNQY
Sbjct  97   RSCREGICGSCAMNIGGVNTLACISKIDTNLGKKAKIYPLPHMYVVKDLVPDMTNFYNQY  156

Query  466  KSIEPWLKRKNPPPIPG-KEV---LQSKADRSKLDGMYECILCACCSTSCP  606
            KSIEPWL+R +     G KEV   LQS  DR+KLDG+YECILCACCSTSCP
Sbjct  157  KSIEPWLQRDDAVAAKGTKEVTQYLQSVDDRAKLDGLYECILCACCSTSCP  207



>gb|KDQ08070.1| hypothetical protein BOTBODRAFT_38289 [Botryobasidium botryosum 
FD-172 SS1]
Length=276

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 145/199 (73%), Gaps = 14/199 (7%)
 Frame = +1

Query  43   ITKVSSSPAAKMTLARAHASEANA------PQATASAK---IKKFQIYRWSPENP-QKPE  192
            + +   +P    T+ARA +S +        P  T   K   +K+F+IYRW+P+ P +KP+
Sbjct  5    LARARLAPFKAATVARAISSSSTRAANPAPPDGTPPQKEPLMKQFKIYRWNPDEPTEKPK  64

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            LQ YE+DL  CGPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G N LACL +I
Sbjct  65   LQTYEVDLNSCGPMMLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGTNTLACLCRI  124

Query  373  SSGPD-SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
               P  + + PLPHM++IKDLV DMT FY QYKSIEP+LK  NP   P KE +QS  DR 
Sbjct  125  EKTPKPAKIYPLPHMYIIKDLVPDMTQFYKQYKSIEPYLKNDNP---PEKEHIQSIEDRK  181

Query  550  KLDGMYECILCACCSTSCP  606
            KLDGMYECILCACCSTSCP
Sbjct  182  KLDGMYECILCACCSTSCP  200



>gb|KIK82102.1| hypothetical protein PAXRUDRAFT_832396 [Paxillus rubicundulus 
Ve08.2h10]
Length=275

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 153/203 (75%), Gaps = 10/203 (5%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENPQK  186
            M  +LV+ +I  +  + A + T+ R  AS A   QA  + K   +K+F+IYRW+P+ P+K
Sbjct  1    MQGNLVK-SILSLPRTSALRSTV-RTFASSATRWQAVPTEKPVLMKEFKIYRWNPDEPEK  58

Query  187  -PELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
             P LQ+Y IDL + GPM+LDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+N LACL
Sbjct  59   KPTLQKYTIDLNQTGPMILDALIKIKNEMDPTLTFRRSCREGICGSCAMNIDGQNTLACL  118

Query  364  TKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
             +I  ++G DS + PLPHM+++KDLV D+T FY QYKSI+P+L+  NPP     E LQS 
Sbjct  119  CRIDRNTGKDSKIYPLPHMYIVKDLVPDLTLFYKQYKSIKPYLQSDNPP--EKGEFLQSP  176

Query  538  ADRSKLDGMYECILCACCSTSCP  606
             DR KLDG+YECILCACCSTSCP
Sbjct  177  EDRKKLDGLYECILCACCSTSCP  199



>emb|CDS11832.1| Putative Succinate dehydrogenase [Absidia idahoensis var. thermophila]
Length=249

 Score =   236 bits (602),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 138/173 (80%), Gaps = 4/173 (2%)
 Frame = +1

Query  97   ASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIKIKNEID  273
            AS  +AP       +K F+IYRW+P+ P +KP L++Y++DL +CGPMVLDALIKIKNE D
Sbjct  2    ASPTDAPATKKQPLLKTFEIYRWNPDKPTEKPYLEKYQVDLNQCGPMVLDALIKIKNEQD  61

Query  274  PTLTFRRSCREGICGSCAMNIDGKNGLACLTKIS--SGPDSMVTPLPHMFVIKDLVVDMT  447
            PTLTFRRSCREGICGSCAMNI+G N LAC++K++  +     + PLPHM+++KDLV D+T
Sbjct  62   PTLTFRRSCREGICGSCAMNIEGGNTLACISKVNRDTSKSVKIYPLPHMYIVKDLVPDLT  121

Query  448  NFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            +FY QYKSIEP+LK+ N PP  GKE LQS  DR KLDG+YECILCACCSTSCP
Sbjct  122  HFYKQYKSIEPYLKQNN-PPTDGKENLQSIEDRKKLDGLYECILCACCSTSCP  173



>emb|CCE42815.1| hypothetical protein CPAR2_204580 [Candida parapsilosis]
Length=257

 Score =   236 bits (602),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 137/160 (86%), Gaps = 4/160 (3%)
 Frame = +1

Query  136  KIKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGI  312
            ++KKFQIYRW+P+ P+ +P+++EYE+DL +CGPMVLDAL+KIKNE D TLTFRRSCREGI
Sbjct  23   RLKKFQIYRWNPDTPEVQPKMKEYEVDLNKCGPMVLDALLKIKNEEDATLTFRRSCREGI  82

Query  313  CGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWL  486
            CGSCAMNI G+N LACL +I   +  D+ + PLPHMFV++DLV D+T+FY QYKSIEP+L
Sbjct  83   CGSCAMNIGGRNTLACLCRIDTDTSKDTKIYPLPHMFVVRDLVPDLTHFYKQYKSIEPYL  142

Query  487  KRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            +R++ P   G+E LQS ADR+KLDG+YECILCACCSTSCP
Sbjct  143  QREDQPA-DGRENLQSIADRAKLDGLYECILCACCSTSCP  181



>gb|EHK17152.1| hypothetical protein TRIVIDRAFT_88418 [Trichoderma virens Gv29-8]
Length=276

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 146/199 (73%), Gaps = 8/199 (4%)
 Frame = +1

Query  19   ASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPEL  195
            +S+ +  + T+ +  P+A  + + A  SE    Q     ++K FQIYRW+P+ P +KP L
Sbjct  6    SSTRILSSSTRAAFRPSAVFSRSMASVSETTEQQP----RVKSFQIYRWNPDTPTEKPRL  61

Query  196  QEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI-  372
            Q Y IDL + GPM+LDALIKIKNE DP+LTFRRSCREGICGSCAMNI+G+N LACL +I 
Sbjct  62   QTYSIDLNKTGPMILDALIKIKNEQDPSLTFRRSCREGICGSCAMNINGQNTLACLCRIP  121

Query  373  -SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
              S  D  + PLPH +V+KDLV D+T+FY QYKSI+P+L+R  P    GKE  QSKADR 
Sbjct  122  TESASDVKIYPLPHTYVVKDLVPDLTHFYKQYKSIQPYLQRDTPAE-DGKEYRQSKADRK  180

Query  550  KLDGMYECILCACCSTSCP  606
            KLDG+YECILCACCSTSCP
Sbjct  181  KLDGLYECILCACCSTSCP  199



>dbj|BAJ07111.1| succinate dehydrogenase subunit B [Corynespora cassiicola]
Length=307

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 149/208 (72%), Gaps = 9/208 (4%)
 Frame = +1

Query  4    GFPAMASSLVRRAITKVSS----SPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSP  171
            GF ++  +  R  ++KV+      PA K+ +  +  S    PQ    AK K F IYRW+P
Sbjct  26   GFASVTDTAAREPVSKVAEKIVPDPARKV-VPESQTSTVKDPQPDKDAKTKTFHIYRWNP  84

Query  172  ENP-QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKN  348
            + P  KP++Q Y +DL + GPM+LDALI+IKNE+DPTLTFRRSCREGICGSCAMNIDG N
Sbjct  85   DEPTSKPKMQTYTLDLNKTGPMMLDALIRIKNELDPTLTFRRSCREGICGSCAMNIDGVN  144

Query  349  GLACLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKE  522
             LACL +I   +  +S + PLPHM+++KDLV DMT FY QY+S++P+L+R  P P  G+E
Sbjct  145  TLACLCRIPTDTTKESRIYPLPHMYIVKDLVPDMTLFYKQYRSVKPYLQRDTPAP-DGRE  203

Query  523  VLQSKADRSKLDGMYECILCACCSTSCP  606
              QSK +R KLDG+YECILCACCSTSCP
Sbjct  204  YRQSKEERKKLDGLYECILCACCSTSCP  231



>dbj|BAJ07110.1| succinate dehydrogenase subunit B [Corynespora cassiicola]
Length=307

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 149/208 (72%), Gaps = 9/208 (4%)
 Frame = +1

Query  4    GFPAMASSLVRRAITKVSS----SPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSP  171
            GF ++  +  R  ++KV+      PA K+ +  +  S    PQ    AK K F IYRW+P
Sbjct  26   GFASVTDTAAREPVSKVAEKIVPDPARKV-VPESQTSTVKDPQPDKDAKTKTFHIYRWNP  84

Query  172  ENP-QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKN  348
            + P  KP++Q Y +DL + GPM+LDALI+IKNE+DPTLTFRRSCREGICGSCAMNIDG N
Sbjct  85   DEPTSKPKMQTYTLDLNKTGPMMLDALIRIKNELDPTLTFRRSCREGICGSCAMNIDGVN  144

Query  349  GLACLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKE  522
             LACL +I   +  +S + PLPHM+++KDLV DMT FY QY+S++P+L+R  P P  G+E
Sbjct  145  TLACLCRIPTDTTKESRIYPLPHMYIVKDLVPDMTLFYKQYRSVKPYLQRDTPAP-DGRE  203

Query  523  VLQSKADRSKLDGMYECILCACCSTSCP  606
              QSK +R KLDG+YECILCACCSTSCP
Sbjct  204  YRQSKEERKKLDGLYECILCACCSTSCP  231



>emb|CCE26570.1| probable succinate dehydrogenase (ubiquinone) iron-sulfur protein 
precursor [Claviceps purpurea 20.1]
Length=276

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 139/178 (78%), Gaps = 5/178 (3%)
 Frame = +1

Query  82   LARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIKI  258
              R+ AS   APQ  A   +K FQ+YRW+P++P +KP++Q Y IDL + GPMVLDAL++I
Sbjct  25   FTRSMASVGEAPQEKA-PNMKTFQVYRWNPDSPTEKPKMQSYTIDLNKTGPMVLDALVRI  83

Query  259  KNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHMFVIKDL  432
            KNE+DPTLTFRRSCREGICGSCAMNI+G+N LACL +I   S  D  + PLPH +V+KDL
Sbjct  84   KNELDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIPAESSSDVKLYPLPHTYVVKDL  143

Query  433  VVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            V D+T+FY QYKSI+P+L+R  P P  GKE  QSK DR KLDG+YECILCACCSTSCP
Sbjct  144  VPDLTHFYKQYKSIKPYLQRDTPSP-DGKEYRQSKEDRKKLDGLYECILCACCSTSCP  200



>dbj|BAO42719.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit [Kluyveromyces 
marxianus DMKU3-1042]
 dbj|BAP74089.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit [Kluyveromyces 
marxianus]
Length=254

 Score =   236 bits (601),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 141/180 (78%), Gaps = 8/180 (4%)
 Frame = +1

Query  76   MTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALI  252
            +   R  A+E  A    A+ ++K F+IYRWSP+ P +KP LQEY++DL +CGPMVLDALI
Sbjct  4    VIFKRGLATEVKA----AAPRLKTFKIYRWSPDTPAEKPRLQEYKVDLNQCGPMVLDALI  59

Query  253  KIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD--SMVTPLPHMFVIK  426
            KIKNE DPTLTFRRSCREGICGSCAMNI G+N LACL +I    +  + + PLPHM++++
Sbjct  60   KIKNEQDPTLTFRRSCREGICGSCAMNIGGRNTLACLCRIDQNENKQTKIYPLPHMYIVR  119

Query  427  DLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            DLV D+T+FY QYKSI+P+L+R+  P   GKE LQS ADR KLDG+YECILCACCSTSCP
Sbjct  120  DLVPDLTHFYKQYKSIQPYLQREKVPE-DGKENLQSIADRKKLDGLYECILCACCSTSCP  178



>gb|KFH68219.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Mortierella verticillata NRRL 6337]
Length=273

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 148/205 (72%), Gaps = 16/205 (8%)
 Frame = +1

Query  16   MASSLVRRAITKV------SSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPEN  177
            M+ SL R+A   +      S  P+  + +AR+ ASEA         K K FQIYRW+P+ 
Sbjct  1    MSFSLARQATLGLTRPVIKSHLPSVPLVIARSFASEA------PEKKTKTFQIYRWNPDK  54

Query  178  P-QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGL  354
            P +KP+LQ YE+D+  CGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNI+G N L
Sbjct  55   PAEKPKLQSYEVDMNSCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIEGSNTL  114

Query  355  ACLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQ  531
            AC+ KI   G  + + PLPH +V+KDL+ D+T FY QYKSIEP+LK+K P     +E LQ
Sbjct  115  ACICKIHVDGKPTKIYPLPHTYVVKDLIPDLTQFYAQYKSIEPFLKQKTPE--LERENLQ  172

Query  532  SKADRSKLDGMYECILCACCSTSCP  606
            +  DR KLDG+YECILCACCSTSCP
Sbjct  173  TIEDRKKLDGLYECILCACCSTSCP  197



>gb|ESW98615.1| Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Ogataea parapolymorpha DL-1]
Length=253

 Score =   236 bits (601),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 139/172 (81%), Gaps = 5/172 (3%)
 Frame = +1

Query  100  SEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIKIKNEIDP  276
            S   A QATA  ++K F+IYRWSP+ P +KP +QEY+IDL +CGPMVLDA+IKIKNE D 
Sbjct  8    SRGMATQATAQ-RLKTFKIYRWSPDTPDKKPYMQEYKIDLNQCGPMVLDAIIKIKNEQDA  66

Query  277  TLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTN  450
            TLTFRRSCREGICGSCAMNI G+N LACL KI   +  ++ + PLPHM++++DLV D+T+
Sbjct  67   TLTFRRSCREGICGSCAMNIGGQNTLACLCKIDQDTSKETKIYPLPHMYIVRDLVPDLTH  126

Query  451  FYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            FY QYKSI+P+L+ KN P   GKE LQS+ DR KLDG+YECILCACCSTSCP
Sbjct  127  FYKQYKSIQPYLQTKNKPA-DGKENLQSEEDRKKLDGLYECILCACCSTSCP  177



>dbj|BAH72989.1| iron-sulfur subunit of succinate dehydrogenase [Mortierella alpina]
Length=272

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 150/204 (74%), Gaps = 15/204 (7%)
 Frame = +1

Query  16   MASSLVRRAITKVSSS-----PAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP  180
            M+ S+ +++   +S S     P+A + +AR+ A+EA A       K K FQIYRW+P+ P
Sbjct  1    MSLSIAKQSALGLSRSIKYSIPSAPVAIARSFATEAPA------KKTKTFQIYRWNPDQP  54

Query  181  -QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLA  357
             +KP+LQ YE+D+  CGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNI G N LA
Sbjct  55   AEKPKLQSYEVDMNNCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGSNTLA  114

Query  358  CLTKIS-SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            C+ KI      + + PLPH +V+KDL+ D+T FY QYKSIEP+LK+K P   P +E LQ+
Sbjct  115  CICKIEVDNKPTKIYPLPHTYVVKDLIPDLTQFYAQYKSIEPFLKQKTPE--PERENLQT  172

Query  535  KADRSKLDGMYECILCACCSTSCP  606
              DR KLDG+YECILCACCSTSCP
Sbjct  173  IEDRKKLDGLYECILCACCSTSCP  196



>ref|XP_009649180.1| succinate dehydrogenase iron-sulfur subunit [Verticillium dahliae 
VdLs.17]
 gb|EGY23000.1| succinate dehydrogenase iron-sulfur subunit [Verticillium dahliae 
VdLs.17]
Length=274

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 144/197 (73%), Gaps = 6/197 (3%)
 Frame = +1

Query  31   VRRAITKVSSS---PAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQ  198
            +R + T+V  S   PA +  L     +    P  T   K+K FQIYRW+P+ P +KP +Q
Sbjct  4    LRSSSTRVLGSALRPAFRPALFARTMATVTEPATTPEPKMKSFQIYRWNPDQPTEKPRMQ  63

Query  199  EYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISS  378
             Y +DL + GPMVLDAL++IKNEIDPTLTFRRSCREGICGSCAMNI+G+N LACL +I +
Sbjct  64   TYTLDLNKTGPMVLDALVRIKNEIDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIPT  123

Query  379  GPDSM-VTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKL  555
                M + PLPH +V+KDLV D+T FY QYKSI+P+L+R  P P  GKE  Q+KADR KL
Sbjct  124  ETSEMKIYPLPHTYVVKDLVPDLTQFYKQYKSIKPYLQRDTPSP-DGKEYRQTKADRRKL  182

Query  556  DGMYECILCACCSTSCP  606
            DG+YECILCACCSTSCP
Sbjct  183  DGLYECILCACCSTSCP  199



>ref|XP_011273321.1| succinate dehydrogenase complex, subunit B [Wickerhamomyces ciferrii]
 emb|CCH44826.1| succinate dehydrogenase complex, subunit B [Wickerhamomyces ciferrii]
Length=262

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 139/178 (78%), Gaps = 9/178 (5%)
 Frame = +1

Query  82   LARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIKI  258
            L+R  A+    P     + IKKF+IYRWSP+ P +KP LQEY++DL +CGPM+LDA+IKI
Sbjct  15   LSRGLATTTEKP-----SLIKKFKIYRWSPDKPSEKPHLQEYQVDLNDCGPMILDAIIKI  69

Query  259  KNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSG--PDSMVTPLPHMFVIKDL  432
            KNE DPTLTFRRSCREGICGSCAMNI G+N LACL +I      D+ + PLPHMFV++DL
Sbjct  70   KNEQDPTLTFRRSCREGICGSCAMNIGGRNTLACLCRIDRDVKKDTKIYPLPHMFVVRDL  129

Query  433  VVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            V D+T+FY QYKSI+P+L+R + P   GKE LQS  DR KLDG+YECILCACCSTSCP
Sbjct  130  VPDLTHFYKQYKSIQPYLQRDSIPE-DGKENLQSVEDRKKLDGLYECILCACCSTSCP  186



>ref|XP_003959765.1| hypothetical protein KAFR_0L00230 [Kazachstania africana CBS 
2517]
 emb|CCF60630.1| hypothetical protein KAFR_0L00230 [Kazachstania africana CBS 
2517]
Length=267

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 139/180 (77%), Gaps = 6/180 (3%)
 Frame = +1

Query  82   LARAHASEANAPQATASA--KIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALI  252
            +AR   +   +  AT S   K+K F++YRW+P+ P +KP LQ Y++DL ECGPMVLDAL+
Sbjct  12   IARRGVATTESAMATHSTVPKMKTFKVYRWNPDKPAEKPHLQTYQVDLNECGPMVLDALL  71

Query  253  KIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSG--PDSMVTPLPHMFVIK  426
            KIKNE DPTLTFRRSCREGICGSCAMNI+G+N LACL KI +       + PLPHMF++K
Sbjct  72   KIKNEQDPTLTFRRSCREGICGSCAMNIEGRNTLACLCKIDTNVSKQEKIYPLPHMFIVK  131

Query  427  DLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            DLV D+TNFY QYKSI+P+L+R + P   GKEV QS  DR KLDG+YECILCACCSTSCP
Sbjct  132  DLVPDLTNFYQQYKSIKPYLQRSSFPA-DGKEVPQSIEDRKKLDGLYECILCACCSTSCP  190



>gb|ACO09839.1| Succinate dehydrogenase iron-sulfur protein, mitochondrial precursor 
[Osmerus mordax]
Length=281

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 144/198 (73%), Gaps = 11/198 (6%)
 Frame = +1

Query  25   SLVRRAITKVSSSPAAKMTLAR-AHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQ  198
            S+ R+A   V+   A  M + R A  + A+ PQ     +IKKFQIYRW P+    KP +Q
Sbjct  7    SVGRKA---VAFKNAGAMVMVRLAQTAAASVPQP----RIKKFQIYRWDPDTTGDKPRMQ  59

Query  199  EYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISS  378
             YEIDL  CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G N LACL KI S
Sbjct  60   TYEIDLNNCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGGNTLACLNKIDS  119

Query  379  GPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSK  552
                 + + PLPHM+V+KDLV DM+NFY QYKSIEP+LK+K+      ++  Q+  DR K
Sbjct  120  NTSKATKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESQEGKEQYHQTVEDRQK  179

Query  553  LDGMYECILCACCSTSCP  606
            LDG+YECILCACCSTSCP
Sbjct  180  LDGLYECILCACCSTSCP  197



>dbj|BAM15614.1| iron-sulfur subunit of succinate dehydrogenase [Plasmodium gallinaceum]
Length=313

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 147/204 (72%), Gaps = 14/204 (7%)
 Frame = +1

Query  1    IGFPAMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP  180
            + F  +  SL +++I K S +             E N  +    +++KKF I+R++PEN 
Sbjct  25   VRFSTIQESLNKKSINKESVN------------KEYNEIKKDEESQLKKFSIFRYNPENN  72

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
            ++P++Q +E+D+  CGPMVLD LIKIK+EID TL+FRRSCREGICGSCAMNIDGKNGLAC
Sbjct  73   KRPKMQTFEVDINNCGPMVLDVLIKIKDEIDSTLSFRRSCREGICGSCAMNIDGKNGLAC  132

Query  361  LTKISSGPDSM--VTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            LT+++   + +  + PLP+++V+KDLV D+TNFYNQYKSI+PWLKRK       KE  QS
Sbjct  133  LTEVNKNKNEITEIHPLPNLYVMKDLVPDLTNFYNQYKSIDPWLKRKTKKEKGQKEFYQS  192

Query  535  KADRSKLDGMYECILCACCSTSCP  606
              DR KLDG+YECI+CA CSTSCP
Sbjct  193  IEDRKKLDGLYECIMCASCSTSCP  216



>ref|XP_007819571.2| succinate dehydrogenase iron-sulfur protein [Metarhizium robertsii 
ARSEF 23]
 gb|EXV03306.1| 4Fe-4S dicluster and 2Fe-2S iron-sulfur cluster binding protein 
[Metarhizium robertsii]
 gb|EFZ00786.2| succinate dehydrogenase iron-sulfur protein [Metarhizium robertsii 
ARSEF 23]
Length=277

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 146/198 (74%), Gaps = 7/198 (4%)
 Frame = +1

Query  22   SSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQ  198
            SS +  +  + +  P A  T  R+ AS + AP   AS  +K FQIYRW+P+ P +KP +Q
Sbjct  8    SSRILGSSIRTAMRPGAVFT--RSMASVSEAPHEKAS-NMKTFQIYRWNPDTPTEKPRMQ  64

Query  199  EYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--  372
             Y IDL + GPM+LDAL++IKNE+DPTLTFRRSCREGICGSCAMNI+G+N LACL +I  
Sbjct  65   SYTIDLNKTGPMILDALVRIKNELDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIPA  124

Query  373  SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSK  552
             S  D  + PLPH +V+KDLV D+T FY QYKSI+P+L+R  P P  GKE  QSK DR K
Sbjct  125  ESSSDVKLYPLPHTYVVKDLVPDLTYFYKQYKSIKPYLQRDTPAP-DGKEYRQSKEDRKK  183

Query  553  LDGMYECILCACCSTSCP  606
            LDG+YECILCACCSTSCP
Sbjct  184  LDGLYECILCACCSTSCP  201



>ref|XP_005931534.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Haplochromis burtoni]
Length=279

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 135/180 (75%), Gaps = 6/180 (3%)
 Frame = +1

Query  76   MTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALI  252
            M + R HA  A AP      +IKKFQ+YRW P+    KP +Q YEIDL  CGPMVLDALI
Sbjct  19   MVMVR-HAQTAAAP--APEPRIKKFQVYRWDPDKSGDKPRMQTYEIDLNTCGPMVLDALI  75

Query  253  KIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD--SMVTPLPHMFVIK  426
            KIKNEIDPTLTFRRSCREGICGSCAMNI+G N LACL KI +     + + PLPHM+V+K
Sbjct  76   KIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNKIDANTSKPTKIYPLPHMYVVK  135

Query  427  DLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            DLV DM+NFY QYKSIEP+LK+K+      ++  QS  DR KLDG+YECILCACCSTSCP
Sbjct  136  DLVPDMSNFYAQYKSIEPYLKKKDESQEGKEQYFQSVEDRQKLDGLYECILCACCSTSCP  195



>ref|XP_004575464.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Maylandia zebra]
Length=279

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 135/180 (75%), Gaps = 6/180 (3%)
 Frame = +1

Query  76   MTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALI  252
            M + R HA  A AP      +IKKFQ+YRW P+    KP +Q YEIDL  CGPMVLDALI
Sbjct  19   MVMVR-HAQTAAAP--APEPRIKKFQVYRWDPDKSGDKPRMQTYEIDLNTCGPMVLDALI  75

Query  253  KIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD--SMVTPLPHMFVIK  426
            KIKNEIDPTLTFRRSCREGICGSCAMNI+G N LACL KI +     + + PLPHM+V+K
Sbjct  76   KIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNKIDANTSKPTKIYPLPHMYVVK  135

Query  427  DLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            DLV DM+NFY QYKSIEP+LK+K+      ++  QS  DR KLDG+YECILCACCSTSCP
Sbjct  136  DLVPDMSNFYAQYKSIEPYLKKKDESQEGKEQYFQSVEDRQKLDGLYECILCACCSTSCP  195



>ref|XP_001876249.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR13751.1| predicted protein [Laccaria bicolor S238N-H82]
Length=263

 Score =   236 bits (601),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 137/179 (77%), Gaps = 8/179 (4%)
 Frame = +1

Query  88   RAHASEANAPQATASAK---IKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIK  255
            RA +S A   QA  + K    K+F+IYRW+P+ P  KP LQ Y+IDL + GPM+LDALIK
Sbjct  11   RAFSSSARRFQAVPTQKPVLEKEFKIYRWNPDEPATKPTLQSYKIDLNQTGPMILDALIK  70

Query  256  IKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGP--DSMVTPLPHMFVIKD  429
            IKNE+DPTLTFRRSCREGICGSCAMNIDG+N LACL +I   P  D+ + PLPHM+++KD
Sbjct  71   IKNEVDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRIDREPAKDTKIYPLPHMYIVKD  130

Query  430  LVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            LV D+T FY QYKSIEPWL+  NPP     E LQS  +R KLDGMYECILCACCSTSCP
Sbjct  131  LVPDLTLFYKQYKSIEPWLQNDNPP--AEGEFLQSPEERKKLDGMYECILCACCSTSCP  187



>gb|KFH42867.1| Succinate dehydrogenase [ubiquinone] iron-sulfur subunit-like 
protein [Acremonium chrysogenum ATCC 11550]
Length=282

 Score =   236 bits (603),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 151/207 (73%), Gaps = 13/207 (6%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSS------PAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPE  174
            A+ SS  RR +   S++      PAA  T + A  SEA A +     ++K FQIYRW+P+
Sbjct  3    ALRSSAARRVLGTPSAAARTMMRPAAVATRSMASVSEAPAEKP---PRMKSFQIYRWNPD  59

Query  175  NP-QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNG  351
             P +KP +Q Y +DL + GPMVLDA+I+IKNEIDPTLTFRRSCREGICGSCAMNI+G+N 
Sbjct  60   KPTEKPYMQTYTLDLNKTGPMVLDAIIRIKNEIDPTLTFRRSCREGICGSCAMNINGQNT  119

Query  352  LACLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEV  525
            LACL +I   S  D  + PLPH +V+KDLV D+T+FY QYKSI+P+L+R  P P  GKE 
Sbjct  120  LACLCRIPAESSADVKLYPLPHTYVVKDLVPDLTHFYKQYKSIKPYLQRDTPAP-DGKEY  178

Query  526  LQSKADRSKLDGMYECILCACCSTSCP  606
             Q+K DR KLDG+YECILCACCSTSCP
Sbjct  179  RQTKEDRKKLDGLYECILCACCSTSCP  205



>ref|XP_006675189.1| hypothetical protein BATDEDRAFT_18595 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83474.1| hypothetical protein BATDEDRAFT_18595 [Batrachochytrium dendrobatidis 
JAM81]
Length=279

 Score =   236 bits (602),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 146/202 (72%), Gaps = 5/202 (2%)
 Frame = +1

Query  10   PAMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATAS-AKIKKFQIYRWSPE-NPQ  183
            P  A++ +    T V S  A   T     A EA +    A    +K F+IYRW+PE + +
Sbjct  3    PMAATTQLMSRYTNVLSKRAFNTTAVVQLAQEATSANPLAKPVLMKSFEIYRWNPEKSEE  62

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KP +Q Y+IDL +CGPM LDALIKIKNEIDPTLTFRRSCREGICGSCAMNI+G N LACL
Sbjct  63   KPRIQTYQIDLNQCGPMTLDALIKIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACL  122

Query  364  TKISSGPDSM-VTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKA  540
            ++I      + + PLPH +V+KDLV D+TNFY QYKSIEP+LK+K  P  P +E LQ+ A
Sbjct  123  SRIERSSKPLKIFPLPHTYVVKDLVPDLTNFYKQYKSIEPYLKQKTAP--PERENLQTIA  180

Query  541  DRSKLDGMYECILCACCSTSCP  606
            DR+KLDG+YECILCACCSTSCP
Sbjct  181  DRAKLDGLYECILCACCSTSCP  202



>gb|EJK54269.1| hypothetical protein THAOC_26120, partial [Thalassiosira oceanica]
Length=302

 Score =   237 bits (604),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 143/206 (69%), Gaps = 8/206 (4%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASA-KIKKFQIYRWSPENPQKP  189
             M +SL+R A ++++ +        R  +SE        S  +I+ F+IYRW P++ QKP
Sbjct  21   GMRTSLLRTAASRLNPTSGGAALAGRNLSSELKVSSVEQSEERIRYFKIYRWDPDHQQKP  80

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             L  Y +DL +CGPMVLDALIKIK+E DPTLTFRRSCREGICGSCAMNI+G+N LACL  
Sbjct  81   YLSTYPVDLNDCGPMVLDALIKIKSEQDPTLTFRRSCREGICGSCAMNINGQNTLACLCY  140

Query  370  IS-------SGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVL  528
            I        SG  + + PLPHM+V+KDLV DM NFY QY+SIEPWL+ K        E L
Sbjct  141  IDGKEGEKKSGGVTKIYPLPHMYVLKDLVPDMGNFYEQYRSIEPWLQSKEGKKEGQGEFL  200

Query  529  QSKADRSKLDGMYECILCACCSTSCP  606
            Q++ DR+KLDGMYECILCACCSTSCP
Sbjct  201  QTREDRAKLDGMYECILCACCSTSCP  226



>emb|CEL53558.1| succinate dehydrogenase iron-sulfur subunit [Rhizoctonia solani 
AG-1 IB]
Length=278

 Score =   236 bits (602),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 140/203 (69%), Gaps = 11/203 (5%)
 Frame = +1

Query  25   SLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKK------FQIYRWSPENP-Q  183
            SL R+A+    S    +   + A  S+A   Q T      K      F+IYRW+P+ P  
Sbjct  2    SLARQAVFSSRSFAVRRAFASSAVRSQAVPTQETGQIPTGKKPLNKVFKIYRWNPDEPAS  61

Query  184  KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL  363
            KP+LQ Y IDL  CGPM+LDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG N LACL
Sbjct  62   KPKLQSYTIDLNSCGPMILDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGVNTLACL  121

Query  364  --TKISSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
              T  S   D+ + PLPHM+++KDLV D+T FY QYKSIEP+LK  NPP     E LQS 
Sbjct  122  CRTSRSESQDAKIYPLPHMYIVKDLVPDLTQFYKQYKSIEPYLKNDNPP--EKGEFLQSP  179

Query  538  ADRSKLDGMYECILCACCSTSCP  606
             DR KLDGMYECILCACCSTSCP
Sbjct  180  EDRRKLDGMYECILCACCSTSCP  202



>gb|EQK99080.1| succinate dehydrogenase iron-sulfur protein [Ophiocordyceps sinensis 
CO18]
Length=278

 Score =   236 bits (602),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 147/196 (75%), Gaps = 7/196 (4%)
 Frame = +1

Query  28   LVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEY  204
            L+  A ++ +  P+A    + A  S+  A Q    +++K FQ+YRW+P+ P +KP +Q Y
Sbjct  10   LLGSAASRTALRPSAVFARSMASVSDVAAEQ---QSQMKTFQVYRWNPDTPSEKPRMQSY  66

Query  205  EIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SS  378
             IDLK+ GPM+LDALI+IKNE+DP+LTFRRSCREGICGSCAMNI+G+N LACL +I   S
Sbjct  67   TIDLKKTGPMILDALIRIKNELDPSLTFRRSCREGICGSCAMNINGQNTLACLCRIPAES  126

Query  379  GPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLD  558
              D  + PLPH +V+KDLV D+T+FY QYKSI+P+L+R  P P  GKE  QSK DR KLD
Sbjct  127  QADVKLYPLPHTYVVKDLVPDLTHFYKQYKSIKPFLQRDTPEP-DGKEFRQSKEDRRKLD  185

Query  559  GMYECILCACCSTSCP  606
            G+YECILCACCSTSCP
Sbjct  186  GLYECILCACCSTSCP  201



>emb|CAA75895.1| succinate dehydrogenase iron-sulfur subunit [Agaricus bisporus]
Length=245

 Score =   235 bits (599),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 134/171 (78%), Gaps = 7/171 (4%)
 Frame = +1

Query  106  ANAPQATASAKIKK-FQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIKIKNEIDPT  279
            A A QA     ++K F+IYRW+P+ P +KP LQ Y+IDL +CGPM+LDALIKIKNE+DPT
Sbjct  2    ARAAQAVQKPVLEKEFKIYRWNPDEPSKKPTLQSYKIDLNQCGPMILDALIKIKNEMDPT  61

Query  280  LTFRRSCREGICGSCAMNIDGKNGLACLTKIS--SGPDSMVTPLPHMFVIKDLVVDMTNF  453
            LTFRRSCREGICGSCAMNIDG+N LACL +I      D+ V PLPHM+V+KDLV D+T F
Sbjct  62   LTFRRSCREGICGSCAMNIDGQNTLACLCRIDREGSKDTKVYPLPHMYVVKDLVPDLTLF  121

Query  454  YNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            Y QYKSI+PWL+  NP   P  E LQS  DR KLDG+YECILCACCSTSCP
Sbjct  122  YKQYKSIQPWLQNDNP---PAHEHLQSIEDRKKLDGLYECILCACCSTSCP  169



>ref|XP_003963013.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Takifugu rubripes]
Length=278

 Score =   236 bits (602),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 143/200 (72%), Gaps = 9/200 (5%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPE  192
            M+ +L R  +   +S     M  A+  A+ A  P      ++KKFQIYRW P+    KP 
Sbjct  1    MSLALRRNLLAFRNSGVLVMMRYAQTAAALAPEP------RLKKFQIYRWDPDTAGDKPR  54

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            +Q YEIDL  CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G N LACL KI
Sbjct  55   MQTYEIDLNACGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGGNTLACLNKI  114

Query  373  SSGPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADR  546
             +  +  + + PLPHM+V+KDLV DM+NFY QYKSIEP+LK+K+      ++  QS  DR
Sbjct  115  DTNTNKTTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDETQEGKEQYFQSVEDR  174

Query  547  SKLDGMYECILCACCSTSCP  606
             KLDG+YECILCACCSTSCP
Sbjct  175  QKLDGLYECILCACCSTSCP  194



>gb|EKG14795.1| Ferredoxin [Macrophomina phaseolina MS6]
Length=287

 Score =   236 bits (602),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 146/211 (69%), Gaps = 14/211 (7%)
 Frame = +1

Query  13   AMASSLVR--RAITKVSSSPAAKMTLARAHAS--------EANAPQATASAKIKKFQIYR  162
            A   +L R  R+ T  S +P +     R  AS            P+    AK+K F IYR
Sbjct  2    ATTRALARLSRSATAASRTPVSSTVFKRGMASFVPESQTSTVAEPKPDKDAKVKTFHIYR  61

Query  163  WSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNID  339
            W+P+ P  KP++Q Y +DL + GPM+LDALI+IKNE+DPTLTFRRSCREGICGSCAMNID
Sbjct  62   WNPDEPSSKPKMQTYTLDLNKTGPMMLDALIRIKNEVDPTLTFRRSCREGICGSCAMNID  121

Query  340  GKNGLACLTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIP  513
            G N LACL +I   +  +S + PLPH +V+KDLV D+T FY QY+SI+P+L+R  PPP  
Sbjct  122  GVNTLACLCRIPTDTTKESRIYPLPHTYVVKDLVPDLTQFYKQYRSIKPYLQRDTPPP-D  180

Query  514  GKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            G+E  QSK DR KLDG+YECILCACCSTSCP
Sbjct  181  GRENRQSKEDRKKLDGLYECILCACCSTSCP  211



>gb|EZA47846.1| Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Cerapachys biroi]
Length=254

 Score =   235 bits (599),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 132/163 (81%), Gaps = 3/163 (2%)
 Frame = +1

Query  127  ASAKIKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCR  303
            A A++K F +YRW+P+ P+ KP +Q+Y++DL  CGPMVLDALIKIKNEIDPTLTFRRSCR
Sbjct  18   AEARLKTFSVYRWNPDKPEEKPYMQKYKVDLNSCGPMVLDALIKIKNEIDPTLTFRRSCR  77

Query  304  EGICGSCAMNIDGKNGLACLTKISSGPDSM--VTPLPHMFVIKDLVVDMTNFYNQYKSIE  477
            EGICGSCAMNI G N LAC++KI +   +   V PLPHM+++KDLV D+ NFYNQY+SI+
Sbjct  78   EGICGSCAMNIGGTNTLACISKIDTNTSTSCDVYPLPHMYIVKDLVPDLNNFYNQYRSIQ  137

Query  478  PWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            PWL+R +   +  ++ LQS  DR KLDG+YECILCACCSTSCP
Sbjct  138  PWLQRDSTEKVGSEQYLQSIEDRKKLDGLYECILCACCSTSCP  180



>ref|XP_007323431.1| iron-sulfur protein subunit of succinate dehydrogenase, Sdh2p 
[Serpula lacrymans var. lacrymans S7.9]
 gb|EGN94513.1| SDHB, iron-sulfur protein subunit of succinate dehydrogenase 
[Serpula lacrymans var. lacrymans S7.3]
 gb|EGO19996.1| iron-sulfur protein subunit of succinate dehydrogenase, Sdh2p 
[Serpula lacrymans var. lacrymans S7.9]
Length=279

 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 139/179 (78%), Gaps = 8/179 (4%)
 Frame = +1

Query  88   RAHASEANAPQATASAK---IKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIK  255
            R+ AS A   QA  + K   +K+F+IYRW+P+ P +KP LQ Y IDL + GPM+LDALIK
Sbjct  27   RSFASSARRSQAVPTEKPVLMKEFKIYRWNPDEPAKKPTLQSYTIDLNQTGPMILDALIK  86

Query  256  IKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACL--TKISSGPDSMVTPLPHMFVIKD  429
            IKNEIDPTLTFRRSCREGICGSCAMNIDG+N LACL  T  + G D+ V PLPHM+++KD
Sbjct  87   IKNEIDPTLTFRRSCREGICGSCAMNIDGQNTLACLCRTDRNVGKDAKVYPLPHMYIVKD  146

Query  430  LVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            LV D+T FY QYKSI+P+L+  NPP     E LQS+ +R KLDG+YECILCACCSTSCP
Sbjct  147  LVPDLTLFYKQYKSIQPYLQNDNPP--ASGEFLQSQEERKKLDGLYECILCACCSTSCP  203



>ref|XP_007828551.1| Succinate dehydrogenase [ubiquinone] iron-sulfur subunit [Pestalotiopsis 
fici W106-1]
 gb|ETS87951.1| Succinate dehydrogenase [ubiquinone] iron-sulfur subunit [Pestalotiopsis 
fici W106-1]
Length=282

 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 147/203 (72%), Gaps = 6/203 (3%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEAN---APQATASAKIKKFQIYRWSPENP-  180
            + +S L+  A       PAA  + + A   +A     P+    +++K FQIYRW+P+ P 
Sbjct  6    STSSRLLASASRPAFVKPAAIFSRSMASVGDATVQATPKGADDSRMKTFQIYRWNPDQPT  65

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
            +KP +Q Y +DL + GPMVLDAL++IKNE+DPTLTFRRSCREGICGSCAMNI+G N LAC
Sbjct  66   EKPRMQSYTLDLNKTGPMVLDALVRIKNEVDPTLTFRRSCREGICGSCAMNINGTNTLAC  125

Query  361  LTKISSGPDSM-VTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSK  537
            L +I +    M + PLPH +V+KDLV D+T+FY QYKSI+P+L+R  P P  G+E  QSK
Sbjct  126  LCRIPTDTKDMKIYPLPHTYVVKDLVPDLTHFYKQYKSIKPYLQRDTPAP-DGREYRQSK  184

Query  538  ADRSKLDGMYECILCACCSTSCP  606
            ADR KLDG+YECILCACCSTSCP
Sbjct  185  ADRKKLDGLYECILCACCSTSCP  207



>ref|XP_010785173.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial [Notothenia coriiceps]
Length=281

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 145/201 (72%), Gaps = 8/201 (4%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKP  189
            ++ S ++ R +  + +S    M +   HA  A AP      +IKKFQIYRW P++   KP
Sbjct  2    SVVSLVLSRNVLAIRNS---GMVVMVRHAQTAAAP--APEPRIKKFQIYRWDPDSAGNKP  56

Query  190  ELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTK  369
             +Q Y+IDL  CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G N LACL K
Sbjct  57   RMQTYDIDLNSCGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNINGGNTLACLNK  116

Query  370  ISSGPD--SMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKAD  543
            I +     + + PLPHM+V+KDLV DM+NFY QYKSIEP+LK+K+      ++  QS  D
Sbjct  117  IDTKTSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDEAQEGKEQYYQSVED  176

Query  544  RSKLDGMYECILCACCSTSCP  606
            R KLDG+YECILCACCSTSCP
Sbjct  177  RQKLDGLYECILCACCSTSCP  197



>gb|AAY66829.1| succinate dehydrogenase Ip subunit [Ixodes scapularis]
Length=282

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 143/199 (72%), Gaps = 7/199 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPE  192
            MA+S+  +    ++SS     T   A    A A        +KKF+IYRW+PE    KP 
Sbjct  1    MAASVYAKKSLLLASS-----TFRFASLRHAAAAAPAGDKGVKKFEIYRWNPEKKGDKPR  55

Query  193  LQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI  372
            LQ YE+DL  CGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNIDG+N LAC+ KI
Sbjct  56   LQTYEVDLNACGPMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIDGRNTLACICKI  115

Query  373  SS-GPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRS  549
             + G  + + PLPHM+V+KDLV DMT FY QYKSI+PWL++K    +  ++ LQS  DR 
Sbjct  116  DNPGQSTKIYPLPHMYVVKDLVPDMTLFYEQYKSIQPWLQKKTEVKLGEQQHLQSIEDRK  175

Query  550  KLDGMYECILCACCSTSCP  606
            KLDG+YECILCACCSTSCP
Sbjct  176  KLDGLYECILCACCSTSCP  194



>gb|ACO57604.1| succinate dehydrogenase complex subunit B, partial [Gillichthys 
mirabilis]
Length=241

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 136/183 (74%), Gaps = 7/183 (4%)
 Frame = +1

Query  67   AAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLD  243
             A M +  A  + A AP+     +IKKFQIYRW P+ P  KP +Q YEI+L  CGPMVLD
Sbjct  19   GAIMLVRYAQTAAAPAPEP----RIKKFQIYRWDPDTPGDKPRMQTYEINLDTCGPMVLD  74

Query  244  ALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD--SMVTPLPHMF  417
            ALIKIKNE+DPTLTFRRSCREGICGSCAMNI+G N LACL KI +     + + PLPHM+
Sbjct  75   ALIKIKNEMDPTLTFRRSCREGICGSCAMNINGGNTLACLNKIDTNTSKPTKIYPLPHMY  134

Query  418  VIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCST  597
            V+KDLV DM+NFY QYKSIEP+LK+K+       +  QS  DR KLDG+YECILCACCST
Sbjct  135  VVKDLVPDMSNFYAQYKSIEPYLKKKDESQEGKNQYYQSVEDRQKLDGLYECILCACCST  194

Query  598  SCP  606
            SCP
Sbjct  195  SCP  197



>ref|XP_011349118.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial-like [Cerapachys biroi]
Length=281

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 132/163 (81%), Gaps = 3/163 (2%)
 Frame = +1

Query  127  ASAKIKKFQIYRWSPENPQ-KPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCR  303
            A A++K F +YRW+P+ P+ KP +Q+Y++DL  CGPMVLDALIKIKNEIDPTLTFRRSCR
Sbjct  30   AEARLKTFSVYRWNPDKPEEKPYMQKYKVDLNSCGPMVLDALIKIKNEIDPTLTFRRSCR  89

Query  304  EGICGSCAMNIDGKNGLACLTKISSGPDSM--VTPLPHMFVIKDLVVDMTNFYNQYKSIE  477
            EGICGSCAMNI G N LAC++KI +   +   V PLPHM+++KDLV D+ NFYNQY+SI+
Sbjct  90   EGICGSCAMNIGGTNTLACISKIDTNTSTSCDVYPLPHMYIVKDLVPDLNNFYNQYRSIQ  149

Query  478  PWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            PWL+R +   +  ++ LQS  DR KLDG+YECILCACCSTSCP
Sbjct  150  PWLQRDSTEKVGSEQYLQSIEDRKKLDGLYECILCACCSTSCP  192



>gb|KIW01365.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial 
[Verruconis gallopava]
Length=277

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 141/179 (79%), Gaps = 7/179 (4%)
 Frame = +1

Query  88   RAHASEANAPQATA---SAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIK  255
            RA+A+EA+  Q  A    AK+K F++YRW+P+ P +KP +Q Y +DL + GPM+LDALI+
Sbjct  24   RAYATEASTTQEPAPSKDAKMKTFKVYRWNPDTPNEKPRMQTYTLDLNKTGPMMLDALIR  83

Query  256  IKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHMFVIKD  429
            IKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I   +  +S + PLPH +V+KD
Sbjct  84   IKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIPTDTTKESRIYPLPHTYVVKD  143

Query  430  LVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            LV DMT FY QY+SI+P+L+R  PPP  G+E  QS A+R KLDG+YECILCACCSTSCP
Sbjct  144  LVPDMTQFYKQYRSIKPYLQRDTPPP-DGRENRQSIAERKKLDGLYECILCACCSTSCP  201



>emb|CDO94128.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=254

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = +1

Query  82   LARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLDALIKI  258
            + R  A+EA A     + ++K F+IYRWSP+ P +KP LQEY++DL +CGPMVLDALIKI
Sbjct  6    IKRGLATEAKA----VAPRLKTFKIYRWSPDKPAEKPRLQEYQVDLNQCGPMVLDALIKI  61

Query  259  KNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKISSGPD--SMVTPLPHMFVIKDL  432
            KNE D TLTFRRSCREGICGSCAMNI G+N LACL +I    +  S + PLPHM++++DL
Sbjct  62   KNEQDATLTFRRSCREGICGSCAMNIGGRNTLACLCRIDQNENKQSKIYPLPHMYIVRDL  121

Query  433  VVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCSTSCP  606
            V D+T+FY QYKSI+P+L+R   P   GKE LQS ADR KLDG+YECILCACCSTSCP
Sbjct  122  VPDLTHFYKQYKSIQPYLQRSQVPE-DGKENLQSIADRKKLDGLYECILCACCSTSCP  178



>gb|AER08702.1| mitochondrial succinate dehydrogenase subunit B [Zymoseptoria 
tritici]
Length=297

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = +1

Query  67   AAKMTLARAHASEANAPQATASAKIKKFQIYRWSPENP-QKPELQEYEIDLKECGPMVLD  243
            A++  +     S    PQ  A AK K F IYRW+P+ P  KP +Q Y +DL + GPM+LD
Sbjct  39   ASRPPIKETKTSTVKEPQMDADAKTKTFHIYRWNPDQPTDKPRMQSYTLDLNKTGPMMLD  98

Query  244  ALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLACLTKI--SSGPDSMVTPLPHMF  417
            ALI+IKNE+DPTLTFRRSCREGICGSCAMNIDG N LACL +I   +  ++ + PLPH++
Sbjct  99   ALIRIKNEVDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIPTDTAKETRIYPLPHIY  158

Query  418  VIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQSKADRSKLDGMYECILCACCST  597
            V+KDLV DMT FY QYKSI+P+L+R   PP  GKE  QS ADR KLDG+YECILCACCST
Sbjct  159  VVKDLVPDMTQFYKQYKSIKPYLQRDTAPP-DGKENRQSVADRKKLDGLYECILCACCST  217

Query  598  SCP  606
            SCP
Sbjct  218  SCP  220



>ref|XP_007843521.1| succinate dehydrogenase iron-sulfur subunit [Moniliophthora roreri 
MCA 2997]
 gb|ESK97184.1| succinate dehydrogenase iron-sulfur subunit [Moniliophthora roreri 
MCA 2997]
Length=277

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 150/204 (74%), Gaps = 11/204 (5%)
 Frame = +1

Query  13   AMASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASAK---IKKFQIYRWSPENP-  180
            ++ SS +R +  + + +P  +   AR  +S   A QA    K    K+F+IYRW+P+ P 
Sbjct  3    SVFSSALRVSSRRATCAPKFQ---ARTFSSSVPAFQAEPLQKPVLNKEFKIYRWNPDEPS  59

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
            +KP LQ Y IDL +CGPM+LDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDG+N LAC
Sbjct  60   KKPTLQSYTIDLNQCGPMILDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGQNTLAC  119

Query  361  LTKI--SSGPDSMVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPIPGKEVLQS  534
            L +I  +   D+ V PLPHM+++KDLV D+T FY QYKSI+P+L+  NPP     E LQS
Sbjct  120  LCRIDRNGAKDTKVYPLPHMYIVKDLVPDLTLFYKQYKSIQPYLQNDNPP--EKGEFLQS  177

Query  535  KADRSKLDGMYECILCACCSTSCP  606
            + DR KLDG+YECILCACCSTSCP
Sbjct  178  QEDRRKLDGLYECILCACCSTSCP  201



>ref|XP_005190481.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, 
mitochondrial [Musca domestica]
Length=297

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 149/206 (72%), Gaps = 9/206 (4%)
 Frame = +1

Query  16   MASSLVRRAITKVSSSPAAKMTLARAHASEANAPQATASA----KIKKFQIYRWSPENP-  180
            M  +  R  +++  +  A +   +    S+ N  QA A +    +IK FQIYRW+P+N  
Sbjct  1    MLVNEARLMLSRTGAVAARQQLRSLTSGSQQNNQQAEAKSAPEPQIKTFQIYRWNPDNAG  60

Query  181  QKPELQEYEIDLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGKNGLAC  360
            +KP +Q Y+++L+ECGPMVLDALIKIKNE+DPTLTFRRSCREGICGSCAMNI G N LAC
Sbjct  61   EKPYMQTYQVNLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIAGTNTLAC  120

Query  361  LTKISSGPDS--MVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKN-PPPIPGK-EVL  528
            ++KI +       V PLPHM+V++DLV DM +FY QY+SI+PWL+RKN      GK + L
Sbjct  121  ISKIDTNTSKPLKVYPLPHMYVVRDLVPDMNHFYEQYRSIQPWLQRKNEASEKKGKAQYL  180

Query  529  QSKADRSKLDGMYECILCACCSTSCP  606
            QS  DRSKLDG+YECILCACCSTSCP
Sbjct  181  QSVEDRSKLDGLYECILCACCSTSCP  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800