BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF002F13

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613028.1|  PREDICTED: (+)-neomenthol dehydrogenase            148   1e-51   Nicotiana tomentosiformis
ref|XP_009770218.1|  PREDICTED: (+)-neomenthol dehydrogenase            147   3e-51   Nicotiana sylvestris
ref|XP_006342322.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       142   2e-50   Solanum tuberosum [potatoes]
ref|XP_010650718.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    140   9e-50   Vitis vinifera
ref|XP_004308961.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       137   1e-48   Fragaria vesca subsp. vesca
ref|XP_011471010.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       135   5e-48   Fragaria vesca subsp. vesca
ref|XP_010930460.1|  PREDICTED: (+)-neomenthol dehydrogenase            137   8e-48   Elaeis guineensis
emb|CDP08000.1|  unnamed protein product                                144   9e-48   Coffea canephora [robusta coffee]
ref|XP_010650717.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    140   1e-47   Vitis vinifera
ref|XP_004234867.1|  PREDICTED: (+)-neomenthol dehydrogenase            134   5e-47   Solanum lycopersicum
emb|CBI24696.3|  unnamed protein product                                139   4e-46   Vitis vinifera
ref|XP_006442161.1|  hypothetical protein CICLE_v10021349mg             132   5e-46   Citrus clementina [clementine]
ref|XP_006492782.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       132   5e-46   Citrus sinensis [apfelsine]
gb|KDO40655.1|  hypothetical protein CISIN_1g022103mg                   132   6e-46   Citrus sinensis [apfelsine]
ref|XP_006376448.1|  hypothetical protein POPTR_0013s13140g             138   6e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010242706.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       134   8e-46   Nelumbo nucifera [Indian lotus]
ref|XP_006442162.1|  hypothetical protein CICLE_v10021349mg             132   8e-46   
ref|XP_002524868.1|  carbonyl reductase, putative                       136   1e-45   
ref|XP_008223612.1|  PREDICTED: LOW QUALITY PROTEIN: (+)-neomenth...    127   2e-45   Prunus mume [ume]
ref|XP_004135331.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       137   2e-45   Cucumis sativus [cucumbers]
ref|XP_011091715.1|  PREDICTED: (+)-neomenthol dehydrogenase            133   3e-45   Sesamum indicum [beniseed]
ref|XP_011037379.1|  PREDICTED: (+)-neomenthol dehydrogenase            135   4e-45   Populus euphratica
ref|XP_010672446.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    139   5e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008802059.1|  PREDICTED: (+)-neomenthol dehydrogenase            134   7e-45   
ref|XP_010258458.1|  PREDICTED: (+)-neomenthol dehydrogenase            130   7e-45   Nelumbo nucifera [Indian lotus]
ref|XP_006858784.1|  hypothetical protein AMTR_s00066p00159430          137   7e-45   Amborella trichopoda
ref|XP_010672445.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    139   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007153728.1|  hypothetical protein PHAVU_003G060100g             127   3e-44   Phaseolus vulgaris [French bean]
ref|XP_008375556.1|  PREDICTED: (+)-neomenthol dehydrogenase            133   3e-44   
ref|XP_008354829.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       130   3e-44   
ref|XP_006402662.1|  hypothetical protein EUTSA_v10006128mg             127   3e-44   Eutrema salsugineum [saltwater cress]
ref|XP_008446020.1|  PREDICTED: (+)-neomenthol dehydrogenase            135   5e-44   Cucumis melo [Oriental melon]
gb|KFK35185.1|  hypothetical protein AALP_AA5G251400                    127   5e-44   Arabis alpina [alpine rockcress]
ref|XP_003520181.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       120   8e-44   Glycine max [soybeans]
emb|CDX67809.1|  BnaA07g18490D                                          130   9e-44   
ref|XP_006583851.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       126   1e-43   Glycine max [soybeans]
ref|XP_009341576.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    124   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_008661481.1|  PREDICTED: hypothetical protein isoform X3         137   5e-43   
ref|XP_010526584.1|  PREDICTED: (+)-neomenthol dehydrogenase            129   9e-43   Tarenaya hassleriana [spider flower]
ref|XP_003580060.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       134   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_008668377.1|  PREDICTED: hypothetical protein isoform X1         135   1e-42   
gb|AES90281.2|  short chain dehydrogenase/reductase                     118   2e-42   Medicago truncatula
ref|XP_004505149.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       120   2e-42   Cicer arietinum [garbanzo]
ref|XP_002878286.1|  short-chain dehydrogenase/reductase family p...    127   2e-42   
gb|EAY86622.1|  hypothetical protein OsI_08003                          136   2e-42   Oryza sativa Indica Group [Indian rice]
dbj|BAK07101.1|  predicted protein                                      136   3e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007033726.1|  NAD(P)-binding Rossmann-fold superfamily pro...    124   3e-42   
ref|XP_007033725.1|  NAD(P)-binding Rossmann-fold superfamily pro...    124   3e-42   
emb|CDY05983.1|  BnaA09g37970D                                          127   4e-42   
ref|XP_009116638.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       126   4e-42   Brassica rapa
gb|EAZ23756.1|  hypothetical protein OsJ_07463                          136   4e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009415038.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    121   5e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047383.1|  Os02g0607700                                       136   5e-42   
ref|XP_004976089.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       134   5e-42   Setaria italica
ref|XP_002448112.1|  hypothetical protein SORBIDRAFT_06g021390          134   6e-42   Sorghum bicolor [broomcorn]
ref|XP_010413651.1|  PREDICTED: salutaridine reductase-like isofo...    124   7e-42   Camelina sativa [gold-of-pleasure]
ref|XP_004953042.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       132   7e-42   Setaria italica
ref|XP_009341577.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    123   2e-41   Pyrus x bretschneideri [bai li]
emb|CDX71880.1|  BnaC08g29940D                                          126   2e-41   
ref|XP_010512245.1|  PREDICTED: salutaridine reductase-like             124   2e-41   Camelina sativa [gold-of-pleasure]
emb|CAD41255.1|  OSJNBa0067K08.7                                        133   3e-41   Oryza sativa Japonica Group [Japonica rice]
gb|AAR96014.1|  putative short-chain hydrogenase/reductase              117   5e-41   Musa acuminata [banana]
ref|XP_010235675.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       131   7e-41   
gb|KJB71626.1|  hypothetical protein B456_011G134500                    124   9e-41   Gossypium raimondii
gb|KHG00050.1|  Salutaridine reductase                                  122   2e-40   Gossypium arboreum [tree cotton]
ref|XP_010469284.1|  PREDICTED: salutaridine reductase-like             120   2e-40   Camelina sativa [gold-of-pleasure]
gb|EMT28204.1|  (+)-neomenthol dehydrogenase                            134   3e-40   
gb|KDP35152.1|  hypothetical protein JCGZ_10686                         124   3e-40   Jatropha curcas
ref|XP_010413652.1|  PREDICTED: salutaridine reductase-like isofo...    124   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002454149.1|  hypothetical protein SORBIDRAFT_04g025500          133   4e-40   Sorghum bicolor [broomcorn]
ref|NP_001169234.1|  hypothetical protein                               126   4e-40   
ref|XP_009341578.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       120   6e-40   Pyrus x bretschneideri [bai li]
gb|AAV64232.1|  unknown                                                 125   1e-39   Zea mays [maize]
ref|NP_191530.1|  Rossmann-fold NAD(P)-binding domain-containing ...    118   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009415037.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    112   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006292992.1|  hypothetical protein CARUB_v10019270mg             120   2e-39   
gb|KJB71627.1|  hypothetical protein B456_011G134500                    118   4e-39   Gossypium raimondii
ref|XP_010101370.1|  (+)-neomenthol dehydrogenase                       108   8e-39   Morus notabilis
ref|XP_008678779.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    130   4e-38   Zea mays [maize]
ref|XP_008678780.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...    130   4e-38   Zea mays [maize]
ref|XP_006653560.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       128   3e-37   Oryza brachyantha
ref|XP_010683956.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       114   4e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010523410.1|  PREDICTED: (+)-neomenthol dehydrogenase            110   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_010695747.1|  PREDICTED: carbonyl reductase [NADPH] 1-like...    111   2e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002511075.1|  carbonyl reductase, putative                       107   3e-34   Ricinus communis
gb|EPS58596.1|  hypothetical protein M569_16215                         111   4e-34   Genlisea aurea
ref|XP_006664903.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       112   6e-34   
ref|XP_006394464.1|  hypothetical protein EUTSA_v10004629mg             109   6e-34   Eutrema salsugineum [saltwater cress]
ref|XP_011043014.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       107   1e-33   Populus euphratica
ref|XP_002318788.1|  short-chain dehydrogenase/reductase family p...    106   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011082831.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       109   3e-33   Sesamum indicum [beniseed]
ref|XP_009607625.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       108   4e-33   Nicotiana tomentosiformis
ref|XP_011465268.1|  PREDICTED: carbonyl reductase [NADPH] 1            108   5e-33   Fragaria vesca subsp. vesca
gb|KCW48503.1|  hypothetical protein EUGRSUZ_K02188                     100   6e-33   Eucalyptus grandis [rose gum]
ref|XP_011073283.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       106   9e-33   Sesamum indicum [beniseed]
ref|XP_009786124.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       107   1e-32   Nicotiana sylvestris
gb|KHG28129.1|  (+)-neomenthol dehydrogenase                          99.8    2e-32   Gossypium arboreum [tree cotton]
ref|NP_200991.1|  NAD(P)-binding Rossmann-fold superfamily protein      107   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457835.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       108   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002322311.2|  hypothetical protein POPTR_0015s11980g             103   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_007159946.1|  hypothetical protein PHAVU_002G280700g             104   4e-32   Phaseolus vulgaris [French bean]
gb|ABK23981.1|  unknown                                                 107   4e-32   Picea sitchensis
ref|XP_006402033.1|  hypothetical protein EUTSA_v10014119mg             102   4e-32   Eutrema salsugineum [saltwater cress]
ref|XP_003532306.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       103   5e-32   Glycine max [soybeans]
ref|XP_007038173.1|  NAD(P)-binding Rossmann-fold superfamily pro...    102   5e-32   Theobroma cacao [chocolate]
gb|KFK27919.1|  hypothetical protein AALP_AA8G447200                    106   5e-32   Arabis alpina [alpine rockcress]
gb|KJB19743.1|  hypothetical protein B456_003G117400                  99.4    5e-32   Gossypium raimondii
ref|XP_004503819.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       103   6e-32   Cicer arietinum [garbanzo]
ref|XP_010039000.1|  PREDICTED: carbonyl reductase [NADPH] 1            100   6e-32   Eucalyptus grandis [rose gum]
emb|CDY53157.1|  BnaCnng24570D                                          110   6e-32   Brassica napus [oilseed rape]
ref|XP_008356810.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       103   8e-32   Malus domestica [apple tree]
ref|XP_007153415.1|  hypothetical protein PHAVU_003G033300g             102   8e-32   Phaseolus vulgaris [French bean]
ref|XP_010314437.1|  PREDICTED: carbonyl reductase [NADPH] 1            101   9e-32   
ref|XP_003525167.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       102   1e-31   Glycine max [soybeans]
ref|XP_002864756.1|  short-chain dehydrogenase/reductase family p...    105   1e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_009339019.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       103   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_010483869.1|  PREDICTED: (+)-neomenthol dehydrogenase            105   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009604829.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       103   1e-31   Nicotiana tomentosiformis
gb|KHN16894.1|  (+)-neomenthol dehydrogenase                            102   1e-31   Glycine soja [wild soybean]
ref|XP_009766268.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       103   1e-31   Nicotiana sylvestris
ref|XP_009150117.1|  PREDICTED: carbonyl reductase [NADPH] 1            110   2e-31   Brassica rapa
ref|XP_010555587.1|  PREDICTED: carbonyl reductase [NADPH] 1 isof...    100   2e-31   
ref|XP_010482430.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       100   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_003526913.2|  PREDICTED: (+)-neomenthol dehydrogenase-like       101   2e-31   Glycine max [soybeans]
dbj|BAJ53119.1|  JHL07K02.9                                           98.2    2e-31   Jatropha curcas
ref|XP_011040290.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       103   2e-31   Populus euphratica
gb|KFK36748.1|  hypothetical protein AALP_AA4G164900                    100   2e-31   Arabis alpina [alpine rockcress]
ref|XP_004241656.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       100   2e-31   Solanum lycopersicum
emb|CDO98293.1|  unnamed protein product                                103   3e-31   Coffea canephora [robusta coffee]
ref|XP_008246053.1|  PREDICTED: (+)-neomenthol dehydrogenase-like       103   3e-31   Prunus mume [ume]
gb|AFJ66164.1|  hypothetical protein 11M19.8                          99.8    3e-31   Arabidopsis halleri
ref|XP_010099540.1|  (+)-neomenthol dehydrogenase                       104   3e-31   
gb|KHN09697.1|  (+)-neomenthol dehydrogenase                            101   4e-31   Glycine soja [wild soybean]
ref|XP_008392685.1|  PREDICTED: (+)-neomenthol dehydrogenase            101   4e-31   Malus domestica [apple tree]
ref|XP_008464357.1|  PREDICTED: LOW QUALITY PROTEIN: carbonyl red...    105   4e-31   Cucumis melo [Oriental melon]
ref|XP_004138015.1|  PREDICTED: short-chain dehydrogenase/reducta...    105   4e-31   Cucumis sativus [cucumbers]
emb|CDY45793.1|  BnaC03g16160D                                        97.8    5e-31   Brassica napus [oilseed rape]
ref|XP_009132676.1|  PREDICTED: (+)-neomenthol dehydrogenase          97.8    5e-31   Brassica rapa
gb|KDP22525.1|  hypothetical protein JCGZ_26356                       96.7    6e-31   Jatropha curcas
ref|XP_009373662.1|  PREDICTED: carbonyl reductase [NADPH] 1            100   6e-31   Pyrus x bretschneideri [bai li]
ref|XP_003602735.1|  Carbonyl reductase-like protein                    100   6e-31   Medicago truncatula
ref|XP_006366284.1|  PREDICTED: carbonyl reductase [NADPH] 1-like       101   6e-31   Solanum tuberosum [potatoes]
ref|XP_006280830.1|  hypothetical protein CARUB_v10026806mg             105   7e-31   Capsella rubella
gb|EPS72810.1|  hypothetical protein M569_01947                         106   7e-31   Genlisea aurea
dbj|BAB10083.1|  carbonyl reductase-like protein                        102   7e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279834.1|  hypothetical protein CARUB_v10028182mg           98.6    8e-31   Capsella rubella
ref|XP_010442583.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     98.6    8e-31   Camelina sativa [gold-of-pleasure]
ref|XP_003589619.1|  Carbonyl reductase                               99.8    8e-31   Medicago truncatula
gb|EYU21766.1|  hypothetical protein MIMGU_mgv1a010388mg                100   1e-30   Erythranthe guttata [common monkey flower]
ref|XP_004503038.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     99.0    1e-30   Cicer arietinum [garbanzo]
ref|XP_007209374.1|  hypothetical protein PRUPE_ppa008867mg             101   1e-30   Prunus persica
ref|XP_003523181.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     99.8    1e-30   Glycine max [soybeans]
ref|XP_002277858.1|  PREDICTED: carbonyl reductase [NADPH] 1            101   1e-30   Vitis vinifera
gb|KHG13984.1|  Carbonyl reductase [NADPH] 1                          97.8    1e-30   Gossypium arboreum [tree cotton]
gb|KHG13985.1|  Carbonyl reductase [NADPH] 1                          97.8    1e-30   Gossypium arboreum [tree cotton]
gb|KHN31241.1|  (+)-neomenthol dehydrogenase                            100   2e-30   Glycine soja [wild soybean]
gb|KJB40075.1|  hypothetical protein B456_007G045400                  96.7    2e-30   Gossypium raimondii
ref|NP_199916.1|  Rossmann-fold NAD(P)-binding domain-containing ...  96.7    2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865838.1|  short-chain dehydrogenase/reductase family p...  96.3    3e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_008810480.1|  PREDICTED: carbonyl reductase [NADPH] 1 isof...    100   3e-30   Phoenix dactylifera
ref|XP_009771378.1|  PREDICTED: carbonyl reductase [NADPH] 1 isof...    100   4e-30   Nicotiana sylvestris
ref|XP_009596907.1|  PREDICTED: carbonyl reductase [NADPH] 1-like...  99.8    7e-30   Nicotiana tomentosiformis
ref|XP_006341464.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     95.5    9e-30   Solanum tuberosum [potatoes]
ref|XP_010265011.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     99.0    1e-29   Nelumbo nucifera [Indian lotus]
gb|ACU23671.1|  unknown                                               95.1    1e-29   Glycine max [soybeans]
ref|XP_009596908.1|  PREDICTED: carbonyl reductase [NADPH] 1-like...  99.4    1e-29   Nicotiana tomentosiformis
ref|XP_006844645.1|  hypothetical protein AMTR_s00016p00233930        98.6    1e-29   Amborella trichopoda
ref|XP_004235853.1|  PREDICTED: carbonyl reductase [NADPH] 3-like     95.1    2e-29   Solanum lycopersicum
ref|XP_003533937.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     95.1    2e-29   Glycine max [soybeans]
gb|EYU24543.1|  hypothetical protein MIMGU_mgv1a010391mg              99.0    4e-29   Erythranthe guttata [common monkey flower]
ref|XP_010908903.1|  PREDICTED: carbonyl reductase [NADPH] 1-like     97.1    4e-29   Elaeis guineensis
ref|XP_004498298.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  94.4    7e-29   Cicer arietinum [garbanzo]
ref|XP_009396770.1|  PREDICTED: carbonyl reductase [NADPH] 1-like     97.1    9e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006436983.1|  hypothetical protein CICLE_v10032162mg           90.9    2e-28   Citrus clementina [clementine]
gb|ADN33869.1|  short-chain dehydrogenase/reductase family protein    94.7    6e-28   Cucumis melo subsp. melo
gb|AFJ66224.1|  hypothetical protein 34G24.29                         86.3    3e-27   Capsella rubella
gb|KEH20958.1|  short-chain dehydrogenase-reductase                   87.4    4e-27   Medicago truncatula
ref|XP_004171147.1|  PREDICTED: salutaridine reductase-like           94.7    5e-27   
ref|XP_008810479.1|  PREDICTED: carbonyl reductase [NADPH] 1 isof...  86.7    3e-26   Phoenix dactylifera
ref|XP_010695750.1|  PREDICTED: carbonyl reductase [NADPH] 1-like...    111   4e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|AFJ66193.1|  hypothetical protein 7G9.11                           81.6    6e-26   Boechera stricta
ref|XP_002980435.1|  hypothetical protein SELMODRAFT_112611           83.2    8e-26   
ref|NP_001136617.1|  uncharacterized protein LOC100216741             95.9    1e-25   Zea mays [maize]
ref|XP_002983044.1|  hypothetical protein SELMODRAFT_117556           76.3    5e-25   
ref|XP_002965558.1|  hypothetical protein SELMODRAFT_83967            77.0    6e-25   
gb|EAZ14715.1|  hypothetical protein OsJ_04640                        94.4    7e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001764466.1|  predicted protein                                84.0    9e-25   
ref|XP_002980432.1|  hypothetical protein SELMODRAFT_419963           81.3    1e-24   
ref|XP_004971162.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     90.5    2e-24   Setaria italica
ref|XP_002459028.1|  hypothetical protein SORBIDRAFT_03g044750        90.9    2e-24   Sorghum bicolor [broomcorn]
gb|EAY77081.1|  hypothetical protein OsI_05042                        92.4    4e-24   Oryza sativa Indica Group [Indian rice]
gb|ADE77110.1|  unknown                                               75.5    5e-24   Picea sitchensis
gb|EMS48166.1|  (+)-neomenthol dehydrogenase                            103   9e-24   Triticum urartu
ref|XP_002961336.1|  hypothetical protein SELMODRAFT_270248           86.7    2e-23   Selaginella moellendorffii
ref|XP_002963056.1|  hypothetical protein SELMODRAFT_78745            76.6    3e-23   
ref|NP_001045283.1|  Os01g0929500                                     94.4    3e-23   
gb|EMT26587.1|  hypothetical protein F775_43997                         102   3e-23   
ref|XP_002983227.1|  hypothetical protein SELMODRAFT_271617           85.9    4e-23   Selaginella moellendorffii
gb|EMS52254.1|  (+)-neomenthol dehydrogenase                            102   5e-23   Triticum urartu
ref|XP_002977743.1|  hypothetical protein SELMODRAFT_107407           77.8    8e-23   
ref|XP_002979536.1|  hypothetical protein SELMODRAFT_110901           77.8    9e-23   
ref|XP_009771379.1|  PREDICTED: carbonyl reductase [NADPH] 1 isof...    100   1e-22   Nicotiana sylvestris
ref|XP_002980278.1|  hypothetical protein SELMODRAFT_112669           75.5    1e-22   
ref|XP_010555589.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...    101   2e-22   
ref|XP_001766843.1|  predicted protein                                74.7    3e-22   
gb|EAZ31223.1|  hypothetical protein OsJ_15322                        99.8    4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008661479.1|  PREDICTED: hypothetical protein isoform X1         100   5e-22   
ref|XP_008661480.1|  PREDICTED: hypothetical protein isoform X2         100   5e-22   Zea mays [maize]
ref|XP_002979924.1|  hypothetical protein SELMODRAFT_111807           75.1    6e-22   
ref|XP_007139902.1|  hypothetical protein PHAVU_008G068200g           83.6    1e-21   Phaseolus vulgaris [French bean]
gb|ABK26346.1|  unknown                                               69.7    1e-21   Picea sitchensis
ref|XP_002987405.1|  hypothetical protein SELMODRAFT_126117           72.4    4e-21   
ref|XP_002962657.1|  hypothetical protein SELMODRAFT_78232            83.6    5e-21   
ref|XP_002994618.1|  hypothetical protein SELMODRAFT_138880           71.6    6e-21   
ref|XP_011091821.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     70.9    6e-21   Sesamum indicum [beniseed]
ref|XP_010025877.1|  PREDICTED: (+)-neomenthol dehydrogenase          95.9    2e-20   Eucalyptus grandis [rose gum]
ref|XP_002973095.1|  hypothetical protein SELMODRAFT_173170           71.6    2e-20   Selaginella moellendorffii
ref|XP_006829842.1|  hypothetical protein AMTR_s00119p00110100        80.1    2e-20   
ref|XP_002976772.1|  hypothetical protein SELMODRAFT_443296           71.6    2e-20   Selaginella moellendorffii
gb|KHM99404.1|  (+)-neomenthol dehydrogenase                          77.8    3e-20   Glycine soja [wild soybean]
ref|XP_009400596.1|  PREDICTED: uncharacterized protein LOC103984761  81.6    5e-20   
gb|KHN29382.1|  (+)-neomenthol dehydrogenase                          75.9    7e-20   Glycine soja [wild soybean]
ref|XP_003564994.1|  PREDICTED: carbonyl reductase [NADPH] 1          89.4    9e-20   
ref|XP_006588341.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     75.5    1e-19   Glycine max [soybeans]
ref|XP_004510823.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     74.3    1e-19   Cicer arietinum [garbanzo]
gb|KEH18925.1|  NAD(P)-binding rossmann-fold protein                  71.6    1e-19   Medicago truncatula
ref|XP_010685513.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     72.0    1e-19   
ref|XP_009338796.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     71.2    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_005707751.1|  carbonyl reductase (NADPH)                       76.6    2e-19   Galdieria sulphuraria
gb|KEH18924.1|  NAD(P)-binding rossmann-fold protein                  71.6    2e-19   Medicago truncatula
ref|XP_004510835.1|  PREDICTED: uncharacterized protein LOC101496709  73.2    2e-19   
ref|XP_003608084.1|  (+)-neomenthol dehydrogenase                     93.2    2e-19   
ref|XP_002966142.1|  hypothetical protein SELMODRAFT_143767           65.1    2e-19   Selaginella moellendorffii
ref|XP_009343607.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     70.9    2e-19   
ref|XP_009343598.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     70.9    2e-19   
ref|XP_006652563.1|  PREDICTED: salutaridine reductase-like           78.6    2e-19   
ref|XP_003600307.1|  (+)-neomenthol dehydrogenase                     70.5    2e-19   
ref|XP_002320110.2|  hypothetical protein POPTR_0014s07580g           80.5    3e-19   
ref|XP_003601313.1|  Short-chain dehydrogenase/reductase              74.3    3e-19   
ref|XP_007139903.1|  hypothetical protein PHAVU_008G068300g           74.3    3e-19   Phaseolus vulgaris [French bean]
gb|KEH18922.1|  NAD(P)-binding rossmann-fold protein                  71.2    3e-19   Medicago truncatula
ref|XP_004298764.1|  PREDICTED: short-chain dehydrogenase/reducta...  77.8    3e-19   Fragaria vesca subsp. vesca
gb|ACJ84741.1|  unknown                                               70.5    4e-19   Medicago truncatula
gb|KEH18926.1|  NAD(P)-binding rossmann-fold protein                  71.6    4e-19   Medicago truncatula
ref|XP_008374039.1|  PREDICTED: salutaridine reductase-like           77.4    5e-19   
gb|KEH24287.1|  short chain dehydrogenase                             74.3    5e-19   Medicago truncatula
ref|NP_001053401.1|  Os04g0531900                                     75.9    6e-19   
ref|XP_002521626.1|  carbonyl reductase, putative                     71.6    6e-19   Ricinus communis
gb|KDP28664.1|  hypothetical protein JCGZ_14435                       74.3    6e-19   Jatropha curcas
gb|KDP28662.1|  hypothetical protein JCGZ_14433                       75.5    7e-19   Jatropha curcas
ref|XP_009358608.1|  PREDICTED: salutaridine reductase-like isofo...  77.0    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_009358607.1|  PREDICTED: salutaridine reductase-like           77.4    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_008374041.1|  PREDICTED: salutaridine reductase-like           77.0    8e-19   
ref|XP_009348824.1|  PREDICTED: salutaridine reductase-like           77.0    8e-19   Pyrus x bretschneideri [bai li]
ref|XP_009369038.1|  PREDICTED: salutaridine reductase-like           76.6    9e-19   Pyrus x bretschneideri [bai li]
gb|KHN04648.1|  (+)-neomenthol dehydrogenase                          68.9    1e-18   Glycine soja [wild soybean]
ref|XP_009358609.1|  PREDICTED: salutaridine reductase-like isofo...  76.6    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_004167944.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     89.7    1e-18   
ref|XP_009358725.1|  PREDICTED: salutaridine reductase-like           76.6    1e-18   Pyrus x bretschneideri [bai li]
gb|AJO70763.1|  alcohol dehydrogenase 1                               70.5    1e-18   Catharanthus roseus [chatas]
ref|XP_007135024.1|  hypothetical protein PHAVU_010G095500g           71.2    1e-18   Phaseolus vulgaris [French bean]
ref|WP_017426928.1|  MULTISPECIES: short-chain dehydrogenase          69.3    1e-18   Paenibacillus
gb|AFK37109.1|  unknown                                               69.7    1e-18   Lotus japonicus
ref|WP_016820924.1|  short-chain dehydrogenase                        69.7    2e-18   Paenibacillus polymyxa
ref|XP_010910358.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     77.4    2e-18   Elaeis guineensis
ref|XP_008451083.1|  PREDICTED: short-chain dehydrogenase/reducta...  70.1    2e-18   Cucumis melo [Oriental melon]
ref|XP_002880558.1|  short-chain dehydrogenase/reductase family p...  75.1    2e-18   
ref|XP_011094700.1|  PREDICTED: uncharacterized protein LOC105174332  71.6    2e-18   
gb|AGT17182.1|  hypothetical protein SHCRBa_069_M12_R_80              75.5    2e-18   Saccharum hybrid cultivar R570
ref|XP_006582932.1|  PREDICTED: uncharacterized protein LOC100803...  67.4    3e-18   
ref|XP_009369037.1|  PREDICTED: salutaridine reductase-like           75.1    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_011080504.1|  PREDICTED: short-chain dehydrogenase/reducta...  72.8    3e-18   Sesamum indicum [beniseed]
ref|XP_002446845.1|  hypothetical protein SORBIDRAFT_06g023560        74.7    4e-18   
ref|XP_003600309.1|  (+)-neomenthol dehydrogenase                     68.9    4e-18   
ref|XP_010098430.1|  (+)-neomenthol dehydrogenase                     69.3    4e-18   
emb|CDX89104.1|  BnaA04g00820D                                        72.0    4e-18   
ref|XP_002982149.1|  hypothetical protein SELMODRAFT_271526           65.5    5e-18   Selaginella moellendorffii
ref|XP_011035784.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     77.8    5e-18   Populus euphratica
ref|XP_002461236.1|  hypothetical protein SORBIDRAFT_02g043370        73.2    5e-18   Sorghum bicolor [broomcorn]
ref|XP_009138784.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  72.0    5e-18   
gb|KEH18923.1|  NAD(P)-binding rossmann-fold protein                  68.9    5e-18   
ref|XP_001763576.1|  predicted protein                                63.9    5e-18   
gb|ACN87274.1|  short chain dehydrogenase/reductase                   73.9    5e-18   
ref|XP_004144091.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     68.9    5e-18   
ref|XP_006583331.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  70.9    5e-18   
ref|XP_011080505.1|  PREDICTED: short-chain dehydrogenase/reducta...  71.6    5e-18   
ref|XP_008232780.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     69.7    6e-18   
ref|XP_006583334.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  69.3    6e-18   
ref|XP_006583333.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  68.9    6e-18   
ref|XP_007221117.1|  hypothetical protein PRUPE_ppa018152mg           69.3    6e-18   
ref|XP_009138783.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  71.6    6e-18   
ref|XP_006646642.1|  PREDICTED: carbonyl reductase [NADPH] 3-like     89.0    7e-18   
ref|XP_007051877.1|  NAD(P)-binding Rossmann-fold superfamily pro...  69.7    7e-18   
ref|XP_004295129.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     72.4    7e-18   
gb|KGN66402.1|  hypothetical protein Csa_1G600920                     68.2    7e-18   
ref|XP_006384070.1|  short-chain dehydrogenase/reductase family p...  60.8    7e-18   
gb|KHN04649.1|  (+)-neomenthol dehydrogenase                          70.1    8e-18   
ref|XP_006418460.1|  hypothetical protein EUTSA_v10008335mg           66.6    8e-18   
ref|XP_003614999.1|  (+)-neomenthol dehydrogenase                     70.1    8e-18   
ref|WP_031463560.1|  short-chain dehydrogenase                        69.7    9e-18   
ref|XP_004510824.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     72.4    9e-18   
ref|NP_001077951.1|  Short-chain dehydrogenase/reductase 2            72.8    9e-18   
ref|XP_006402505.1|  hypothetical protein EUTSA_v10006127mg           77.4    9e-18   
ref|XP_003627604.1|  Carbonyl reductase                               66.2    9e-18   
ref|NP_179996.1|  Short-chain dehydrogenase/reductase 2               72.8    1e-17   
gb|KDP42906.1|  hypothetical protein JCGZ_23848                       69.3    1e-17   
ref|NP_001242019.1|  uncharacterized protein LOC100803877             65.5    1e-17   
ref|XP_009377415.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  68.9    1e-17   
ref|XP_008343394.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     68.2    1e-17   
ref|XP_008337474.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  68.6    1e-17   
ref|XP_010251641.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  70.5    1e-17   
ref|XP_010251642.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  70.9    1e-17   
ref|XP_010251640.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  70.5    1e-17   
ref|XP_007135017.1|  hypothetical protein PHAVU_010G094900g           68.2    1e-17   
ref|XP_010041389.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     70.9    1e-17   
ref|XP_004976335.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     73.2    1e-17   
ref|WP_025364891.1|  short-chain dehydrogenase                        69.3    1e-17   
ref|XP_010093838.1|  Short-chain dehydrogenase/reductase 2            71.6    1e-17   
ref|XP_009377413.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  68.6    1e-17   
ref|XP_008337412.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  68.2    1e-17   
gb|EMT12915.1|  (+)-neomenthol dehydrogenase                          73.2    2e-17   
gb|KCW44386.1|  hypothetical protein EUGRSUZ_L02135                   70.5    2e-17   
ref|XP_002267820.2|  PREDICTED: uncharacterized protein LOC100243097  73.2    2e-17   
ref|WP_010344974.1|  short-chain dehydrogenase                        67.4    2e-17   
ref|XP_008778203.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     71.6    2e-17   
gb|KDP28661.1|  hypothetical protein JCGZ_14432                       69.3    2e-17   
ref|WP_007432056.1|  short-chain dehydrogenase                        67.0    2e-17   
ref|XP_009119740.1|  PREDICTED: (+)-neomenthol dehydrogenase isof...  66.2    2e-17   
ref|XP_002511824.1|  carbonyl reductase, putative                     70.1    2e-17   
emb|CDX90062.1|  BnaA10g00200D                                        66.2    2e-17   
ref|XP_010053299.1|  PREDICTED: salutaridine reductase-like           69.7    2e-17   
ref|XP_006583329.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     68.6    2e-17   
ref|XP_002446846.1|  hypothetical protein SORBIDRAFT_06g023570        71.2    2e-17   
ref|XP_002892041.1|  short-chain dehydrogenase/reductase family p...  68.6    2e-17   
ref|XP_006340278.1|  PREDICTED: short-chain dehydrogenase/reducta...  67.0    3e-17   
ref|XP_010053672.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  69.7    3e-17   
ref|XP_008232781.1|  PREDICTED: short-chain dehydrogenase/reducta...  66.6    3e-17   
ref|XP_007224111.1|  hypothetical protein PRUPE_ppa015667mg           68.2    3e-17   
ref|XP_009420957.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     71.6    3e-17   
ref|XP_010544713.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     72.8    3e-17   
ref|NP_191681.1|  (+)-neomenthol dehydrogenase                        71.2    3e-17   
ref|NP_001146814.1|  uncharacterized protein LOC100280419             75.5    3e-17   
ref|XP_008667878.1|  PREDICTED: uncharacterized protein LOC100280...  76.3    3e-17   
ref|XP_009347861.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     69.3    4e-17   
ref|XP_009620596.1|  PREDICTED: short-chain dehydrogenase/reducta...  65.9    4e-17   
ref|XP_008238881.1|  PREDICTED: salutaridine reductase-like           72.8    4e-17   
ref|XP_007209393.1|  hypothetical protein PRUPE_ppa009165mg           72.8    4e-17   
ref|XP_003600308.1|  (+)-neomenthol dehydrogenase                     69.3    4e-17   
emb|CDY56927.1|  BnaAnng14460D                                        70.1    4e-17   
gb|KCW78028.1|  hypothetical protein EUGRSUZ_D02253                   69.7    4e-17   
ref|XP_011469050.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     67.4    4e-17   
gb|KHN04645.1|  (+)-neomenthol dehydrogenase                          67.8    4e-17   
ref|XP_006340272.1|  PREDICTED: short-chain dehydrogenase/reducta...  65.5    4e-17   
ref|XP_010053670.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     69.3    4e-17   
ref|XP_009350263.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     68.9    4e-17   
gb|EMT05793.1|  Short-chain dehydrogenase/reductase 2                 72.8    4e-17   
ref|XP_003600312.1|  (+)-neomenthol dehydrogenase                     65.9    4e-17   
ref|XP_009620597.1|  PREDICTED: short-chain dehydrogenase/reducta...  65.9    4e-17   
ref|XP_002301348.1|  short-chain dehydrogenase/reductase family p...  69.3    4e-17   
ref|XP_008337634.1|  PREDICTED: uncharacterized protein LOC103400719  67.0    5e-17   
ref|NP_001190151.1|  (+)-neomenthol dehydrogenase                     70.9    5e-17   
ref|XP_004958738.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  73.9    5e-17   
emb|CDY15148.1|  BnaC05g00270D                                        66.2    5e-17   
ref|NP_563635.1|  Rossmann-fold NAD(P)-binding domain-containing ...  65.5    5e-17   
ref|XP_007139905.1|  hypothetical protein PHAVU_008G068500g           67.0    5e-17   
tpg|DAA36697.1|  TPA: hypothetical protein ZEAMMB73_569025            74.7    5e-17   
ref|XP_010473147.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     62.4    5e-17   
gb|AAF78417.1|AC009273_23  Contains similarity to a retinal short...  65.5    6e-17   
gb|AGT17181.1|  hypothetical protein SHCRBa_069_M12_R_60              71.2    6e-17   
ref|XP_003627589.1|  Carbonyl reductase                               68.6    6e-17   
ref|XP_010661735.1|  PREDICTED: (+)-neomenthol dehydrogenase          70.1    7e-17   
ref|XP_008375920.1|  PREDICTED: (+)-neomenthol dehydrogenase          64.7    7e-17   
ref|XP_006387687.1|  hypothetical protein POPTR_0675s00200g           69.3    7e-17   
emb|CDP11266.1|  unnamed protein product                              65.1    7e-17   
ref|XP_004958735.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     72.4    8e-17   
ref|XP_006387460.1|  hypothetical protein POPTR_1018s00210g           69.3    8e-17   
ref|XP_008338485.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     65.5    8e-17   
tpg|DAA36698.1|  TPA: hypothetical protein ZEAMMB73_569025            75.1    8e-17   
ref|XP_007218748.1|  hypothetical protein PRUPE_ppa009292mg           68.2    9e-17   
ref|XP_010313462.1|  PREDICTED: short-chain dehydrogenase/reducta...  64.7    9e-17   
ref|XP_004976338.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     68.6    9e-17   
ref|XP_006294712.1|  hypothetical protein CARUB_v10023750mg           70.9    9e-17   
ref|XP_007212966.1|  hypothetical protein PRUPE_ppa021111mg           64.3    9e-17   
gb|ACN87275.1|  short chain dehydrogenase/reductase                   74.3    9e-17   
ref|XP_010313459.1|  PREDICTED: short-chain dehydrogenase/reducta...  64.7    1e-16   
gb|KEH23345.1|  NAD(P)-binding rossmann-fold protein                  66.2    1e-16   
ref|XP_008353983.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     65.1    1e-16   
ref|XP_008337732.1|  PREDICTED: short-chain dehydrogenase/reducta...  65.1    1e-16   
ref|XP_002454578.1|  hypothetical protein SORBIDRAFT_04g033750        65.1    1e-16   
ref|XP_004958737.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  72.4    1e-16   
gb|EYU46137.1|  hypothetical protein MIMGU_mgv1a009586mg              68.6    1e-16   
ref|XP_010054778.1|  PREDICTED: LOW QUALITY PROTEIN: salutaridine...  67.8    1e-16   
ref|XP_004167181.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     72.8    1e-16   
ref|XP_011016633.1|  PREDICTED: carbonyl reductase [NADPH] 1-like     72.0    1e-16   
ref|XP_006385156.1|  hypothetical protein POPTR_0004s24370g           68.6    1e-16   
ref|XP_007135015.1|  hypothetical protein PHAVU_010G094800g           66.2    1e-16   
ref|XP_010053680.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     68.2    1e-16   
ref|XP_006491048.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     67.8    1e-16   
ref|XP_011094713.1|  PREDICTED: uncharacterized protein LOC105174340  67.4    1e-16   
gb|EYU32079.1|  hypothetical protein MIMGU_mgv1a010703mg              65.5    1e-16   
ref|NP_001174025.1|  Os04g0531750                                     67.4    1e-16   
ref|XP_009803547.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     71.2    1e-16   
gb|KCW78042.1|  hypothetical protein EUGRSUZ_D02266                   68.2    1e-16   
gb|KHN29385.1|  (+)-neomenthol dehydrogenase                          66.6    1e-16   
ref|XP_010671895.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     68.9    1e-16   
ref|XP_010544712.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     67.8    1e-16   
ref|XP_007218749.1|  hypothetical protein PRUPE_ppa009309mg           67.0    2e-16   
gb|ACU16111.1|  unknown                                               66.2    2e-16   
ref|XP_007221124.1|  hypothetical protein PRUPE_ppa018330mg           67.0    2e-16   
ref|XP_004958736.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  72.0    2e-16   
ref|XP_002454577.1|  hypothetical protein SORBIDRAFT_04g033740        64.7    2e-16   
ref|XP_006576352.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  65.9    2e-16   
ref|XP_011028494.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  68.2    2e-16   
ref|NP_001276230.1|  (+)-neomenthol dehydrogenase-like                65.9    2e-16   
ref|XP_010238633.1|  PREDICTED: short-chain dehydrogenase/reducta...  66.6    2e-16   
gb|KDP28663.1|  hypothetical protein JCGZ_14434                       69.7    2e-16   
ref|XP_009620590.1|  PREDICTED: short-chain dehydrogenase/reducta...  63.5    2e-16   
ref|XP_010053301.1|  PREDICTED: salutaridine reductase-like           66.6    2e-16   
ref|XP_003623884.1|  (+)-neomenthol dehydrogenase                     67.4    2e-16   
emb|CBI40299.3|  unnamed protein product                              72.0    2e-16   
ref|XP_002876599.1|  short-chain dehydrogenase/reductase family p...  67.8    2e-16   
ref|XP_003623885.1|  (+)-neomenthol dehydrogenase                     67.0    2e-16   
emb|CDP19124.1|  unnamed protein product                              67.8    2e-16   
ref|XP_003627593.1|  (+)-neomenthol dehydrogenase                     66.2    3e-16   
ref|XP_004976333.1|  PREDICTED: salutaridine reductase-like           68.6    3e-16   
ref|XP_008355449.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     67.8    3e-16   
ref|XP_010429384.1|  PREDICTED: short-chain dehydrogenase/reducta...  71.2    3e-16   
ref|XP_006658151.1|  PREDICTED: short-chain dehydrogenase/reducta...  69.3    3e-16   
ref|XP_004975343.1|  PREDICTED: salutaridine reductase-like           67.4    3e-16   
ref|XP_009799308.1|  PREDICTED: short-chain dehydrogenase/reducta...  62.8    3e-16   
ref|XP_008790460.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  68.6    3e-16   
ref|XP_008232812.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     68.6    3e-16   
ref|XP_010238632.1|  PREDICTED: short-chain dehydrogenase/reducta...  66.6    3e-16   
ref|XP_008790461.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  68.6    3e-16   
ref|XP_006340274.1|  PREDICTED: short-chain dehydrogenase/reducta...  64.7    3e-16   
ref|XP_002267348.2|  PREDICTED: (+)-neomenthol dehydrogenase          68.9    3e-16   
gb|EEE67842.1|  hypothetical protein OsJ_25630                        70.9    3e-16   
emb|CBI40298.3|  unnamed protein product                              68.6    4e-16   
ref|XP_010661732.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  70.5    4e-16   
ref|XP_004976336.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     64.7    4e-16   
emb|CBI40296.3|  unnamed protein product                              70.5    4e-16   
ref|XP_010523034.1|  PREDICTED: (+)-neomenthol dehydrogenase          67.8    4e-16   
ref|XP_010661731.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  70.5    4e-16   
gb|EEC82711.1|  hypothetical protein OsI_27383                        69.3    4e-16   
ref|XP_010429382.1|  PREDICTED: short-chain dehydrogenase/reducta...  71.2    4e-16   
ref|XP_002446843.1|  hypothetical protein SORBIDRAFT_06g023540        68.9    4e-16   
emb|CAE03869.2|  OSJNBa0081C01.19                                     66.2    4e-16   
ref|XP_008343393.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     65.1    4e-16   
gb|ACZ34296.1|  broad substrate reductase/dehydrogenase               70.1    4e-16   
ref|XP_007051884.1|  NAD(P)-binding Rossmann-fold superfamily pro...  68.6    4e-16   
ref|XP_003600313.1|  (+)-neomenthol dehydrogenase                     65.9    4e-16   
gb|ACL53476.1|  unknown                                               72.4    4e-16   
ref|XP_011035794.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     73.2    4e-16   
gb|EEC77693.1|  hypothetical protein OsI_16756                        67.0    4e-16   
emb|CDP08863.1|  unnamed protein product                              63.2    4e-16   
gb|AET02077.2|  NAD(P)-binding rossmann-fold protein                  64.3    4e-16   
ref|XP_003608085.1|  Retinol dehydrogenase                            81.3    5e-16   
ref|XP_003521915.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     66.2    5e-16   
dbj|BAG89111.1|  unnamed protein product                              69.3    5e-16   
ref|NP_001060679.1|  Os07g0685800                                     68.9    5e-16   
ref|XP_003600294.1|  Ribulose bisphosphate carboxylase small chain    65.5    5e-16   
gb|EYU32077.1|  hypothetical protein MIMGU_mgv1a010747mg              63.9    5e-16   
ref|XP_010053669.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     65.1    6e-16   
ref|XP_002446847.1|  hypothetical protein SORBIDRAFT_06g023580        67.0    6e-16   
gb|AES80102.2|  NAD(P)-binding rossmann-fold protein                  66.2    6e-16   
dbj|BAD25370.1|  short-chain dehydrogenase/reductase protein-like     64.7    6e-16   
ref|XP_011028496.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  66.2    6e-16   
ref|XP_006445105.1|  hypothetical protein CICLE_v10023951mg           65.9    6e-16   
ref|XP_010661730.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  70.5    6e-16   
gb|KEH23344.1|  NAD(P)-binding rossmann-fold protein                  66.2    6e-16   
ref|XP_010918531.1|  PREDICTED: salutaridine reductase-like           68.6    6e-16   
ref|XP_003627601.1|  (+)-neomenthol dehydrogenase                     63.5    6e-16   
ref|XP_008232813.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     61.6    6e-16   
ref|XP_010943682.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     67.4    7e-16   
ref|XP_004978151.1|  PREDICTED: uncharacterized protein LOC101786803  67.0    7e-16   
emb|CDP01393.1|  unnamed protein product                              64.3    7e-16   
ref|XP_004513824.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     63.2    7e-16   
ref|XP_004976339.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     67.4    7e-16   
ref|XP_007218752.1|  hypothetical protein PRUPE_ppa009330mg           60.8    7e-16   
gb|KDO86072.1|  hypothetical protein CISIN_1g039097mg                 68.2    7e-16   
gb|KHN27306.1|  (+)-neomenthol dehydrogenase                          65.5    7e-16   
gb|KDO86071.1|  hypothetical protein CISIN_1g035504mg                 65.5    7e-16   
gb|EAY86850.1|  hypothetical protein OsI_08234                        64.7    7e-16   
ref|XP_008227552.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     64.7    7e-16   
ref|XP_010053673.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  64.7    7e-16   
ref|XP_006339532.1|  PREDICTED: short-chain dehydrogenase/reducta...  68.9    8e-16   
ref|XP_008353985.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  62.8    8e-16   
gb|KHG17192.1|  (+)-neomenthol dehydrogenase -like protein            65.5    8e-16   
ref|XP_006445104.1|  hypothetical protein CICLE_v10023386mg           68.2    8e-16   
ref|XP_007205614.1|  hypothetical protein PRUPE_ppa009101mg           69.3    8e-16   
gb|KHM99407.1|  (+)-neomenthol dehydrogenase                          67.8    8e-16   
ref|XP_006491047.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     68.2    9e-16   
ref|XP_010661729.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  69.7    9e-16   
ref|XP_010240175.1|  PREDICTED: LOW QUALITY PROTEIN: salutaridine...  65.5    9e-16   
gb|KIZ01219.1|  Carbonyl reductase [NADPH] 1                          55.5    9e-16   
ref|XP_008353984.1|  PREDICTED: (+)-neomenthol dehydrogenase-like...  62.4    1e-15   
gb|ACG31770.1|  carbonyl reductase 3                                  67.4    1e-15   
gb|KHN27304.1|  (+)-neomenthol dehydrogenase                          67.0    1e-15   
ref|XP_010918528.1|  PREDICTED: salutaridine reductase-like           66.2    1e-15   
ref|XP_003528868.1|  PREDICTED: (+)-neomenthol dehydrogenase-like     66.6    1e-15   



>ref|XP_009613028.1| PREDICTED: (+)-neomenthol dehydrogenase [Nicotiana tomentosiformis]
Length=298

 Score =   148 bits (374),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            +++H+LDVSD  SI  FASWF   F+ LDILVNNAAVSFND+ +NSVEHAETVI+TN+YG
Sbjct  75   IYYHQLDVSDTSSIKTFASWFAKNFTGLDILVNNAAVSFNDIHENSVEHAETVISTNFYG  134

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PK L+  L PMFRCSS+ ARILN+SSRLG  +KL+N KLR
Sbjct  135  PKRLMEELWPMFRCSSTVARILNVSSRLGLLSKLRNDKLR  174


 Score = 81.6 bits (200),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 2/56 (4%)
 Frame = +2

Query  56   MASILSQYSSP--SLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            MAS  S+ SS   +L K+RWWS+ETVAIVTG+NKGIGFALVKR+AELGLTVVLTAR
Sbjct  1    MASRQSELSSSCSTLLKSRWWSKETVAIVTGSNKGIGFALVKRMAELGLTVVLTAR  56



>ref|XP_009770218.1| PREDICTED: (+)-neomenthol dehydrogenase [Nicotiana sylvestris]
Length=298

 Score =   147 bits (372),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            +++H+LDVSD  SI  FASWF   F+ LDILVNNAAVSFND+ +NSVEHAETVI+TN+YG
Sbjct  75   IYYHQLDVSDTSSIQTFASWFANNFTGLDILVNNAAVSFNDIHENSVEHAETVISTNFYG  134

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PK L+  L PMFRCSS+ ARILN+SSRLG  +KL+N KLR
Sbjct  135  PKRLMEELWPMFRCSSTVARILNVSSRLGLLSKLRNDKLR  174


 Score = 80.9 bits (198),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 2/56 (4%)
 Frame = +2

Query  56   MASILSQYSSP--SLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            MAS  S+ SS   +L K RWWS+ETVAIVTGANKGIGFA VKR+AELGLTVVLTAR
Sbjct  1    MASRQSELSSSCSTLLKARWWSKETVAIVTGANKGIGFAFVKRMAELGLTVVLTAR  56



>ref|XP_006342322.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Solanum tuberosum]
Length=299

 Score =   142 bits (358),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            +++H+LDVSD  SI  F SWF   F+ALDILVNNAAVSFND+++NSVEHAETVI TN+YG
Sbjct  76   LYYHQLDVSDISSIKQFTSWFTNNFTALDILVNNAAVSFNDIEENSVEHAETVICTNFYG  135

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PK LI  L P FRCSS+  RILNISSRLG  +KL+N +L+
Sbjct  136  PKRLIQQLWPTFRCSSTVTRILNISSRLGLLSKLRNEELK  175


 Score = 84.0 bits (206),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 45/51 (88%), Gaps = 2/51 (4%)
 Frame = +2

Query  71   SQYSSPS--LPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            SQ SS S  LPKTRWWS+ETVAIVTG NKGIGFA VKR+AELGLTV+LTAR
Sbjct  7    SQLSSSSFPLPKTRWWSKETVAIVTGGNKGIGFAFVKRMAELGLTVILTAR  57



>ref|XP_010650718.1| PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Vitis vinifera]
Length=292

 Score =   140 bits (352),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVS+  SI  FASWF+ +F  LDILVNNA VSFN++++NSVEHAE VI TNYYG
Sbjct  70   VHFSLLDVSNPDSIQTFASWFQHSFRKLDILVNNAGVSFNNINENSVEHAEVVIKTNYYG  129

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PK+LI ALLPMFR SSS +RILNISSRLG  NKL+NP ++
Sbjct  130  PKMLIEALLPMFRRSSSVSRILNISSRLGLLNKLKNPNIK  169


 Score = 84.0 bits (206),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  77   YSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            +SSP L  TRWWS++TVAIVTGANKGIGFALVKRLAE GLTV+LTAR     L+
Sbjct  5    FSSPCLSSTRWWSKDTVAIVTGANKGIGFALVKRLAESGLTVILTARDEARGLK  58



>ref|XP_004308961.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=307

 Score =   137 bits (346),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F+RLDVSD  SI  FASWF+  F+ALDILVNNAAVSFN++++NSVEHAETVI TN+ GPK
Sbjct  79   FYRLDVSDPCSINTFASWFKENFTALDILVNNAAVSFNEINENSVEHAETVIRTNFNGPK  138

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  ALLPMFR +SS +RILN+SSRLG  NK+ NP ++
Sbjct  139  LLTEALLPMFR-TSSMSRILNVSSRLGSLNKVGNPSIK  175


 Score = 82.4 bits (202),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 6/58 (10%)
 Frame = +2

Query  83   SPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ------EALR  238
            SPS   TRWWSEETVAIVTGANKGIGFA+VKR+AELGL V+LTAR ++      EALR
Sbjct  13   SPSHSSTRWWSEETVAIVTGANKGIGFAVVKRMAELGLKVILTARDSERGCKAVEALR  70



>ref|XP_011471010.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=320

 Score =   135 bits (341),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 81/98 (83%), Gaps = 1/98 (1%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F+RLDVSD  SI  FASWF+  F+ALDILVNNAAVSFN++++NSVEH ETVI TN+ GPK
Sbjct  79   FYRLDVSDPCSINTFASWFKENFTALDILVNNAAVSFNEINENSVEHTETVIRTNFNGPK  138

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  ALLPMFR +SS +RILN+SSRLG  NK+ NP ++
Sbjct  139  LLTEALLPMFR-TSSMSRILNVSSRLGSLNKVGNPNIK  175


 Score = 82.0 bits (201),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 6/58 (10%)
 Frame = +2

Query  83   SPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ------EALR  238
            SPS   TRWWSEETVAIVTGANKGIGFA+VKR+AELGL V+LTAR ++      EALR
Sbjct  13   SPSHSSTRWWSEETVAIVTGANKGIGFAVVKRMAELGLKVILTARDSERGCKAVEALR  70



>ref|XP_010930460.1| PREDICTED: (+)-neomenthol dehydrogenase, partial [Elaeis guineensis]
Length=275

 Score =   137 bits (345),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F RLDV D  SI  FASW +  F  LDILVNNA VSFN++D NSVEHAETVI TN+YGPK
Sbjct  75   FCRLDVGDSSSIIAFASWLQQRFGGLDILVNNAGVSFNEIDSNSVEHAETVIRTNFYGPK  134

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LLI ALLP+FR SS+ +RILNISS+LG  NK++NP L+
Sbjct  135  LLIEALLPLFRRSSARSRILNISSQLGLLNKVRNPALK  172


 Score = 80.1 bits (196),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  56   MASILSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            M ++  + S PS   T+WWS+ETVA+VTGANKGIGFALVKRLAELGLTVVLT+R
Sbjct  1    MLAMDCKVSMPSSSPTKWWSKETVAVVTGANKGIGFALVKRLAELGLTVVLTSR  54



>emb|CDP08000.1| unnamed protein product [Coffea canephora]
Length=286

 Score =   144 bits (362),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVSD  SI  FASWF+  F+A+DILVNNAAVSFND+ +NSVEHAETV+ TN+YG
Sbjct  63   VHFFCLDVSDPLSIKQFASWFKEKFAAVDILVNNAAVSFNDIHENSVEHAETVMRTNFYG  122

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLL  ALLPMFR S+S  RI+NISSRLG  NKL+NPKLR
Sbjct  123  PKLLTEALLPMFRSSASFGRIINISSRLGLLNKLKNPKLR  162


 Score = 73.6 bits (179),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 3/48 (6%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT---QEALR  238
            RWWS++TVAIVTGANKGIGFALVKRLAEL LTVVLTAR     QEA+ 
Sbjct  6    RWWSKDTVAIVTGANKGIGFALVKRLAELRLTVVLTARDNARGQEAVE  53



>ref|XP_010650717.1| PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Vitis vinifera]
Length=297

 Score =   140 bits (353),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVS+  SI  FASWF+ +F  LDILVNNA VSFN++++NSVEHAE VI TNYYG
Sbjct  75   VHFSLLDVSNPDSIQTFASWFQHSFRKLDILVNNAGVSFNNINENSVEHAEVVIKTNYYG  134

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PK+LI ALLPMFR SSS +RILNISSRLG  NKL+NP ++
Sbjct  135  PKMLIEALLPMFRRSSSVSRILNISSRLGLLNKLKNPNIK  174


 Score = 76.6 bits (187),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            TRWWS++TVAIVTGANKGIGFALVKRLAE GLTV+LTAR     L+
Sbjct  18   TRWWSKDTVAIVTGANKGIGFALVKRLAESGLTVILTARDEARGLK  63



>ref|XP_004234867.1| PREDICTED: (+)-neomenthol dehydrogenase [Solanum lycopersicum]
Length=297

 Score =   134 bits (337),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            +++H LDVSD  SI  F SWF   F+ALDILVNNAAVSF D+++NSVEHAETVI TN+YG
Sbjct  74   LYYHHLDVSDISSIQLFTSWFTNNFTALDILVNNAAVSFKDIEENSVEHAETVICTNFYG  133

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PK LI  L P FR SS+  RILNISSRLG  +KL+N +L+
Sbjct  134  PKRLIQQLYPTFRSSSTVTRILNISSRLGLLSKLRNEELK  173


 Score = 80.5 bits (197),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  89   SLPKT-RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            SLPKT RWWS+ETVAIVTG NKGIGFALVKR+AELGLTV+LTAR     + 
Sbjct  12   SLPKTSRWWSKETVAIVTGGNKGIGFALVKRMAELGLTVILTARDNARGME  62



>emb|CBI24696.3| unnamed protein product [Vitis vinifera]
Length=302

 Score =   139 bits (350),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVS+  SI  FASWF+ +F  LDILVNNA VSFN++++NSVEHAE VI TNYYG
Sbjct  70   VHFSLLDVSNPDSIQTFASWFQHSFRKLDILVNNAGVSFNNINENSVEHAEVVIKTNYYG  129

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNP  561
            PK+LI ALLPMFR SSS +RILNISSRLG  NKL+NP
Sbjct  130  PKMLIEALLPMFRRSSSVSRILNISSRLGLLNKLKNP  166


 Score = 72.8 bits (177),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            WWS++TVAIVTGANKGIGFALVKRLAE GLTV+LTAR     L+
Sbjct  15   WWSKDTVAIVTGANKGIGFALVKRLAESGLTVILTARDEARGLK  58



>ref|XP_006442161.1| hypothetical protein CICLE_v10021349mg [Citrus clementina]
 gb|ESR55401.1| hypothetical protein CICLE_v10021349mg [Citrus clementina]
Length=302

 Score =   132 bits (332),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F +LDVSD  SI  F SWF+  F+ALDILVNNA VSFND+ +N+VEHAETVI TN+YG K
Sbjct  83   FFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAK  142

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  +LLP+FR S S +RILNISSRLG  +K++NP ++
Sbjct  143  LLTESLLPLFRRSPSKSRILNISSRLGTLSKVRNPNIK  180


 Score = 79.0 bits (193),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            T+WWS+ET+AIVTGANKGIGFALVKRLAELGLTV+LTAR  +   R
Sbjct  24   TKWWSKETIAIVTGANKGIGFALVKRLAELGLTVILTARDVERGQR  69



>ref|XP_006492782.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Citrus sinensis]
Length=300

 Score =   132 bits (332),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F +LDVSD  SI  F SWF+  F+ALDILVNNA VSFND+ +N+VEHAETVI TN+YG K
Sbjct  81   FFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAK  140

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  +LLP+FR S S +RILNISSRLG  +K++NP ++
Sbjct  141  LLTESLLPLFRRSPSKSRILNISSRLGTLSKVRNPNIK  178


 Score = 79.0 bits (193),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            T+WWS+ET+AIVTGANKGIGFALVKRLAELGLTV+LTAR  +   R
Sbjct  22   TKWWSKETIAIVTGANKGIGFALVKRLAELGLTVILTARDVERGQR  67



>gb|KDO40655.1| hypothetical protein CISIN_1g022103mg [Citrus sinensis]
Length=302

 Score =   132 bits (331),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F +LDVSD  SI  F SWF+  F+ALDILVNNA VSFND+ +N+VEHAETVI TN+YG K
Sbjct  83   FFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAK  142

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  +LLP+FR S S +RILNISSRLG  +K++NP ++
Sbjct  143  LLTESLLPLFRRSPSKSRILNISSRLGTLSKVRNPNIK  180


 Score = 79.0 bits (193),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            T+WWS+ET+AIVTGANKGIGFALVKRLAELGLTV+LTAR  +   R
Sbjct  24   TKWWSKETIAIVTGANKGIGFALVKRLAELGLTVILTARDVERGQR  69



>ref|XP_006376448.1| hypothetical protein POPTR_0013s13140g [Populus trichocarpa]
 gb|ERP54245.1| hypothetical protein POPTR_0013s13140g [Populus trichocarpa]
Length=301

 Score =   138 bits (347),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F+RLDVSD  S+   ASWF+  F  LDIL+NNAAVSFND+ +NSV+HAE VI TN+YG
Sbjct  80   VHFYRLDVSDPASVKTLASWFQKKFGVLDILINNAAVSFNDIYENSVDHAEIVIKTNFYG  139

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLPMFR S S +RILNISSRLG  NK++NPK++
Sbjct  140  VKLLTEALLPMFRLSDSISRILNISSRLGSINKMRNPKMK  179


 Score = 73.2 bits (178),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
            TRWWS++TVA+VTGANKGIGF+LVK+LA+LGLTV+LTAR  ++ 
Sbjct  23   TRWWSKDTVAMVTGANKGIGFSLVKQLAQLGLTVILTARDVEKG  66



>ref|XP_010242706.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Nelumbo nucifera]
Length=293

 Score =   134 bits (337),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F +LD+SD  SI  F SW +  F  LDILVNNAAVSFN + +NSVEHAETVI TN+YG
Sbjct  71   VLFCQLDISDPASIDIFVSWLKEEFGGLDILVNNAAVSFNRIGENSVEHAETVIKTNFYG  130

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLL  ALLP+FR S+S +RILN+SSRLG  NK++NP++R
Sbjct  131  PKLLTEALLPLFRRSASISRILNVSSRLGLLNKVRNPQVR  170


 Score = 76.6 bits (187),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  89   SLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            SL  TRWWSE+T+A+VTGANKGIGFA+VK+LAELGLTV+LT+R
Sbjct  10   SLSSTRWWSEDTIAVVTGANKGIGFAIVKQLAELGLTVILTSR  52



>ref|XP_006442162.1| hypothetical protein CICLE_v10021349mg [Citrus clementina]
 gb|ESR55402.1| hypothetical protein CICLE_v10021349mg [Citrus clementina]
Length=282

 Score =   132 bits (332),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F +LDVSD  SI  F SWF+  F+ALDILVNNA VSFND+ +N+VEHAETVI TN+YG K
Sbjct  63   FFQLDVSDPSSIEAFVSWFKSNFAALDILVNNAGVSFNDIYKNTVEHAETVIRTNFYGAK  122

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  +LLP+FR S S +RILNISSRLG  +K++NP ++
Sbjct  123  LLTESLLPLFRRSPSKSRILNISSRLGTLSKVRNPNIK  160


 Score = 78.6 bits (192),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            RWWS+ET+AIVTGANKGIGFALVKRLAELGLTV+LTAR  +   R
Sbjct  5    RWWSKETIAIVTGANKGIGFALVKRLAELGLTVILTARDVERGQR  49



>ref|XP_002524868.1| carbonyl reductase, putative [Ricinus communis]
 gb|EEF37492.1| carbonyl reductase, putative [Ricinus communis]
Length=296

 Score =   136 bits (343),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F++LDVS+  SI  F+S F   F  LDILVNNAAVSFND+ +N+VEHAETVI TN+YG
Sbjct  74   VHFYQLDVSNPSSIKAFSSQFEKEFGVLDILVNNAAVSFNDIHENTVEHAETVIKTNFYG  133

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLLI +L PMFR S S +RILNISSRLG  NK++NPK++
Sbjct  134  PKLLIQSLFPMFRRSKSISRILNISSRLGSINKMKNPKMK  173


 Score = 73.2 bits (178),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  56   MASILSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            M +     SSP    TRWWS++TVAIVTGANKGIGF LVK+LAE G+TV+LTAR  +   
Sbjct  1    MEAKEQDLSSPISSATRWWSKDTVAIVTGANKGIGFWLVKQLAEEGVTVILTARDVERGC  60

Query  236  R  238
            +
Sbjct  61   K  61



>ref|XP_008223612.1| PREDICTED: LOW QUALITY PROTEIN: (+)-neomenthol dehydrogenase 
[Prunus mume]
Length=306

 Score =   127 bits (319),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVSD  SI  F SWFR +++ALDILVNNAAVSFND+++NSVEHA+TV+ TN+YG
Sbjct  77   VAFSCLDVSDPSSIRAFTSWFRKSYAALDILVNNAAVSFNDLNENSVEHADTVMKTNFYG  136

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLLI ALLP+FR SSS +RILN+SSRLG  N+L+NP ++
Sbjct  137  PKLLIEALLPVFRSSSSISRILNVSSRLGSLNQLRNPSIK  176


 Score = 82.4 bits (202),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 7/59 (12%)
 Frame = +2

Query  83   SPSL-PKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ------EALR  238
            SPSL P +RWWSE+TVA+VTGANKGIGFALVKR+AELG+TV+LTAR  +      EALR
Sbjct  12   SPSLSPTSRWWSEDTVAVVTGANKGIGFALVKRMAELGMTVILTARDIERGCKAVEALR  70



>ref|XP_004135331.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Cucumis sativus]
 gb|KGN51659.1| Carbonyl reductase [Cucumis sativus]
Length=298

 Score =   137 bits (344),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDVSD  SI  FA+WF   F ALDILVNNAAVSFND+ +NSVE+AETV+ TN+YG
Sbjct  73   VLFRRLDVSDPDSIVAFAAWFGSNFQALDILVNNAAVSFNDIYENSVENAETVMKTNFYG  132

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLLI AL+P FR SSS  RILNI+SRLG  +K++N K++
Sbjct  133  PKLLIEALIPYFRSSSSKTRILNITSRLGTVDKVRNVKVK  172


 Score = 72.4 bits (176),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  83   SPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            S SLP  RWWS+ TVAIVTGANKGIGFALV++LA+  LTVVLTAR     L+
Sbjct  9    SSSLPSHRWWSKNTVAIVTGANKGIGFALVRKLAQSELTVVLTARDEVRGLK  60



>ref|XP_011091715.1| PREDICTED: (+)-neomenthol dehydrogenase [Sesamum indicum]
Length=303

 Score =   133 bits (334),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F +LDV++ +SI  FA+WF+  F  +DIL+NNAAVSFN++ +NSV  AETVI TN+YG
Sbjct  80   VHFFQLDVANPNSINTFAAWFQEAFGVVDILINNAAVSFNEIHENSVAEAETVIRTNFYG  139

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PK+L  ALLP+FR SS+ ARILNISSRLG  NKL+NPKL+
Sbjct  140  PKMLTEALLPLFRRSSTGARILNISSRLGLLNKLKNPKLK  179


 Score = 75.9 bits (185),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = +2

Query  83   SPSLP-KTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            +PS P  +RWWS+ETVAIVTGANKGIGFALV+RLAE G+TVVLTAR T
Sbjct  15   APSHPISSRWWSKETVAIVTGANKGIGFALVRRLAEEGVTVVLTARDT  62



>ref|XP_011037379.1| PREDICTED: (+)-neomenthol dehydrogenase [Populus euphratica]
Length=304

 Score =   135 bits (341),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F+RLDVSD  SI  FA WF+  F  LDIL+NNAAVSFND+ +NSV+HAE VI TN+YG
Sbjct  82   VHFYRLDVSDPASIKTFALWFQKKFGVLDILINNAAVSFNDIYENSVDHAEIVIKTNFYG  141

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL   LLPMFR S S +RILNISSRLG  NK++NPK++
Sbjct  142  VKLLTETLLPMFRRSDSISRILNISSRLGSINKMRNPKMK  181


 Score = 72.4 bits (176),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            TRWWS++TVA+VTGANKGIGF+LV +LA+LGLTV+LTAR  ++  R
Sbjct  25   TRWWSKDTVAMVTGANKGIGFSLVNQLAQLGLTVILTARDVEKGNR  70



>ref|XP_010672446.1| PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=291

 Score =   139 bits (349),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F  LDVSD HSI+ FA+WF+  F  LDILVNNAAVSFND+ +NSV+HAETVI TN+YGPK
Sbjct  71   FSLLDVSDPHSISVFAAWFKLNFGVLDILVNNAAVSFNDIHENSVKHAETVIKTNFYGPK  130

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  ALLP FRCS+S +RILN SSRLG   K++N  +R
Sbjct  131  LLTEALLPFFRCSTSKSRILNFSSRLGLLTKVENQNIR  168


 Score = 69.3 bits (168),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            TRWW +ET AIVTGAN+GIG A+ KRLAELG+TV+LTAR  ++ L
Sbjct  10   TRWWGKETKAIVTGANRGIGLAVAKRLAELGVTVILTARDAKKGL  54



>ref|XP_008802059.1| PREDICTED: (+)-neomenthol dehydrogenase [Phoenix dactylifera]
Length=314

 Score =   134 bits (337),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F +LDV D  SI  FASW +  F  LDILVNNA VSFN++D NSVEHAETVI TN+YGPK
Sbjct  94   FCQLDVGDSSSIMAFASWLQRRFGGLDILVNNAGVSFNEIDSNSVEHAETVIRTNFYGPK  153

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LLI ALLPMFR S +T+RILNISS+LG  NK+ N  L+
Sbjct  154  LLIEALLPMFRRSPATSRILNISSQLGLLNKVSNSALK  191


 Score = 73.2 bits (178),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  50   AAMASILSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            +++A + S   +      +WWS+ETVA+VTGANKGIGFALV+RLAELGLTVVLT+R
Sbjct  18   SSLAMVASSGKTQKKKGPKWWSKETVAVVTGANKGIGFALVERLAELGLTVVLTSR  73



>ref|XP_010258458.1| PREDICTED: (+)-neomenthol dehydrogenase [Nelumbo nucifera]
Length=303

 Score =   130 bits (327),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F +LDVSD  SI  F SW    F  LDILVNNAAVSFND+ +NSVEHA TVI TN+YG
Sbjct  82   VEFSQLDVSDPGSIYAFVSWLNKQFGGLDILVNNAAVSFNDIGENSVEHALTVIRTNFYG  141

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLL  ALLP+FR S S +RILN+SS+LG  NK++NP +R
Sbjct  142  PKLLTEALLPLFRRSPSISRILNVSSQLGLLNKVRNPAVR  181


 Score = 77.4 bits (189),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  80   SSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            SS  L  TRWWSE+TVA+VTGANKGIGFA+VKRLAE+GLTV+LT+R
Sbjct  18   SSLHLSTTRWWSEDTVAVVTGANKGIGFAMVKRLAEMGLTVILTSR  63



>ref|XP_006858784.1| hypothetical protein AMTR_s00066p00159430 [Amborella trichopoda]
 gb|ERN20251.1| hypothetical protein AMTR_s00066p00159430 [Amborella trichopoda]
Length=294

 Score =   137 bits (344),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH LDVS  HSI DF  W R  F  LDILVNNAAVSFN + +NSVEHAETV+ TN+YGPK
Sbjct  74   FHCLDVSSSHSILDFVYWLRTCFGGLDILVNNAAVSFNALHENSVEHAETVLRTNFYGPK  133

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  ALLP+FR S S +RILN+SSRLG  NKLQ+P L+
Sbjct  134  LLTDALLPLFRQSPSKSRILNVSSRLGSLNKLQDPVLK  171


 Score = 70.5 bits (171),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  56   MASILSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            MAS         +P TRWWS +T+A+VTGANKGIGF +VK+L ELGLTV+LTAR   + L
Sbjct  1    MASTDPSTQHSCIP-TRWWSRDTLAVVTGANKGIGFEIVKQLCELGLTVILTARDESKGL  59

Query  236  R  238
             
Sbjct  60   E  60



>ref|XP_010672445.1| PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=292

 Score =   139 bits (349),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F  LDVSD HSI+ FA+WF+  F  LDILVNNAAVSFND+ +NSV+HAETVI TN+YGPK
Sbjct  72   FSLLDVSDPHSISVFAAWFKLNFGVLDILVNNAAVSFNDIHENSVKHAETVIKTNFYGPK  131

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  ALLP FRCS+S +RILN SSRLG   K++N  +R
Sbjct  132  LLTEALLPFFRCSTSKSRILNFSSRLGLLTKVENQNIR  169


 Score = 67.8 bits (164),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            RWW +ET AIVTGAN+GIG A+ KRLAELG+TV+LTAR  ++ L
Sbjct  12   RWWGKETKAIVTGANRGIGLAVAKRLAELGVTVILTARDAKKGL  55



>ref|XP_007153728.1| hypothetical protein PHAVU_003G060100g [Phaseolus vulgaris]
 gb|ESW25722.1| hypothetical protein PHAVU_003G060100g [Phaseolus vulgaris]
Length=302

 Score =   127 bits (318),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFS-ALDILVNNAAVSFNDVDQNSVEHAETVIATNYY  447
            V F  LDVSD  S++ FAS F+  F   LDILVNNA VS+N++++NSVE+AE+V+ TN+Y
Sbjct  74   VHFLLLDVSDPLSVSSFASSFKAKFGPTLDILVNNAGVSYNELEKNSVENAESVMKTNFY  133

Query  448  GPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            GPKLLI ALLP+FRCSSS  R+LN+SSRLG  NK++N ++R
Sbjct  134  GPKLLIQALLPLFRCSSSITRVLNVSSRLGSLNKVRNAEIR  174


 Score = 78.6 bits (192),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 11/66 (17%)
 Frame = +2

Query  35   HHFFPAAMASILSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTA  214
             H+FP           SPSL  +RWW++ETVA+VTG NKGIGFALVKR A+LG++VVLTA
Sbjct  4    EHYFP-----------SPSLLSSRWWTKETVAVVTGGNKGIGFALVKRFAKLGVSVVLTA  52

Query  215  RVTQEA  232
            R  Q  
Sbjct  53   RNKQRG  58



>ref|XP_008375556.1| PREDICTED: (+)-neomenthol dehydrogenase [Malus domestica]
Length=326

 Score =   133 bits (334),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVSD  SI  F  WF+ T++ LDILVNNAAVSFND+++NSVEHAE V+ TN+YG
Sbjct  83   VVFSCLDVSDPASIKSFTLWFQKTYAVLDILVNNAAVSFNDINENSVEHAEAVMKTNFYG  142

Query  451  PKLLIAALLPMFRCS-SSTARILNISSRLGQFNKLQNPKLR  570
            PKLL  ALLPMFR S SS  RILN+SSRLG  NKL+NP  +
Sbjct  143  PKLLTEALLPMFRRSTSSVGRILNVSSRLGSLNKLRNPSTK  183


 Score = 72.4 bits (176),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 6/52 (12%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ------EALR  238
            +RWWSE+TVAIVTGANKGIGFA+ KR+AELG+ V+LTAR  +      EALR
Sbjct  25   SRWWSEDTVAIVTGANKGIGFAVAKRMAELGVRVILTARDKERGGKAVEALR  76



>ref|XP_008354829.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica]
Length=292

 Score =   130 bits (327),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVSD  SI  F SWF+ +++ LDILVNNAAVSFND+++NSVEHAE V+ TN+YG
Sbjct  66   VTFSCLDVSDPSSIKSFTSWFKKSYAVLDILVNNAAVSFNDINENSVEHAEXVMKTNFYG  125

Query  451  PKLLIAALLPMF-RCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLL  ALLPMF   +SS  RILN+SSRLG  NKL+NP  +
Sbjct  126  PKLLTDALLPMFHHSTSSVGRILNVSSRLGSLNKLRNPSTK  166


 Score = 74.7 bits (182),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  98   KTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            + RWWSE+TVAIVTGANKGIGFA+VKR AELG+TV+LTAR  +   +
Sbjct  7    RRRWWSEDTVAIVTGANKGIGFAVVKRXAELGVTVILTARDKERGCK  53



>ref|XP_006402662.1| hypothetical protein EUTSA_v10006128mg [Eutrema salsugineum]
 gb|ESQ44115.1| hypothetical protein EUTSA_v10006128mg [Eutrema salsugineum]
Length=295

 Score =   127 bits (319),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDV+D  SIA F SWFR  F  LDILVNNAAVSFN V +NS++  ET+I TN+YG
Sbjct  73   VHFFCLDVTDPSSIAAFVSWFRLNFRVLDILVNNAAVSFNAVGENSIKEPETIIKTNFYG  132

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLP+FR S S +RILNISSRLG  NKL+NP +R
Sbjct  133  AKLLTEALLPLFRRSVSVSRILNISSRLGALNKLRNPNVR  172


 Score = 77.8 bits (190),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   SPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
            SP+ P  RWWSEET A+VTGANKGIGFA+VK+L ELG+TVVLTAR  +  
Sbjct  9    SPTQPSKRWWSEETTAVVTGANKGIGFAVVKKLLELGVTVVLTARNAENG  58



>ref|XP_008446020.1| PREDICTED: (+)-neomenthol dehydrogenase [Cucumis melo]
Length=298

 Score =   135 bits (341),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDVSD  SI  FA+WF   F ALDILVNNAAVSFND+ +NSVE+AETV+ TN+YG
Sbjct  73   VLFRRLDVSDPDSIVAFAAWFASNFQALDILVNNAAVSFNDIYENSVENAETVMKTNFYG  132

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLLI AL P FR SSS  RILNI+SRLG  +K++N K++
Sbjct  133  PKLLIEALFPYFRSSSSKTRILNITSRLGTVDKVRNIKVK  172


 Score = 69.3 bits (168),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  83   SPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            S SL   RWWS+ TVAIVTGANKGIGFALV++LA+  LTVVLTAR     L+
Sbjct  9    SSSLSSHRWWSKNTVAIVTGANKGIGFALVRKLAQSELTVVLTARDEVRGLK  60



>gb|KFK35185.1| hypothetical protein AALP_AA5G251400 [Arabis alpina]
Length=295

 Score =   127 bits (319),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LD+SD  SI+ F SWFR  F  LDILVNNAAVSFN +D NS++  ET+I TN+YG
Sbjct  73   VHFCCLDISDPSSISAFVSWFRLNFGILDILVNNAAVSFNAIDDNSIKQPETIIKTNFYG  132

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLP+FR S S +RILNISSRLG  NKL+NP +R
Sbjct  133  AKLLTEALLPLFRRSVSVSRILNISSRLGSLNKLRNPSVR  172


 Score = 77.4 bits (189),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   SPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
            SP+ P  RWWSE+T  +VTGANKGIGFA+VKRL ELGLTVVLTAR  +  
Sbjct  9    SPTPPSNRWWSEKTTVVVTGANKGIGFAVVKRLLELGLTVVLTARNAENG  58



>ref|XP_003520181.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
 gb|KHN32354.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=303

 Score =   120 bits (301),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +1

Query  286  LDVSDRHSIADFASWFRCTFSA-LDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKLL  462
            LDVSD  S++ FAS FR  F A LDILVNNA VS+N++D+NSVEHAE+VI TN+YG K L
Sbjct  79   LDVSDPLSVSTFASSFRAKFGATLDILVNNAGVSYNELDENSVEHAESVIKTNFYGSKSL  138

Query  463  IAALLPMFRCSSST-ARILNISSRLGQFNKLQNPKLR  570
            I ALLP+FR SSS+  R+LN+SSRLG  NK++N ++R
Sbjct  139  IEALLPLFRFSSSSITRVLNVSSRLGSLNKVRNAEIR  175


 Score = 83.6 bits (205),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 46/66 (70%), Gaps = 11/66 (17%)
 Frame = +2

Query  35   HHFFPAAMASILSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTA  214
             H+FP           SPSL  TRWWS ETVA+VTG NKGIGFALVKRLAELG++VVLTA
Sbjct  4    EHYFP-----------SPSLCLTRWWSRETVAVVTGGNKGIGFALVKRLAELGVSVVLTA  52

Query  215  RVTQEA  232
            R  Q  
Sbjct  53   RDKQRG  58



>emb|CDX67809.1| BnaA07g18490D [Brassica napus]
Length=295

 Score =   130 bits (326),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVSD  SI+ F SWFR  F  LDILVNNAAVSFN V +NS+   ET+I TNYYG
Sbjct  73   VHFFCLDVSDPSSISAFVSWFRLNFGILDILVNNAAVSFNAVGENSIREPETIIKTNYYG  132

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLP+FR S S  RILNISSRLG  NKL+NP LR
Sbjct  133  AKLLTEALLPLFRRSVSVGRILNISSRLGALNKLRNPSLR  172


 Score = 73.9 bits (180),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  83   SPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
            SP  P  RWWSEET A+VTGANKGIGF +VK+L +LGLTVVLTAR  +  
Sbjct  9    SPIPPSDRWWSEETTAVVTGANKGIGFEVVKKLLKLGLTVVLTARNAENG  58



>ref|XP_006583851.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
 gb|KHN31019.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=303

 Score =   126 bits (316),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 82/102 (80%), Gaps = 2/102 (2%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSA-LDILVNNAAVSFNDVDQNSVEHAETVIATNYY  447
            V F  LDVSD  S+  FAS F+  F A LDILVNNA VS+N++D+NSVEHAE+VI TN+Y
Sbjct  74   VHFLLLDVSDPLSVLTFASSFQAKFGATLDILVNNAGVSYNELDENSVEHAESVIKTNFY  133

Query  448  GPKLLIAALLPMFRCSSST-ARILNISSRLGQFNKLQNPKLR  570
            GPKLLI ALLP+FRCSSS+  R+LN+SSRLG  +K++N ++R
Sbjct  134  GPKLLIEALLPLFRCSSSSITRVLNVSSRLGSLDKVRNGEIR  175


 Score = 77.0 bits (188),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 43/66 (65%), Gaps = 11/66 (17%)
 Frame = +2

Query  35   HHFFPAAMASILSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTA  214
             H+FP            PS   TRWWS ETVA+VTG NKGIGFALV RLAELG++VVLTA
Sbjct  4    EHYFPC-----------PSSCLTRWWSRETVAVVTGGNKGIGFALVNRLAELGVSVVLTA  52

Query  215  RVTQEA  232
            R  Q  
Sbjct  53   RDRQRG  58



>ref|XP_009341576.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Pyrus 
x bretschneideri]
Length=305

 Score =   124 bits (310),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVSD  SI  F   F+ +++ LDILVNNAAVSFND+++NSVEHAETV+ TN+YG
Sbjct  79   VAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYG  138

Query  451  PKLLIAALLPMF-RCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLL  ALLPMF   +SS  RI+N+SSRLG  NKL+NP  +
Sbjct  139  PKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTK  179


 Score = 78.2 bits (191),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 9/61 (15%)
 Frame = +2

Query  83   SPSL---PKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ------EAL  235
            SPSL   P TRWWSE+TVAIVTGANKGIGFA+VK +AELG+TV+LTAR  +      EAL
Sbjct  12   SPSLFPTPTTRWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEAL  71

Query  236  R  238
            R
Sbjct  72   R  72



>ref|XP_008661481.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 gb|ACN25251.1| unknown [Zea mays]
 gb|ACR37752.1| unknown [Zea mays]
 gb|AFW58715.1| hypothetical protein ZEAMMB73_802882 [Zea mays]
Length=292

 Score =   137 bits (344),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F RLDVSD  S+A+FA+W R     LDILVNNAAVSFN++D NSVEHAETV+ TN+YG K
Sbjct  72   FRRLDVSDAASVAEFAAWLRDAVGGLDILVNNAAVSFNEIDTNSVEHAETVLRTNFYGAK  131

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            +L  ALLP+FR SS+T+RILNISS+LG  NK+ +P L+
Sbjct  132  MLTEALLPLFRQSSATSRILNISSQLGLLNKVGDPSLK  169


 Score = 64.3 bits (155),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  89   SLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            S P   WWS ETVA+VTGAN+GIG AL  RLAE GLTVVLTAR
Sbjct  9    SPPSGAWWSRETVAVVTGANRGIGHALAARLAEHGLTVVLTAR  51



>ref|XP_010526584.1| PREDICTED: (+)-neomenthol dehydrogenase [Tarenaya hassleriana]
Length=302

 Score =   129 bits (324),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F  LDVSD  SI  F SW R  F A+DILVNNAAVSFN + +NSV+H ETV+ TN+YG K
Sbjct  80   FFTLDVSDPSSIDAFVSWLRTKFGAIDILVNNAAVSFNGIHENSVQHPETVLRTNFYGAK  139

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  ALLP+FR SSS +R+LNISSRLG  +KL+NP +R
Sbjct  140  LLTEALLPLFRRSSSVSRVLNISSRLGSLDKLRNPSIR  177


 Score = 71.2 bits (173),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            +WWSEETVA+VTGAN+GIGFA+VKRL+E GLTVVLTAR +    R
Sbjct  21   KWWSEETVAVVTGANRGIGFAVVKRLSEHGLTVVLTARNSVNGHR  65



>ref|XP_003580060.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Brachypodium distachyon]
Length=298

 Score =   134 bits (338),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F RLDVSD  S+A FA W R     LDILVNNAAVSFN++D NSVEHAETV+ TN+YG K
Sbjct  76   FRRLDVSDAASVAGFAGWLRNAVGGLDILVNNAAVSFNEIDTNSVEHAETVLRTNFYGAK  135

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKL  567
            LL  ALLP+FR S +T+RILNISS+LG  NK+ NP L
Sbjct  136  LLTEALLPLFRRSPATSRILNISSQLGLLNKVSNPSL  172


 Score = 65.5 bits (158),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +2

Query  95   PKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR--VTQEALRLP  244
            P   WWS+ETVA+VTGAN+GIG AL  RLAE GLTVVLTAR  V  EA   P
Sbjct  15   PTGAWWSKETVAVVTGANRGIGLALAARLAEQGLTVVLTARDGVRGEAAAAP  66



>ref|XP_008668377.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AAV64194.1| unknown [Zea mays]
 tpg|DAA37134.1| TPA: hypothetical protein ZEAMMB73_820599 [Zea mays]
Length=294

 Score =   135 bits (340),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F RLDVSD  S+A+FA+W R     LDILVNNAAVSFN++D NSVEHAE V+ TN+YG K
Sbjct  72   FRRLDVSDPASVAEFAAWIRDALGGLDILVNNAAVSFNEIDTNSVEHAEAVLRTNFYGAK  131

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            +L  ALLP+FR SS+T+RILN+SS+LG  NK+ +P LR
Sbjct  132  MLTEALLPLFRQSSATSRILNVSSQLGLLNKVSDPSLR  169


 Score = 64.3 bits (155),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  89   SLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            S P   WWS ETVA+VTGAN+GIG AL  RLAE GLTVVLTAR
Sbjct  9    SPPAGAWWSRETVAVVTGANRGIGHALAARLAEHGLTVVLTAR  51



>gb|AES90281.2| short chain dehydrogenase/reductase [Medicago truncatula]
Length=312

 Score =   118 bits (296),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 81/105 (77%), Gaps = 5/105 (5%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSA-LDILVNNAAVSFNDVDQNSVEHAETVIATNYY  447
            V F  LDVSD  SI  FAS F+  F A LDILVNNAAVSFN++D+NSV+HAE V+ TN+Y
Sbjct  78   VHFLVLDVSDADSIKTFASSFKDKFGATLDILVNNAAVSFNELDENSVDHAENVMKTNFY  137

Query  448  GPKLLIAALLPMFRCSSST----ARILNISSRLGQFNKLQNPKLR  570
            GPKLLI ALLP+FRCSSS+     RILN+SSRLG  +K+ N +++
Sbjct  138  GPKLLIEALLPLFRCSSSSNSSITRILNVSSRLGSLDKVTNVEMK  182


 Score = 81.3 bits (199),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   YSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
            + SP+L  TRWWS+ETVA+VTG NKGIGFALVKR AELGL+VVLTAR  ++ 
Sbjct  7    FPSPALCSTRWWSKETVAVVTGGNKGIGFALVKRFAELGLSVVLTARDKKKG  58



>ref|XP_004505149.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Cicer arietinum]
Length=308

 Score =   120 bits (301),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 77/100 (77%), Gaps = 2/100 (2%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFS-ALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGP  453
            F  LDVSD +SI  FAS F+  F   LDILVNNA VSFN++D+NSV HAE VI TN+YGP
Sbjct  78   FLLLDVSDPNSIKTFASSFKAKFGPTLDILVNNAGVSFNELDENSVGHAECVIKTNFYGP  137

Query  454  KLLIAALLPMFRCSSST-ARILNISSRLGQFNKLQNPKLR  570
            K +I ALLP+FR SSS+  RILN+SSRLG  NK++N +++
Sbjct  138  KFVIEALLPLFRSSSSSVTRILNVSSRLGSLNKMRNEEMK  177


 Score = 79.3 bits (194),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 11/66 (17%)
 Frame = +2

Query  35   HHFFPAAMASILSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTA  214
             H+FP+A           +L  TRWWS+ETVA+VTG NKGIGFA+VKRLAE+G+ VVLTA
Sbjct  4    EHYFPSA-----------ALCSTRWWSKETVAVVTGGNKGIGFAVVKRLAEVGVNVVLTA  52

Query  215  RVTQEA  232
            R  Q+ 
Sbjct  53   RDKQKG  58



>ref|XP_002878286.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH54545.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=301

 Score =   127 bits (318),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LD+SD  SIA FASWFR  F  LDILVNNAAVSFN V +N +   ET+I TN+YG
Sbjct  79   VHFGCLDISDPSSIAAFASWFRHNFGVLDILVNNAAVSFNAVGENLINEPETIIKTNFYG  138

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLL  ALLP+FR S S +RILN+SSRLG  NKL++P +R
Sbjct  139  PKLLTEALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIR  178


 Score = 72.4 bits (176),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            WWSEET A+VTGANKGIGFA+VKRL ELGLTVVLTAR  +  ++
Sbjct  23   WWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENGIQ  66



>gb|EAY86622.1| hypothetical protein OsI_08003 [Oryza sativa Indica Group]
Length=298

 Score =   136 bits (342),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDVSD  S+A FASW R     LDILVNNAAVSFN++D NSVEHAETV+ TN+YG
Sbjct  72   VRFRRLDVSDPASVAAFASWLRDELGGLDILVNNAAVSFNEIDTNSVEHAETVLRTNFYG  131

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             K+LI ALLP+FR S++ +RILNISS+LG  NK+++P LR
Sbjct  132  AKMLIEALLPLFRRSAANSRILNISSQLGLLNKVRDPSLR  171


 Score = 63.2 bits (152),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  68   LSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            LS     + P+  WW+ ETVA+VTGAN+GIG AL  RLAE GL VVLTAR
Sbjct  3    LSSSEEATTPREAWWTGETVAVVTGANRGIGHALSARLAEQGLPVVLTAR  52



>dbj|BAK07101.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   136 bits (343),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F RLDV+D  S+A FASW R  F  LDILVNNAAVSFN++D NSVEHAETV+ TN+YG K
Sbjct  73   FCRLDVADPASVAAFASWIRDHFGGLDILVNNAAVSFNEIDTNSVEHAETVLKTNFYGAK  132

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            +LI ALLP+FR SS T+RILN+SS+LG  NK+++P LR
Sbjct  133  MLIEALLPLFRRSSGTSRILNLSSQLGLLNKVRDPSLR  170


 Score = 62.4 bits (150),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  80   SSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            S  + P   WW+ ETVA+VTGAN+GIG AL  RLAE GL+VVLTAR
Sbjct  6    SKETPPHKAWWTGETVAVVTGANRGIGHALAARLAEQGLSVVLTAR  51



>ref|XP_007033726.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY04652.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=268

 Score =   124 bits (312),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F  LDVS   SI  F SW   TF  LDILVNNAAVSFN++D+NSVE+AETVI TN+YG K
Sbjct  78   FSPLDVSKPASIQTFVSWLDTTFGGLDILVNNAAVSFNEIDENSVEYAETVIKTNFYGAK  137

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  +LLP+FR S+S +RILNISSRLG  NK+++  ++
Sbjct  138  LLTESLLPLFRFSTSISRILNISSRLGSMNKVRDLNIK  175


 Score = 73.9 bits (180),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            TRWW  +TVA+VTGANKGIGFALVKR AELGLTVVLTAR
Sbjct  18   TRWWCRDTVAVVTGANKGIGFALVKRFAELGLTVVLTAR  56



>ref|XP_007033725.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY04651.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=297

 Score =   124 bits (312),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVS   SI  F SW   TF  LDILVNNAAVSFN++D+NSVE+AETVI TN+YG
Sbjct  76   VHFSPLDVSKPASIQTFVSWLDTTFGGLDILVNNAAVSFNEIDENSVEYAETVIKTNFYG  135

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             KLL  +LLP+FR S+S +RILNISSRLG  NK+++
Sbjct  136  AKLLTESLLPLFRFSTSISRILNISSRLGSMNKVRD  171


 Score = 73.9 bits (180),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            TRWW  +TVA+VTGANKGIGFALVKR AELGLTVVLTAR
Sbjct  18   TRWWCRDTVAVVTGANKGIGFALVKRFAELGLTVVLTAR  56



>emb|CDY05983.1| BnaA09g37970D [Brassica napus]
Length=292

 Score =   127 bits (318),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F+ LDVS+  SIA F SWFR  F  LDILVNNAAVSFN V  NS+   ET+I TN+YG
Sbjct  70   VQFYCLDVSEPSSIAAFVSWFRHNFGVLDILVNNAAVSFNVVGDNSIREPETIIKTNFYG  129

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLP+FR S S +RILNISSRLG  NKL+NP +R
Sbjct  130  AKLLTEALLPLFRRSVSASRILNISSRLGSLNKLRNPSVR  169


 Score = 71.6 bits (174),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P  P  RWWS ET AIVTGANKGIGF +VK+L ELGLTVVLTAR
Sbjct  7    PLPPTARWWSRETTAIVTGANKGIGFEVVKKLLELGLTVVLTAR  50



>ref|XP_009116638.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Brassica rapa]
Length=292

 Score =   126 bits (317),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F+ LDVS+  SIA F SWFR  F  LDILVNNAAVSFN V  NS+   ET+I TN+YG
Sbjct  70   VQFYCLDVSEPSSIAAFVSWFRHNFGVLDILVNNAAVSFNVVGDNSIREPETIIKTNFYG  129

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLP+FR S S +RILNISSRLG  NKL+NP +R
Sbjct  130  AKLLTEALLPLFRHSVSASRILNISSRLGSLNKLRNPTVR  169


 Score = 71.6 bits (174),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P  P  RWWS ET AIVTGANKGIGF +VK+L ELGLTVVLTAR
Sbjct  7    PLPPTARWWSRETTAIVTGANKGIGFEVVKKLLELGLTVVLTAR  50



>gb|EAZ23756.1| hypothetical protein OsJ_07463 [Oryza sativa Japonica Group]
Length=298

 Score =   136 bits (342),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F RLDVSD  S+A FASW R     LDILVNNAAVSFN++D NSVEHAETV+ TN+YG K
Sbjct  74   FRRLDVSDPASVAAFASWLRDELGGLDILVNNAAVSFNEIDTNSVEHAETVLRTNFYGAK  133

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            +LI ALLP+FR S++ +RILNISS+LG  NK+++P LR
Sbjct  134  MLIEALLPLFRRSAANSRILNISSQLGLLNKVRDPSLR  171


 Score = 62.0 bits (149),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  68   LSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            LS     + P   WW+ ETVA+VTGAN+GIG AL  RLAE GL VVLTAR
Sbjct  3    LSSSKEATPPPEAWWTGETVAVVTGANRGIGHALAARLAEQGLAVVLTAR  52



>ref|XP_009415038.1| PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=295

 Score =   121 bits (303),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDV+   SI  FA+W    F  LDIL+NNAAVSFN++D NSVEHAETVI TN+YG
Sbjct  72   VAFCHLDVAVPSSIVTFAAWLERRFGGLDILINNAAVSFNEIDTNSVEHAETVIRTNFYG  131

Query  451  PKLLIAALLPMFRCS-SSTARILNISSRLGQFNKLQNPKLR  570
             K+LI +LLP+FR S ++++RILNISS+LG  NK++NP L+
Sbjct  132  SKMLIESLLPLFRRSIATSSRILNISSQLGLLNKVRNPALK  172


 Score = 77.0 bits (188),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            TRWWS+ETVA+VTGANKGIGFALVKRLAELGLTVVLT+R
Sbjct  15   TRWWSKETVAVVTGANKGIGFALVKRLAELGLTVVLTSR  53



>ref|NP_001047383.1| Os02g0607700 [Oryza sativa Japonica Group]
 dbj|BAD20143.1| putative carbonyl reductase 3 [Oryza sativa Japonica Group]
 dbj|BAF09297.1| Os02g0607700 [Oryza sativa Japonica Group]
 dbj|BAG98648.1| unnamed protein product [Oryza sativa Japonica Group]
Length=298

 Score =   136 bits (342),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDVSD  S+A FASW R     LDILVNNAAVSFN++D NSVEHAETV+ TN+YG
Sbjct  72   VRFRRLDVSDPASVAAFASWLRDELGGLDILVNNAAVSFNEIDTNSVEHAETVLRTNFYG  131

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             K+LI ALLP+FR S++ +RILNISS+LG  NK+++P LR
Sbjct  132  AKMLIEALLPLFRRSAANSRILNISSQLGLLNKVRDPSLR  171


 Score = 62.0 bits (149),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  68   LSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            LS     + P   WW+ ETVA+VTGAN+GIG AL  RLAE GL VVLTAR
Sbjct  3    LSSSKEATPPPEAWWTGETVAVVTGANRGIGHALAARLAEQGLAVVLTAR  52



>ref|XP_004976089.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Setaria italica]
Length=294

 Score =   134 bits (336),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDVSD  S+A+FA+W R     LDILVNNAAVSFN++D NSVEHAETV+ TN+YG
Sbjct  70   VAFRRLDVSDPDSVAEFAAWLRDAVGGLDILVNNAAVSFNEIDTNSVEHAETVLRTNFYG  129

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKL  567
             K+L  ALLP+FR S +T+RILNISS+LG  NK+ +P L
Sbjct  130  AKMLTEALLPLFRQSPATSRILNISSQLGLLNKVSDPSL  168


 Score = 64.3 bits (155),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   PKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P   WWS ETVA+VTGAN+GIG AL  RLAE GLTVVLTAR
Sbjct  11   PAGAWWSRETVAVVTGANRGIGHALAARLAEHGLTVVLTAR  51



>ref|XP_002448112.1| hypothetical protein SORBIDRAFT_06g021390 [Sorghum bicolor]
 gb|EES12440.1| hypothetical protein SORBIDRAFT_06g021390 [Sorghum bicolor]
Length=290

 Score =   134 bits (338),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F RLDVSD  S+++FA+W R     LDILVNNAAVSFN++D NSVEHAETV+ TN+YG K
Sbjct  68   FRRLDVSDPASVSEFAAWIRDAVGGLDILVNNAAVSFNEIDTNSVEHAETVLRTNFYGAK  127

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            +L  ALLP+FR SS+T+RILNISS+LG  NK+ +P L+
Sbjct  128  MLTEALLPLFRQSSATSRILNISSQLGLLNKVSDPSLK  165


 Score = 62.8 bits (151),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WWS ETVA+VTGAN+GIG AL  RLAE GLTVVLTAR
Sbjct  11   WWSRETVAVVTGANRGIGHALAARLAEHGLTVVLTAR  47



>ref|XP_010413651.1| PREDICTED: salutaridine reductase-like isoform X1 [Camelina sativa]
Length=293

 Score =   124 bits (310),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LD+SD  SIA F SWFR     LDILVNNA VSFN V +NS++  ET+I TN+YG
Sbjct  70   VHFCSLDISDPSSIAAFVSWFRRNLGVLDILVNNAGVSFNAVGENSIKQPETIIKTNFYG  129

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLP+FR S S +RILNISSRLG  NKL++P +R
Sbjct  130  AKLLTEALLPLFRRSESVSRILNISSRLGTLNKLRSPIIR  169


 Score = 73.6 bits (179),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  83   SPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            SP  P  +WWSE T A+VTGANKGIGFA+VKRL ELGLTVVLT+R T
Sbjct  6    SPLSPTNKWWSEGTTAVVTGANKGIGFAVVKRLLELGLTVVLTSRNT  52



>ref|XP_004953042.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Setaria italica]
Length=309

 Score =   132 bits (331),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDV+D  S+A FASW R     LDILVNNAAVSFN+VD NSV HAETV+ TN+YG
Sbjct  87   VRFRRLDVADPASVAAFASWVRDELGGLDILVNNAAVSFNEVDTNSVGHAETVLRTNFYG  146

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             K+L  ALLP+FR +  T+RILNISS+LG  NKL++P LR
Sbjct  147  AKMLTEALLPLFRRAPETSRILNISSQLGLLNKLKDPSLR  186


 Score = 65.5 bits (158),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   PKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            PK  WW+ ETVA+VTGAN+GIG AL  RLAE GLTVVLTAR
Sbjct  20   PKAPWWTGETVAVVTGANRGIGHALAARLAEQGLTVVLTAR  60



>ref|XP_009341577.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Pyrus 
x bretschneideri]
Length=292

 Score =   123 bits (309),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVSD  SI  F   F+ +++ LDILVNNAAVSFND+++NSVEHAETV+ TN+YG
Sbjct  66   VAFSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFNDINENSVEHAETVMKTNFYG  125

Query  451  PKLLIAALLPMF-RCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLL  ALLPMF   +SS  RI+N+SSRLG  NKL+NP  +
Sbjct  126  PKLLTDALLPMFLHSTSSIGRIVNVSSRLGSLNKLRNPSTK  166


 Score = 72.4 bits (176),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 6/53 (11%)
 Frame = +2

Query  98   KTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ------EALR  238
            + RWWSE+TVAIVTGANKGIGFA+VK +AELG+TV+LTAR  +      EALR
Sbjct  7    RRRWWSEDTVAIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALR  59



>emb|CDX71880.1| BnaC08g29940D [Brassica napus]
Length=292

 Score =   126 bits (317),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F+ LDVSD  SIA F SWFR  F  LDILVNNAAVSFN V  NS++  ET+I TN+YG
Sbjct  70   VHFYCLDVSDPSSIAAFVSWFRHNFGVLDILVNNAAVSFNAVGDNSIKEPETIIKTNFYG  129

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLP+FR   S +RILNISSRLG  NKL+NP +R
Sbjct  130  AKLLTEALLPLFRRLVSVSRILNISSRLGSLNKLRNPSVR  169


 Score = 69.3 bits (168),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
            P  P +RWWS+ T A+VTGANKGIGF +VK+L ELGLTVVLTAR  +  
Sbjct  7    PLPPTSRWWSKGTTAVVTGANKGIGFEVVKKLLELGLTVVLTARNAKNG  55



>ref|XP_010512245.1| PREDICTED: salutaridine reductase-like [Camelina sativa]
Length=294

 Score =   124 bits (312),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LD+SD  SIA F SWFR     LDILVNNA VSFN V +NS++  ET+I TN+YG
Sbjct  71   VHFCSLDISDPSSIAAFVSWFRRNLGVLDILVNNAGVSFNAVGENSIKQPETIINTNFYG  130

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLP+FR S S +RILNISSRLG  NKL++P LR
Sbjct  131  AKLLTEALLPLFRRSESVSRILNISSRLGTLNKLRSPSLR  170


 Score = 70.9 bits (172),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  83   SPSLPKT-RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            SP  P T +WWSE T A+VTGANKGIGFA+VKRL ELGLTVVLTAR T
Sbjct  6    SPLSPLTNKWWSEGTTAVVTGANKGIGFAVVKRLLELGLTVVLTARNT  53



>emb|CAD41255.1| OSJNBa0067K08.7 [Oryza sativa Japonica Group]
 emb|CAH67487.1| H0306B06.2 [Oryza sativa Indica Group]
 gb|EEC77556.1| hypothetical protein OsI_16477 [Oryza sativa Indica Group]
Length=294

 Score =   133 bits (334),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLDV+D  S+  FA+W R     LDILVNNAAVSFN++D NSVEHAETV+ TN+YG K
Sbjct  72   FHRLDVADPASVQAFAAWLRDAIGGLDILVNNAAVSFNEIDTNSVEHAETVLRTNFYGAK  131

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            +L  ALLP+FR S +T+RILNISS+LG  NK+ +P+L+
Sbjct  132  MLTEALLPLFRRSPATSRILNISSQLGLLNKVSDPELK  169


 Score = 62.4 bits (150),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +2

Query  74   QYSSPSLPKTR--WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
             YSS   P +   WW+ ETVA+VTGAN+GIG AL  RL E G+TVVLTAR
Sbjct  2    DYSSSKEPSSARAWWTRETVAVVTGANRGIGLALAARLGEHGITVVLTAR  51



>gb|AAR96014.1| putative short-chain hydrogenase/reductase [Musa acuminata]
Length=308

 Score =   117 bits (293),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 80/114 (70%), Gaps = 14/114 (12%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDV++  SI  FA+W    F  LDIL+NNAAVSFN++D NSVEHAETVI TN+YG
Sbjct  72   VAFCHLDVAEPSSIVTFAAWLERRFGGLDILINNAAVSFNEIDTNSVEHAETVIRTNFYG  131

Query  451  PKLLIAALLPMFRCS-SSTARILNISSRLGQFN-------------KLQNPKLR  570
            PK+LI +LLP+FR S ++++RILNISS+LG  N             K++NP L+
Sbjct  132  PKMLIESLLPLFRRSIATSSRILNISSQLGLLNAVNQSHVSLCALQKVRNPALK  185


 Score = 77.0 bits (188),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            TRWWS+ETVA+VTGANKGIGFALVKRLAELGLTVVLT+R
Sbjct  15   TRWWSKETVAVVTGANKGIGFALVKRLAELGLTVVLTSR  53



>ref|XP_010235675.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Brachypodium distachyon]
Length=295

 Score =   131 bits (329),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDV+D  S+A FASW R     LDILVNNAAVSFN+++ NSVEHAETV+ TN+YG
Sbjct  73   VRFRRLDVADPASVAAFASWIRDHVGGLDILVNNAAVSFNEIETNSVEHAETVLRTNFYG  132

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             K+LI ALLP+FR  + T+RILN+SS+LG  NK+++P LR
Sbjct  133  AKMLIEALLPLFRREAGTSRILNLSSQLGLLNKVRDPSLR  172


 Score = 63.2 bits (152),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +2

Query  71   SQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            S+ + PS P   WW+ ETVA+VTGAN+GIG AL  RLAE GL+VVLTAR
Sbjct  6    SKETPPSKPAP-WWTGETVAVVTGANRGIGHALAARLAEQGLSVVLTAR  53



>gb|KJB71626.1| hypothetical protein B456_011G134500 [Gossypium raimondii]
Length=300

 Score =   124 bits (310),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVS   SI  F SW   TF  LDILVNNA VSFND+ +NSVE AETVI TN++G
Sbjct  79   VRFFALDVSKAASIKTFVSWVETTFGGLDILVNNAGVSFNDIHENSVEFAETVIKTNFHG  138

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLL  +LLP+FR S S +RILNISSRLG  NK++N  ++
Sbjct  139  PKLLTESLLPLFRLSPSISRILNISSRLGSINKVRNHNIK  178


 Score = 69.7 bits (169),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
             RWWS +TVA+VTGANKGIG A+VKR AELGLTVVLTAR  +   +
Sbjct  21   NRWWSGDTVAVVTGANKGIGLAVVKRFAELGLTVVLTARDEERGKK  66



>gb|KHG00050.1| Salutaridine reductase [Gossypium arboreum]
Length=297

 Score =   122 bits (307),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVS   SI  F SW   TF  LDILVNNA VSFND+ +NSVE AETVI TN++G
Sbjct  76   VRFFALDVSKAASIKTFVSWVETTFGGLDILVNNAGVSFNDIHENSVEFAETVIKTNFHG  135

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            PKLL  +LLP+FR S S +RILNISSRLG  NK++N  ++
Sbjct  136  PKLLTDSLLPLFRLSPSISRILNISSRLGSINKVRNHTIK  175


 Score = 69.7 bits (169),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  98   KTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            + RWWS +TVA+VTGANKGIG A+VKR AELGLTVVLTAR  +   +
Sbjct  17   RGRWWSGDTVAVVTGANKGIGLAVVKRFAELGLTVVLTARDEERGKK  63



>ref|XP_010469284.1| PREDICTED: salutaridine reductase-like [Camelina sativa]
Length=293

 Score =   120 bits (300),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LD+SD  SIA F SWF      LDILVNNA VSFN V +NS++  ET+I TN+YG
Sbjct  70   VHFCSLDISDPSSIAAFVSWFHRNLGVLDILVNNAGVSFNAVGENSIKQPETIIKTNFYG  129

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLP+FR S S +RILNISSRLG  NKL++P +R
Sbjct  130  AKLLSEALLPLFRRSESVSRILNISSRLGTLNKLRSPIIR  169


 Score = 72.4 bits (176),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  83   SPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            SP  P  +WW+E T A+VTGANKGIGFA+VKRL +LGLTVVLTAR T
Sbjct  6    SPLSPTNKWWAEGTTAVVTGANKGIGFAVVKRLLQLGLTVVLTARNT  52



>gb|EMT28204.1| (+)-neomenthol dehydrogenase [Aegilops tauschii]
Length=292

 Score =   134 bits (337),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F RLDV+D  S+A FASW R     LDILVNNA VSFN++D NSVEHAETV+ TN+YG K
Sbjct  73   FRRLDVTDPASVAAFASWIRDHVGGLDILVNNAGVSFNEIDTNSVEHAETVLKTNFYGAK  132

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            +LI ALLP+FR SS T+RILN+SS+LG  NK+++P LR
Sbjct  133  MLIEALLPLFRRSSGTSRILNLSSQLGLLNKVRDPSLR  170


 Score = 57.8 bits (138),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  80   SSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLT  211
            S  + P   WW+ ETVA+VTGAN+GIG AL  RLAE GL+VVLT
Sbjct  6    SKETPPHKAWWTGETVAVVTGANRGIGHALAARLAEHGLSVVLT  49



>gb|KDP35152.1| hypothetical protein JCGZ_10686 [Jatropha curcas]
Length=311

 Score =   124 bits (310),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V  +RLDVSD  SI  F   F+  F  +DILVNNAAVSFN +  N+V+HAETVI TNYYG
Sbjct  89   VHLYRLDVSDSASIKAFVLQFKKDFGVVDILVNNAAVSFNGIHDNTVDHAETVIKTNYYG  148

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLLI +LLP+FR S+S +RILN+SSRLG  NK++NP ++
Sbjct  149  AKLLIESLLPIFRRSNSISRILNMSSRLGSINKMRNPNMK  188


 Score = 68.2 bits (165),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            +WWS++T+AIVTGANKGIGFALVK+ + LGLTV+LTAR  ++  +
Sbjct  29   QWWSKDTIAIVTGANKGIGFALVKQFSGLGLTVILTARDVEKGYK  73



>ref|XP_010413652.1| PREDICTED: salutaridine reductase-like isoform X2 [Camelina sativa]
Length=281

 Score =   124 bits (310),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LD+SD  SIA F SWFR     LDILVNNA VSFN V +NS++  ET+I TN+YG
Sbjct  58   VHFCSLDISDPSSIAAFVSWFRRNLGVLDILVNNAGVSFNAVGENSIKQPETIIKTNFYG  117

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLP+FR S S +RILNISSRLG  NKL++P +R
Sbjct  118  AKLLTEALLPLFRRSESVSRILNISSRLGTLNKLRSPIIR  157


 Score = 68.2 bits (165),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            WWSE T A+VTGANKGIGFA+VKRL ELGLTVVLT+R T
Sbjct  2    WWSEGTTAVVTGANKGIGFAVVKRLLELGLTVVLTSRNT  40



>ref|XP_002454149.1| hypothetical protein SORBIDRAFT_04g025500 [Sorghum bicolor]
 gb|EES07125.1| hypothetical protein SORBIDRAFT_04g025500 [Sorghum bicolor]
Length=310

 Score =   133 bits (335),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDV+D  S+A FASW R     LDILVNNA VSFN++D NSVEHAETV+ TN+YG
Sbjct  88   VRFRRLDVADPASVAAFASWVRDELGGLDILVNNAGVSFNEMDTNSVEHAETVLRTNFYG  147

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             K+L  ALLP+FR S +T+RILNISS+LG  NK+++P+LR
Sbjct  148  AKMLTEALLPLFRRSPTTSRILNISSQLGLLNKVKDPQLR  187


 Score = 58.5 bits (140),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WW+ ETVA+VTGAN+GIG AL  RLAE GL VV+TAR
Sbjct  30   WWTGETVAVVTGANRGIGHALAARLAEQGLCVVVTAR  66



>ref|NP_001169234.1| hypothetical protein [Zea mays]
 gb|ACN32042.1| unknown [Zea mays]
 tpg|DAA37135.1| TPA: hypothetical protein ZEAMMB73_820599 [Zea mays]
Length=176

 Score =   126 bits (316),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDVSD  S+A+FA+W R     LDILVNNAAVSFN++D NSVEHAE V+ TN+YG
Sbjct  70   VVFRRLDVSDPASVAEFAAWIRDALGGLDILVNNAAVSFNEIDTNSVEHAEAVLRTNFYG  129

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFN  546
             K+L  ALLP+FR SS+T+RILN+SS+LG  N
Sbjct  130  AKMLTEALLPLFRQSSATSRILNVSSQLGLLN  161


 Score = 65.5 bits (158),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  89   SLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            S P   WWS ETVA+VTGAN+GIG AL  RLAE GLTVVLTAR
Sbjct  9    SPPAGAWWSRETVAVVTGANRGIGHALAARLAEHGLTVVLTAR  51



>ref|XP_009341578.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri]
Length=292

 Score =   120 bits (302),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 1/99 (1%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F  LDVSD  SI  F   F+ +++ LDILVNNAAVSF+D+++NS+EHAETV+ TN+YGPK
Sbjct  68   FSCLDVSDPSSIKSFTLRFKKSYAVLDILVNNAAVSFSDINENSLEHAETVMKTNFYGPK  127

Query  457  LLIAALLPMF-RCSSSTARILNISSRLGQFNKLQNPKLR  570
            LL  ALLPMF   +SS  RILN+SSRLG  NKL+NP  +
Sbjct  128  LLTDALLPMFLHSTSSIGRILNVSSRLGSLNKLRNPSTK  166


 Score = 70.5 bits (171),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 6/53 (11%)
 Frame = +2

Query  98   KTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ------EALR  238
            + RWWSE+TV IVTGANKGIGFA+VK +AELG+TV+LTAR  +      EALR
Sbjct  7    RRRWWSEDTVVIVTGANKGIGFAVVKWMAELGVTVILTARDKERGCKAVEALR  59



>gb|AAV64232.1| unknown [Zea mays]
Length=309

 Score =   125 bits (315),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F RLDVSD  S+A+FA+W R     LDILVNNAAVSFN++D NSVEHAE V+ TN+YG K
Sbjct  72   FRRLDVSDPASVAEFAAWIRDALGGLDILVNNAAVSFNEIDTNSVEHAEAVLRTNFYGAK  131

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFN  546
            +L  ALLP+FR SS+T+RILN+SS+LG  N
Sbjct  132  MLTEALLPLFRQSSATSRILNVSSQLGLLN  161


 Score = 64.3 bits (155),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  80   SSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            +  S P   WWS ETVA+VTGAN+GIG AL  RLAE GLTVVLTAR
Sbjct  6    TKESPPAGAWWSRETVAVVTGANRGIGHALAARLAEHGLTVVLTAR  51



>ref|NP_191530.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 emb|CAB75468.1| putative protein [Arabidopsis thaliana]
 gb|AEE79958.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=302

 Score =   118 bits (296),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +1

Query  286  LDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKLLI  465
            LD+SD  SIA FASWF      LDILVNNAAVSFN V +N ++  ET+I TN+YG KLL 
Sbjct  85   LDISDPSSIAAFASWFGRNLGILDILVNNAAVSFNAVGENLIKEPETIIKTNFYGAKLLT  144

Query  466  AALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             ALLP+FR S S +RILN+SSRLG  NKL++P +R
Sbjct  145  EALLPLFRRSVSVSRILNMSSRLGTLNKLRSPSIR  179


 Score = 71.2 bits (173),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
             WWSEET A+VTGANKGIGFA+VKRL ELGLTVVLTAR  +  
Sbjct  23   EWWSEETTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENG  65



>ref|XP_009415037.1| PREDICTED: (+)-neomenthol dehydrogenase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   112 bits (280),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDV+   SI  FA+W    F  LDIL+NNAAVSFN++D NSVEHAETVI TN+YG
Sbjct  72   VAFCHLDVAVPSSIVTFAAWLERRFGGLDILINNAAVSFNEIDTNSVEHAETVIRTNFYG  131

Query  451  PKLLIAALLPMFRCS-SSTARILNISSRLGQFNKLQN  558
             K+LI +LLP+FR S ++++RILNISS+LG  N+  N
Sbjct  132  SKMLIESLLPLFRRSIATSSRILNISSQLGLLNQAVN  168


 Score = 77.4 bits (189),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            TRWWS+ETVA+VTGANKGIGFALVKRLAELGLTVVLT+R
Sbjct  15   TRWWSKETVAVVTGANKGIGFALVKRLAELGLTVVLTSR  53



>ref|XP_006292992.1| hypothetical protein CARUB_v10019270mg, partial [Capsella rubella]
 gb|EOA25890.1| hypothetical protein CARUB_v10019270mg, partial [Capsella rubella]
Length=284

 Score =   120 bits (301),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LD+SD  SIA FAS FR  F  LDILVNNAAVSFN V +N ++  ET+I TN+YG
Sbjct  61   VHFCCLDISDPSSIATFASSFRRNFGVLDILVNNAAVSFNAVGENLIKQPETIIKTNFYG  120

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  ALLP+FR S S +RILNISSRLG  NKL++P +R
Sbjct  121  AKLLTEALLPLFRRSDSVSRILNISSRLGTLNKLRSPSIR  160


 Score = 68.9 bits (167),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
            WWSE T A+VTGANKGIGFA+VKRL ELGLTVVLTAR  +  
Sbjct  5    WWSEGTTAVVTGANKGIGFAVVKRLLELGLTVVLTARNAENG  46



>gb|KJB71627.1| hypothetical protein B456_011G134500 [Gossypium raimondii]
Length=323

 Score =   118 bits (296),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVS   SI  F SW   TF  LDILVNNA VSFND+ +NSVE AETVI TN++G
Sbjct  79   VRFFALDVSKAASIKTFVSWVETTFGGLDILVNNAGVSFNDIHENSVEFAETVIKTNFHG  138

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFN  546
            PKLL  +LLP+FR S S +RILNISSRLG  N
Sbjct  139  PKLLTESLLPLFRLSPSISRILNISSRLGSIN  170


 Score = 69.7 bits (169),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
             RWWS +TVA+VTGANKGIG A+VKR AELGLTVVLTAR  +   +
Sbjct  21   NRWWSGDTVAVVTGANKGIGLAVVKRFAELGLTVVLTARDEERGKK  66



>ref|XP_010101370.1| (+)-neomenthol dehydrogenase [Morus notabilis]
 gb|EXB88317.1| (+)-neomenthol dehydrogenase [Morus notabilis]
Length=306

 Score =   108 bits (271),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDVSD  SI  F SWF   F ALDIL+NNA +S+N++ +NSV+ AE V+ TN++G
Sbjct  81   VHFFRLDVSDPASIQAFVSWFSQNFPALDILINNAGISYNEIGENSVKQAERVMKTNFFG  140

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             KLL  +LLP FR SSS++R+LNI+SRLG  +K++NP ++
Sbjct  141  AKLLTQSLLPFFRRSSSSSRLLNITSRLGSLDKMRNPSIK  180


 Score = 78.6 bits (192),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  80   SSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            S P    TRWWS+ETVAIVTGANKGIGFALVKRLAE+GLT++LTAR
Sbjct  17   SDPFQSPTRWWSKETVAIVTGANKGIGFALVKRLAEIGLTLILTAR  62



>ref|XP_008678779.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Zea 
mays]
 gb|AFW62898.1| hypothetical protein ZEAMMB73_833592 [Zea mays]
Length=316

 Score =   130 bits (326),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDV+D  SIA FASW R     LDILVNNAAVSFN++D NSVEHAETV+ TN+YG
Sbjct  93   VRFRRLDVADPASIAAFASWLRDELGGLDILVNNAAVSFNEMDTNSVEHAETVLRTNFYG  152

Query  451  PKLLIAALLPMFRCSSST-ARILNISSRLGQFNKLQNPKLR  570
             K+L  ALLP+FR S +T +RILN+SS+LG  NK+++P+LR
Sbjct  153  AKMLTEALLPLFRRSPATSSRILNVSSQLGLLNKVKDPQLR  193


 Score = 55.1 bits (131),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WW+ +TVA+VTGAN+GIG AL   LAE GL VV+TAR
Sbjct  34   WWTGDTVAVVTGANRGIGHALAAHLAEQGLCVVVTAR  70



>ref|XP_008678780.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Zea 
mays]
Length=315

 Score =   130 bits (326),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F RLDV+D  SIA FASW R     LDILVNNAAVSFN++D NSVEHAETV+ TN+YG
Sbjct  92   VRFRRLDVADPASIAAFASWLRDELGGLDILVNNAAVSFNEMDTNSVEHAETVLRTNFYG  151

Query  451  PKLLIAALLPMFRCSSST-ARILNISSRLGQFNKLQNPKLR  570
             K+L  ALLP+FR S +T +RILN+SS+LG  NK+++P+LR
Sbjct  152  AKMLTEALLPLFRRSPATSSRILNVSSQLGLLNKVKDPQLR  192


 Score = 54.7 bits (130),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WW+ +TVA+VTGAN+GIG AL   LAE GL VV+TAR
Sbjct  33   WWTGDTVAVVTGANRGIGHALAAHLAEQGLCVVVTAR  69



>ref|XP_006653560.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Oryza brachyantha]
Length=294

 Score =   128 bits (321),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            F RLDV+D  S+  FA+W R     LDILVNNAAVSFN++D NSVEHAE+V+ TN+YG K
Sbjct  72   FRRLDVADPDSVRAFAAWLRDAVGGLDILVNNAAVSFNEIDTNSVEHAESVLRTNFYGAK  131

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            +L  ALLP+FR S +T+RILNISS+LG  NK+ +P+L+
Sbjct  132  MLTEALLPLFRRSPATSRILNISSQLGLLNKVSDPELK  169


 Score = 53.9 bits (128),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  80   SSPSLPKTR-WWSEETVAIVTGANKGIGFALVKRLAELGL  196
             S  LP  R WWS ETVA+VTGAN+GIG AL  RLAE GL
Sbjct  5    GSKELPSARAWWSRETVAVVTGANRGIGHALAARLAEHGL  44



>ref|XP_010683956.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Beta vulgaris subsp. 
vulgaris]
Length=314

 Score =   114 bits (284),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LD+ D  SI +F  W + T   LDILVNNA V+FN   +NSVEHAE VI TNYYG
Sbjct  88   VEFHQLDIVDPQSIENFTEWIQETHGGLDILVNNAGVNFNVGSENSVEHAEQVIRTNYYG  147

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K +I A++P+ R S+S ARI+NISSRLG+ N  +N
Sbjct  148  TKNVIEAMIPLMRPSASGARIVNISSRLGRLNGKKN  183


 Score = 60.8 bits (146),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ  226
            P     RWW+ ET+A+VTG N+GIGF + K+LA  G+TVVLT+R T+
Sbjct  26   PYSDHRRWWTAETIAVVTGGNRGIGFEITKQLANHGMTVVLTSRDTE  72



>ref|XP_010523410.1| PREDICTED: (+)-neomenthol dehydrogenase [Tarenaya hassleriana]
Length=314

 Score =   110 bits (274),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LDV+D  SI +F  W + TF  LD+LVNNA V++N    NSVE A+TV+ATNYYG
Sbjct  87   VEFHQLDVTDSSSIREFGQWIKETFGGLDVLVNNAGVNYNLGSDNSVEFAQTVVATNYYG  146

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K +  A++P+ R S    RI+N+SSRLG+ N  +N
Sbjct  147  TKNMTEAMIPLMRLSRQGTRIVNVSSRLGRLNGRRN  182


 Score = 63.5 bits (153),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P   + RWWS E +A+VTGAN+GIGF + ++LA  GLTVVLTAR  +  L
Sbjct  25   PYSDQQRWWSSENIAVVTGANRGIGFEIARQLAGQGLTVVLTARNAETGL  74



>ref|XP_010695747.1| PREDICTED: carbonyl reductase [NADPH] 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010695748.1| PREDICTED: carbonyl reductase [NADPH] 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010695749.1| PREDICTED: carbonyl reductase [NADPH] 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=315

 Score =   111 bits (277),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LD+ D  SI +FA W + T   LDIL+NNA V+FN   +NSVE+AE VI TNYYG
Sbjct  89   VEFHQLDIVDPQSIKEFADWIQVTHGGLDILINNAGVNFNVGSENSVEYAEQVIKTNYYG  148

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K LI A++P+ + S S ARI+N++SRLG+ N  +N
Sbjct  149  TKNLIEAMIPLMKPSPSGARIVNVTSRLGRLNGRRN  184


 Score = 60.8 bits (146),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS ET+A+VTG N+GIGF ++++LA  G+TVVLT+R
Sbjct  27   PYSNNQRWWSSETIAVVTGGNRGIGFEIIRQLASHGMTVVLTSR  70



>ref|XP_002511075.1| carbonyl reductase, putative [Ricinus communis]
 gb|EEF51677.1| carbonyl reductase, putative [Ricinus communis]
Length=315

 Score =   107 bits (267),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+SD  SI  FA W + T+  LDILVNNA V++N   +NSVE A  VI TNYYG K
Sbjct  91   FHQLDISDSSSIKHFADWIQQTYGGLDILVNNAGVNYNVGSENSVEFARNVIDTNYYGTK  150

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             LI A++P+ R S++  RI+++SSRLG+ N  +N
Sbjct  151  NLIKAMIPLMRHSAAGGRIVSVSSRLGRLNGRRN  184


 Score = 64.7 bits (156),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS+ET+A+VTG N+GIGF +V++LA  GLTVVLT+R +   L
Sbjct  27   PYSDHQRWWSQETIAVVTGGNRGIGFEIVRQLANHGLTVVLTSRASGAGL  76



>gb|EPS58596.1| hypothetical protein M569_16215, partial [Genlisea aurea]
Length=306

 Score =   111 bits (278),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 73/102 (72%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ DR SI  FA W R T+  +DIL+NNA V+FN    N+VEH+E VI TNY+G K
Sbjct  82   FHQLDIVDRDSIEAFAGWIRETYGGIDILINNAGVNFNTGSDNNVEHSEKVIHTNYFGTK  141

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R S + ARI+++SSRLG+     NK++N +LR
Sbjct  142  NIIKAMIPLMRPSDAGARIVSVSSRLGRLNGKRNKIENLELR  183


 Score = 60.1 bits (144),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR---VTQEALRL  241
            P     RWW+ +T+A+VTGAN+GIGF +V +LA  GLTV+LT+R   V +EA ++
Sbjct  18   PYSDHQRWWTSDTIAVVTGANRGIGFEIVHQLAHHGLTVILTSREAAVGEEAAKV  72



>ref|XP_006664903.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Oryza brachyantha]
Length=264

 Score =   112 bits (279),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +1

Query  331  FRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTAR  510
             R  F  LDILVNNAAVSFN++D NSVE+AETV+ TN+YG K+LI ALLP+FR S++++R
Sbjct  60   LRDEFGGLDILVNNAAVSFNEIDTNSVENAETVLRTNFYGAKMLIEALLPLFRRSAASSR  119

Query  511  ILNISSRLGQFNKLQNPKLR  570
            ILNISS+LG  NK+++P LR
Sbjct  120  ILNISSQLGLLNKVRDPSLR  139


 Score = 59.3 bits (142),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WW+ ETVA+VTGAN+GIG ALV RLAE  L+VVLTAR
Sbjct  19   WWTGETVAVVTGANRGIGHALVTRLAEQALSVVLTAR  55



>ref|XP_006394464.1| hypothetical protein EUTSA_v10004629mg [Eutrema salsugineum]
 gb|ESQ31750.1| hypothetical protein EUTSA_v10004629mg [Eutrema salsugineum]
Length=315

 Score =   109 bits (273),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 71/102 (70%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDVSD  SI +FA W + TF  LDILVNNA V++N    NSVE AETVI+ NY G K
Sbjct  90   FHQLDVSDSSSIKEFACWIKQTFGGLDILVNNAGVNYNLGSDNSVEFAETVISINYQGTK  149

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R S   ARI+N+SSRLG+     N+L N +LR
Sbjct  150  NMIKAMIPLMRPSPQGARIVNVSSRLGRVNGRRNRLANVELR  191


 Score = 61.2 bits (147),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P   + RWWS E VA+VTG+N+GIGF + ++LA  GLTVVLTAR     L
Sbjct  25   PYSDRQRWWSCENVAVVTGSNRGIGFEIARQLASHGLTVVLTARNVDAGL  74



>ref|XP_011043014.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Populus euphratica]
Length=313

 Score =   107 bits (268),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 71/102 (70%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDV D  SI  FA W   T+  +D+LVNNA V++N    NSVEHA+ V+ATNYYG K
Sbjct  89   FHQLDVLDSLSIKKFAEWIEQTYGGIDVLVNNAGVNYNLGSDNSVEHAQNVVATNYYGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +  +L+P+ R S++ ARI+N+SSRLG+     N+L++  LR
Sbjct  149  NVTQSLIPLMRPSAAGARIVNVSSRLGRLNGRRNRLEDKDLR  190


 Score = 62.4 bits (150),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS ETVA+VTG N+GIGF + ++LA+ GLTV+LT+R +   L
Sbjct  25   PYSDHQRWWSSETVAVVTGGNRGIGFEIARQLADHGLTVILTSRESSTGL  74



>ref|XP_002318788.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEE97008.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=313

 Score =   106 bits (264),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDV D  SI  FA W   T+  +D+LVNNA V++N    NSVEHA+ V+ATNYYG K
Sbjct  89   FHQLDVLDSLSIKKFAEWIEQTYGGIDVLVNNAGVNYNLGSDNSVEHAQNVVATNYYGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +  +L+P+ R S+  ARI+N+SSRLG+     N+L++  LR
Sbjct  149  NVTQSLIPLMRPSAVGARIVNVSSRLGRLNGRRNRLEDKDLR  190


 Score = 62.4 bits (150),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS ETVA+VTG N+GIGF + ++LA+ GLTV+LT+R +   L
Sbjct  25   PYSDHQRWWSSETVAVVTGGNRGIGFEIARQLADHGLTVILTSRESSTGL  74



>ref|XP_011082831.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Sesamum indicum]
Length=313

 Score =   109 bits (272),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI  F+ W + T+  +DI+VNNA V+FN    NSVE AE VIATNYYG K
Sbjct  89   FHQLDIVDPSSIEAFSKWIKETYGGIDIVVNNAGVNFNAGSDNSVEFAEKVIATNYYGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I A++P+ R S S ARI+N+SSRLG+ N  +N
Sbjct  149  NMIKAMIPLMRPSDSGARIVNVSSRLGRLNGRRN  182


 Score = 59.3 bits (142),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            P     RWW+ +TVA+VTGAN+GIGF +  +LA  GLTV+LT+RVT
Sbjct  25   PYSDHERWWTSDTVAVVTGANRGIGFEIAHQLAFHGLTVILTSRVT  70



>ref|XP_009607625.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Nicotiana tomentosiformis]
Length=314

 Score =   108 bits (269),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  S+  F+ W + T+  LDIL+NNA VSFN   +NS+EHAETVI TNY+G K
Sbjct  90   FHQLDIVDHASVEAFSDWIKETYGGLDILINNAGVSFNVGTENSMEHAETVIQTNYFGTK  149

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +  A++P+ R S S  RI+++SSRLG+ N  +N
Sbjct  150  NMTKAMIPLMRPSPSGGRIVSVSSRLGRLNGKKN  183


 Score = 60.1 bits (144),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR---VTQEALRL  241
            P     +WWS +TVA+VTGAN+GIGF +  +LA  GLTVVLT+R   V +EA+++
Sbjct  26   PYSDHRKWWSSDTVAVVTGANRGIGFEIAHQLASHGLTVVLTSRETGVGEEAVKV  80



>ref|XP_011465268.1| PREDICTED: carbonyl reductase [NADPH] 1 [Fragaria vesca subsp. 
vesca]
Length=316

 Score =   108 bits (270),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V+FH+LDV D+ SI +F  W    +  LDILVNNAAV+FN    NSVEHA  V  TNYYG
Sbjct  90   VYFHQLDVLDQVSIKEFCDWLVENYGGLDILVNNAAVNFNQGSDNSVEHAAQVCTTNYYG  149

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K +I AL+P+ + SS+  RI+N+SSRLG+ N  +N
Sbjct  150  TKNMIQALIPLMKHSSAGGRIVNVSSRLGRLNGKRN  185


 Score = 59.3 bits (142),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS ET+A+VTG N+GIGF + ++LA  GLTV+LT+R
Sbjct  28   PYSDHQRWWSAETIAVVTGGNRGIGFEITRQLAAHGLTVILTSR  71



>gb|KCW48503.1| hypothetical protein EUGRSUZ_K02188 [Eucalyptus grandis]
Length=300

 Score =   100 bits (250),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI  F  W R T+  + +LVNNA V+FN    NSVE A  V+ATNYYG K
Sbjct  76   FHQLDILDPSSIQLFVDWIRQTYEGIHVLVNNAGVNFNVGSDNSVESAHMVVATNYYGTK  135

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I A++P+ R S+  ARI+N+SSRLG+ N  +N
Sbjct  136  NMIKAMIPLMRPSAVGARIVNVSSRLGKLNGRRN  169


 Score = 67.0 bits (162),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 3/54 (6%)
 Frame = +2

Query  89   SLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR---VTQEALRL  241
            S P+ +WWS+ETVA+VTG+N+GIGF + ++LA  GLTVVLT+R   V QEA R+
Sbjct  13   SKPQRKWWSKETVAVVTGSNRGIGFEIARQLAAHGLTVVLTSRDECVGQEATRV  66



>ref|XP_011073283.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Sesamum indicum]
Length=313

 Score =   106 bits (265),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI  F  W +  +  +DIL+NNA V++N   +NSVE+AE VIATNYYG K
Sbjct  89   FHQLDIVDPSSIEAFTEWIKENYGGIDILINNAGVNYNAGSENSVENAEKVIATNYYGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R S + ARI+N+SS+LG+     N+++N ++R
Sbjct  149  NMIKAMIPLMRPSDAGARIVNVSSKLGRLNGRRNRIENDEVR  190


 Score = 60.5 bits (145),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            P     RWW+ ET+A+VTGAN+GIGF +V +LA  GLTVVLT+R T
Sbjct  25   PYSDHQRWWTSETIAVVTGANRGIGFEIVHQLALHGLTVVLTSRDT  70



>ref|XP_009786124.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Nicotiana sylvestris]
Length=314

 Score =   107 bits (266),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  S+  F+ W + T+  LDIL+NNA VSFN   +NS+EHAETVI TNY+G K
Sbjct  90   FHQLDIVDHASVEAFSDWIKETYGGLDILINNAGVSFNVGTENSMEHAETVIQTNYFGTK  149

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +  A++P+ R S S  RI+++SSRLG+ N  +N
Sbjct  150  NMTNAMIPLMRPSPSGGRIVSVSSRLGRLNGKKN  183


 Score = 59.7 bits (143),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR---VTQEALRL  241
            P     +WWS +TVA+VTGAN+GIGF +  +LA  GLTVVLT+R   V +EA+++
Sbjct  26   PYSDHRKWWSSDTVAVVTGANRGIGFEISHQLASHGLTVVLTSRETGVGEEAVKV  80



>gb|KHG28129.1| (+)-neomenthol dehydrogenase [Gossypium arboreum]
Length=287

 Score = 99.8 bits (247),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 71/101 (70%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+    SI++F  W +  +  +DILVNNA V++N V  NS+E+A+ +I TNY+G K 
Sbjct  91   HQLDILHEESISEFTKWIKEKYDGVDILVNNAGVNYNLVSGNSMEYAKQMIETNYFGTKN  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQFN----KLQNPKLR  570
            +I A++P+ R S++ ARI+N+SSRLG+ N    ++++  LR
Sbjct  151  MIKAMIPLMRPSAAGARIVNVSSRLGKLNGRRSRIEDEALR  191


 Score = 66.2 bits (160),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            P     RWWSEET+AIVTGAN+GIGF + K+LA  GLTV+LT+R T
Sbjct  26   PYSDHQRWWSEETIAIVTGANRGIGFEIAKQLAGHGLTVILTSRDT  71



>ref|NP_200991.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AAY27052.1| At5g61830 [Arabidopsis thaliana]
 gb|AED97523.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=316

 Score =   107 bits (267),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 72/104 (69%), Gaps = 4/104 (4%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V+FH+LDV+D  SI +F  W + TF  LDILVNNA V++N    N+VE AETVI+TNY G
Sbjct  89   VYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQG  148

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             K +  A++P+ R S   AR++N+SSRLG+     N+L N +LR
Sbjct  149  TKNMTKAMIPLMRPSPHGARVVNVSSRLGRVNGRRNRLANVELR  192


 Score = 58.2 bits (139),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            RWWS E VA+VTG+N+GIGF + ++LA  GLTVVLTAR     L
Sbjct  31   RWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGL  74



>ref|XP_010457835.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Camelina sativa]
Length=316

 Score =   108 bits (269),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 71/102 (70%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDV+D  SI +F  W + TF  LDILVNNA V++N    NSVE AETVI+TNY G K
Sbjct  91   FHQLDVTDTSSIREFGCWIKQTFGGLDILVNNAGVNYNLGSDNSVEFAETVISTNYLGTK  150

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R S   ARI+N+SSRLG+     N+L N +LR
Sbjct  151  NMIKAMIPLMRPSPHGARIVNVSSRLGRVNGRRNRLANVELR  192


 Score = 57.0 bits (136),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS E VA+VTG+N+GIG  + ++LA  GLTVVLTAR     L
Sbjct  25   PYSDHNRWWSCENVAVVTGSNRGIGLEIARQLAGHGLTVVLTARNVDAGL  74



>ref|XP_002322311.2| hypothetical protein POPTR_0015s11980g [Populus trichocarpa]
 gb|EEF06438.2| hypothetical protein POPTR_0015s11980g [Populus trichocarpa]
Length=313

 Score =   103 bits (258),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDV D  SI  FA W + T+  LD+LVNNA V++N    NSVE+A+ V+ TNYYG K
Sbjct  89   FHQLDVLDSLSIKTFAEWIQQTYGGLDVLVNNAGVNYNMGSDNSVENAKNVVDTNYYGIK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +  AL+P+ R SS  ARI+N+SSRLG+     N+L++  LR
Sbjct  149  NVTEALIPLMRPSSVGARIVNVSSRLGRLNGKRNRLEDKDLR  190


 Score = 61.2 bits (147),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS ETVA+VTG N+GIGF + ++LA+ GL+V+LT+R +   L
Sbjct  25   PYSDHQRWWSSETVAVVTGGNRGIGFEIARQLADHGLSVILTSRESSAGL  74



>ref|XP_007159946.1| hypothetical protein PHAVU_002G280700g [Phaseolus vulgaris]
 gb|ESW31940.1| hypothetical protein PHAVU_002G280700g [Phaseolus vulgaris]
Length=314

 Score =   104 bits (259),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI +F  W +  +  LDIL+NNA V+FN    NSVEHA  VI TNY+G K 
Sbjct  91   HQLDILDTSSINEFCDWLKENYGGLDILINNAGVNFNFGSNNSVEHASLVIETNYFGTKR  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + SS+  RI+N+SSRLG+     N+L+N +LR
Sbjct  151  MIEAMIPLMKPSSAGGRIVNVSSRLGRLNGKRNRLENEELR  191


 Score = 60.5 bits (145),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ET+A+VTG N+GIGF + ++LA+ G+TV+LT+R
Sbjct  25   PYADHQRWWSKETIAVVTGGNRGIGFEISRQLADHGVTVILTSR  68



>gb|ABK23981.1| unknown [Picea sitchensis]
Length=275

 Score =   107 bits (266),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  S+A F+ W    +  +DILVNNA V+FN    NSVE+AETVI TNYYG K
Sbjct  89   FHQLDIVDPKSVALFSKWIGEQYGGIDILVNNAGVNFNTGSSNSVEYAETVIQTNYYGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +   +LP+ + SS++AR+LN+SSRLG+ N   N
Sbjct  149  RMTEYMLPLMKPSSASARVLNVSSRLGRLNGRHN  182


 Score = 58.2 bits (139),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 38/47 (81%), Gaps = 4/47 (9%)
 Frame = +2

Query  77   YSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            YS P+    RWWS +T+A+VTG++KGIG  +V++LA+ GLT+VLT+R
Sbjct  26   YSGPN----RWWSTDTLAVVTGSSKGIGLEIVQQLAKQGLTIVLTSR  68



>ref|XP_006402033.1| hypothetical protein EUTSA_v10014119mg [Eutrema salsugineum]
 gb|ESQ43486.1| hypothetical protein EUTSA_v10014119mg [Eutrema salsugineum]
Length=322

 Score =   102 bits (254),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 73/102 (72%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI +F +W +  + ++D+L+NNA V++N   +NSVE++  VI+TNYYG K
Sbjct  98   FHRLDILDSSSIQEFCNWVKEKYGSIDVLINNAGVNYNIGTENSVEYSHMVISTNYYGTK  157

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R +S  ARI+N++SRLG+     +KL+N  +R
Sbjct  158  NIIRAMIPLMRHASQGARIVNVTSRLGRLKGRHSKLENEAVR  199


 Score = 62.4 bits (150),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +V++LA  GLTV+LT+R
Sbjct  34   PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSR  77



>ref|XP_003532306.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
Length=314

 Score =   103 bits (258),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI  F  W +  +  LDILVNNA V+FN    NSVE+A+ VI TNYYG K 
Sbjct  91   HQLDILDTSSINQFCEWLKENYGGLDILVNNAGVNFNFGSDNSVENAKLVIETNYYGTKR  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + SS+  RI+N+SSRLG+     N+L+N  LR
Sbjct  151  MIQAMIPLMKSSSAGGRIVNVSSRLGRLNGKRNRLENEALR  191


 Score = 60.8 bits (146),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ET+A+VTG N+GIGF + ++LA+ G+TV+LT+R
Sbjct  25   PYADHQRWWSKETIAVVTGGNRGIGFEISRQLADHGVTVILTSR  68



>ref|XP_007038173.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY22674.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=314

 Score =   102 bits (253),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LDV D  SI++F  W +  +  +DILVNNA V++N    NSV+ A+ V+ TNYYG K 
Sbjct  91   HQLDVLDGESISEFTEWIKEKYGGIDILVNNAGVNYNLGSDNSVQFAQQVVDTNYYGTKN  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ R S++ ARI+N+SSRLG+     N++Q+  LR
Sbjct  151  MIKAMIPLMRPSAAGARIVNVSSRLGKLNGRRNRIQDANLR  191


 Score = 62.8 bits (151),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            P     RWWS+ET+A+VTGAN+GIGF + ++LA  GLTV+LT+R T
Sbjct  26   PYSDHQRWWSQETIAVVTGANRGIGFEIARQLAGHGLTVILTSRDT  71



>gb|KFK27919.1| hypothetical protein AALP_AA8G447200 [Arabis alpina]
Length=302

 Score =   106 bits (265),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 73/104 (70%), Gaps = 4/104 (4%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LDV+D  SI +F  W + TF  LDILVNNA V++N    NSVE A+TV++TNY+G
Sbjct  75   VEFHQLDVTDSSSIREFGCWIKQTFGRLDILVNNAGVNYNLGSDNSVEFAKTVVSTNYHG  134

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             K +I A++P+ R S   ARI+N+SSRLG+     N+L N +LR
Sbjct  135  TKNMIKAMIPLMRESPHGARIVNVSSRLGRVNGRRNRLANIELR  178


 Score = 57.8 bits (138),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS E VA+VTG+N+GIG  + ++LA  GLTVVLTAR     L
Sbjct  11   PYSDHQRWWSSENVAVVTGSNRGIGLEIARQLAVHGLTVVLTARNVDAGL  60



>gb|KJB19743.1| hypothetical protein B456_003G117400 [Gossypium raimondii]
Length=314

 Score = 99.4 bits (246),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 71/101 (70%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+    SI++F  W +  +  +DILVNNA V++N V  NS+E+A+ +I TNY+G K 
Sbjct  91   HQLDILHEESISEFTKWIKEKYDGVDILVNNAGVNYNLVSGNSMEYAKQMIETNYFGTKN  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQFN----KLQNPKLR  570
            +I A++P+ R S++ ARI+N+SSRLG+ N    ++++  LR
Sbjct  151  MIKAMIPLMRPSAAGARIVNVSSRLGKLNGRRSRIEDEALR  191


 Score = 65.1 bits (157),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            P     RWWSEET+A+VTGAN+GIGF + K+LA  GLTV+LT+R T
Sbjct  26   PYSDHQRWWSEETIAVVTGANRGIGFEIAKQLAGHGLTVILTSRDT  71



>ref|XP_004503819.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Cicer arietinum]
Length=313

 Score =   103 bits (258),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LDV D  SI+ F+ W +  +  L+ILVNNA V+FN    NSVE+A+ VI TNYYG K 
Sbjct  90   HQLDVLDSSSISQFSEWLKENYGGLNILVNNAGVNFNFGSDNSVENAQQVIETNYYGTKR  149

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S++  RI+N+SSRLG+     N+L+N  LR
Sbjct  150  MIEAMIPLMKASTAGGRIVNVSSRLGRLNGKRNRLENDALR  190


 Score = 60.5 bits (145),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ET+A+VTG N+GIGF + ++LA+ G+TV+LT+R
Sbjct  25   PYSDHQRWWSKETIAVVTGGNRGIGFEISRQLADHGVTVILTSR  68



>ref|XP_010039000.1| PREDICTED: carbonyl reductase [NADPH] 1, partial [Eucalyptus 
grandis]
Length=293

 Score =   100 bits (249),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI  F  W R T+  + +LVNNA V+FN    NSVE A  V+ATNYYG K
Sbjct  69   FHQLDILDPSSIQLFVDWIRQTYEGIHVLVNNAGVNFNVGSDNSVESAHMVVATNYYGTK  128

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I A++P+ R S+  ARI+N+SSRLG+ N  +N
Sbjct  129  NMIKAMIPLMRPSAVGARIVNVSSRLGKLNGRRN  162


 Score = 63.9 bits (154),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR---VTQEALRL  241
            RWWS+ETVA+VTG+N+GIGF + ++LA  GLTVVLT+R   V QEA R+
Sbjct  11   RWWSKETVAVVTGSNRGIGFEIARQLAAHGLTVVLTSRDECVGQEATRV  59



>emb|CDY53157.1| BnaCnng24570D [Brassica napus]
Length=316

 Score =   110 bits (276),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDV+D  SI +F  W + TF  LDILVNNA V++N    NSVE AETV++TNY+G K
Sbjct  91   FHQLDVTDASSIKEFGRWIKQTFGGLDILVNNAGVNYNLGSDNSVEFAETVVSTNYHGTK  150

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R S   ARI+N+SSRLG+     N+L N +LR
Sbjct  151  NMIKAMIPLMRPSPQGARIVNVSSRLGRVYGRRNRLANVELR  192


 Score = 53.5 bits (127),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +2

Query  86   PSLPKTRWWSEETV-AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS E V A+VTG+N+GIG  + ++LA  GLTVVLTAR     L
Sbjct  25   PYSGHQRWWSSENVVAVVTGSNRGIGLEIARQLASHGLTVVLTARNVDAGL  75



>ref|XP_008356810.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Malus domestica]
Length=316

 Score =   103 bits (257),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V+ H+LDV D  SI +F  W +  +  LDIL+NNAAV+FN    N+VE+A  VI TNYYG
Sbjct  90   VFCHQLDVLDMASIIEFCDWLKENYGGLDILINNAAVNFNQGSDNTVEYASQVITTNYYG  149

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNP  561
             K +I A++P+ + S++ ARI+N+SSRLG+ N  +N 
Sbjct  150  TKNMIQAMIPLMKPSAAGARIVNVSSRLGRINGRRNK  186


 Score = 60.5 bits (145),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS ETVA+VTG N+GIGF L K+LA  G+TV+LT+R
Sbjct  28   PYSDHQRWWSAETVAVVTGGNRGIGFELSKQLAAHGVTVILTSR  71



>ref|XP_007153415.1| hypothetical protein PHAVU_003G033300g [Phaseolus vulgaris]
 gb|ESW25409.1| hypothetical protein PHAVU_003G033300g [Phaseolus vulgaris]
Length=313

 Score =   102 bits (254),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            +H+LDV+D  SI  F  W R  +  LDILVNNA V+FN    NSVE+A  VI TNYYG K
Sbjct  89   YHQLDVTDHSSINQFVQWLRENYGGLDILVNNAGVNFNLGSDNSVENAHKVIETNYYGIK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
              I A++P+ + S + ARI+N+SSRLG+ N  +N
Sbjct  149  HTIEAIIPLMKPSLAGARIVNVSSRLGRLNGRRN  182


 Score = 61.2 bits (147),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  56   MASILSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            +  I  Q + P     RWWS+ETVA+VTG N+GIGF + ++LA  GLTV+LT+R
Sbjct  15   LQEIRLQMTIPYSDHQRWWSKETVAVVTGGNRGIGFEICRQLAVHGLTVILTSR  68



>ref|XP_010314437.1| PREDICTED: carbonyl reductase [NADPH] 1 [Solanum lycopersicum]
Length=292

 Score =   101 bits (251),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI  F+ W + T+  LDIL+NNA VSFN   +NS+E+A+TVI TNY G K
Sbjct  68   FHQLDIVDHASIEAFSDWIKETYGGLDILINNAGVSFNVGTENSMENADTVIETNYIGTK  127

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +  A++P+ R S   ARI++++SRLG+     N++ N  LR
Sbjct  128  NMTKAMIPLMRSSPYGARIVSVTSRLGRLHGKKNRITNASLR  169


 Score = 62.8 bits (151),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 3/54 (6%)
 Frame = +2

Query  89   SLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR---VTQEALRL  241
            S   +RWWS ETVA+VTGAN+GIGF +  +LA  GLTVVLT+R   V +EA+++
Sbjct  5    SRGGSRWWSSETVAVVTGANRGIGFEIAHQLASHGLTVVLTSRETGVGEEAVKV  58



>ref|XP_003525167.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
 gb|KHN17451.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=314

 Score =   102 bits (255),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI  F  W +  +  LDILVNNA V+FN    NSVE+++ VI TNYYG K 
Sbjct  91   HQLDILDTSSINQFCEWLKENYGGLDILVNNAGVNFNFGSDNSVENSKLVIETNYYGTKR  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + SS+  RI+N+SSRLG+     N+L+N  LR
Sbjct  151  MIKAMIPLMKSSSAGGRIVNVSSRLGRLNGKRNRLENEALR  191


 Score = 60.8 bits (146),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ET+A+VTG N+GIGF + ++LA+ G+TV+LT+R
Sbjct  25   PYADHQRWWSKETIAVVTGGNRGIGFEISRQLADHGVTVILTSR  68



>ref|XP_002864756.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41015.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=316

 Score =   105 bits (263),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDV D  SI +F  W + TF  LDILVNNA V++N    NSVE AETVI+TNY G K
Sbjct  91   FHQLDVKDSSSIREFGFWIKQTFGGLDILVNNAGVNYNLGSDNSVEFAETVISTNYQGTK  150

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +  A++P+ R S   ARI+N+SSRLG+     N+L N +LR
Sbjct  151  NMTKAMIPLMRPSPHGARIVNVSSRLGRVNGRRNRLANVELR  192


 Score = 57.8 bits (138),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            RWWS E VA+VTG+N+GIG  + ++LA  GLTVVLTAR     L
Sbjct  31   RWWSSENVAVVTGSNRGIGLEIARQLAGHGLTVVLTARNVDAGL  74



>ref|XP_009339019.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri]
Length=316

 Score =   103 bits (258),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V+ H+LDV D  SI +F  W +  +  LDIL+NNAAV+FN    N+VE+A  VI TNYYG
Sbjct  90   VFCHQLDVLDTASITEFCDWLKENYGGLDILINNAAVNFNQGSDNTVEYASQVITTNYYG  149

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNP  561
             K +I A++P+ + S++ ARI+N+SSRLG+ N  +N 
Sbjct  150  TKNMIQAIIPLMKPSAAGARIVNVSSRLGRINGKRNK  186


 Score = 59.3 bits (142),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS ETVA+VTG N+GIGF + K+LA  G+TV+LT+R
Sbjct  28   PYSDHQRWWSAETVAVVTGGNRGIGFEISKQLAAHGVTVILTSR  71



>ref|XP_010483869.1| PREDICTED: (+)-neomenthol dehydrogenase [Camelina sativa]
Length=316

 Score =   105 bits (261),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDV+D  SI +F  W + TF  LDILVNNA V++N    NSVE AETVI+TNY G K
Sbjct  91   FHQLDVTDASSIREFGCWIKQTFGRLDILVNNAGVNYNLGSDNSVEFAETVISTNYLGTK  150

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +  A++P+ R S   ARI+N+SSRLG+     N+L N +LR
Sbjct  151  NMTKAMIPLMRPSPHGARIVNVSSRLGRVNGRRNRLANVELR  192


 Score = 58.2 bits (139),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P    TRWWS E VA+VTG+N+GIG  + ++LA  GLTV+LTAR     L
Sbjct  25   PYSDHTRWWSCENVAVVTGSNRGIGLEIARQLAGHGLTVILTARNVDAGL  74



>ref|XP_009604829.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Nicotiana tomentosiformis]
Length=313

 Score =   103 bits (256),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  S+  F  W + T+  LDIL+NNA V+FN   +NSVE AETVI TNY+G K
Sbjct  89   FHQLDIVDLESVQVFCDWIKETYGGLDILINNAGVNFNYGKENSVEFAETVIQTNYFGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I AL+P+ R S + ARI++++SRLG+ N  +N
Sbjct  149  NMINALIPLMRPSPAGARIVSVTSRLGRLNSKRN  182


 Score = 59.7 bits (143),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR---VTQEALRL  241
            P     RWWS +T+A+VTGAN+GIGF +  +LA  G+TVVLT+R   V +EA+++
Sbjct  25   PYSDHQRWWSSDTIAVVTGANRGIGFEIAHQLASHGVTVVLTSRETAVGEEAVKV  79



>gb|KHN16894.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=452

 Score =   102 bits (255),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI  F  W +  +  LDILVNNA V+FN    NSVE+A+ VI TNYYG K 
Sbjct  91   HQLDILDTSSINQFCEWLKENYGGLDILVNNAGVNFNFGSDNSVENAKLVIETNYYGTKR  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + SS+  RI+N+SSRLG+     N+L+N  LR
Sbjct  151  MIQAMIPLMKSSSAGGRIVNVSSRLGRLNGKRNRLENEALR  191


 Score = 60.5 bits (145),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ET+A+VTG N+GIGF + ++LA+ G+TV+LT+R
Sbjct  25   PYADHQRWWSKETIAVVTGGNRGIGFEISRQLADHGVTVILTSR  68



>ref|XP_009766268.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Nicotiana sylvestris]
Length=331

 Score =   103 bits (258),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  S+  F  W + T+  LDIL+NNA V+FN   +NSVE AETVI TNY+G K
Sbjct  107  FHQLDIVDLASVQAFCDWIKETYGGLDILINNAGVNFNYGKENSVEFAETVIQTNYFGTK  166

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I AL+P+ R S + ARI++++SRLG+ N  +N
Sbjct  167  NMIKALIPLMRPSPAGARIVSVTSRLGRLNSKRN  200


 Score = 59.3 bits (142),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR---VTQEALRL  241
            P     RWWS +T+A+VTGAN+GIGF +  +LA  G++VVLT+R   V +EA+++
Sbjct  43   PYSDHQRWWSSDTIAVVTGANRGIGFEIAHQLASHGISVVLTSRETAVGEEAVKV  97



>ref|XP_009150117.1| PREDICTED: carbonyl reductase [NADPH] 1 [Brassica rapa]
 emb|CDY00233.1| BnaA06g21340D [Brassica napus]
Length=316

 Score =   110 bits (274),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDV+D  SI +F  W + TF  LDILVNNA V++N    NSVE AETV++TNY+G K
Sbjct  91   FHQLDVTDASSIKEFGCWIKQTFGGLDILVNNAGVNYNLGSDNSVEFAETVVSTNYHGTK  150

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R S   ARI+N+SSRLG+     N+L N +LR
Sbjct  151  NMIKAMIPLMRPSPQGARIVNVSSRLGRVYGRRNRLANVELR  192


 Score = 52.8 bits (125),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +2

Query  86   PSLPKTRWWSEETV-AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS E V A+VTG+N+GIG  + ++LA  GLT+VLTAR     L
Sbjct  25   PYSDHQRWWSSENVVAVVTGSNRGIGLEIARQLASHGLTLVLTARNVDAGL  75



>ref|XP_010555587.1| PREDICTED: carbonyl reductase [NADPH] 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010555588.1| PREDICTED: carbonyl reductase [NADPH] 1 isoform X1 [Tarenaya 
hassleriana]
Length=314

 Score =   100 bits (250),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI +F  W    +  +D+L+NNA V++N    NSV HAE VI+TNYYG K 
Sbjct  91   HQLDILDPSSIEEFCQWITEKYGGVDVLINNAGVNYNVGSDNSVGHAEMVISTNYYGTKN  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQFN----KLQNPKLR  570
            +I A+LP+ R S+  ARI+N++SRLG+ N    KL+N  +R
Sbjct  151  IIKAMLPLMRPSAPGARIVNVTSRLGRLNGRHSKLENDAVR  191


 Score = 62.0 bits (149),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +V++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSR  69



>ref|XP_010482430.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Camelina sativa]
Length=314

 Score =   100 bits (249),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI DF +W +  +  +D+L+NNA V++N    NSVE +  VI+TNYYG K
Sbjct  90   FHRLDILDPSSIQDFCNWIKEKYECIDVLINNAGVNYNVGSGNSVEFSNMVISTNYYGTK  149

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R +S  ARI+N++SRLG+     +KL+N  +R
Sbjct  150  NIITAMIPLMRHASQGARIVNVTSRLGRLKGRHSKLENEAVR  191


 Score = 62.4 bits (150),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +V++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSR  69



>ref|XP_003526913.2| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
Length=358

 Score =   101 bits (251),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI  FA W +  +  +DILVNNA V+FN   +N+VE+A  VI TNYYG K 
Sbjct  135  HQLDILDPSSINQFAEWMKENYGGVDILVNNAGVNFNHGSENNVENARNVIDTNYYGTKS  194

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S++ ARI+N+SSRLG+     N+++N  LR
Sbjct  195  MIEAMIPLMKPSAAGARIVNVSSRLGRLNGKRNRVENDALR  235


 Score = 61.2 bits (147),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ET+A+VTG N+GIGF + ++LA+ G+TV+LT+R
Sbjct  69   PYSDHQRWWSKETIAVVTGGNRGIGFEICRQLADHGVTVILTSR  112



>dbj|BAJ53119.1| JHL07K02.9 [Jatropha curcas]
Length=313

 Score = 98.2 bits (243),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI  F  W R T+  +DILVNNA V++N    NSVE+A  VI TNYYG K
Sbjct  89   FHQLDILDSSSIQQFTDWIRETYGGIDILVNNAGVNYNLGSDNSVENARMVINTNYYGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I A++P+ R S + ARI+ +SSRLG+    +N
Sbjct  149  NVIKAMIPLMRPSVAGARIVCVSSRLGKVGGRRN  182


 Score = 64.3 bits (155),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS ET+A+VTGAN+GIGF +V++LA+ GLTV+LT+R +   L
Sbjct  25   PYSDHQRWWSAETIAVVTGANRGIGFEIVRQLADHGLTVILTSRESSAGL  74



>ref|XP_011040290.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Populus euphratica]
Length=313

 Score =   103 bits (256),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDV D  SI  FA W + T+  LD+LVNNA V++N    NSVE+A+ V+ TNYYG K
Sbjct  89   FHQLDVLDSLSIKTFAEWIQQTYGGLDVLVNNAGVNYNMGSDNSVENAKNVVDTNYYGIK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +  AL+P+ R S+  ARI+N+SSRLG+     N+L++  LR
Sbjct  149  NVTEALIPLMRPSAVGARIVNVSSRLGRLNGKRNRLEDKDLR  190


 Score = 59.3 bits (142),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS ETVA+VTG N+GIGF + ++LA+ GL+ +LT+R +   L
Sbjct  25   PYSDHQRWWSSETVAVVTGGNRGIGFEIARQLADHGLSAILTSRESSAGL  74



>gb|KFK36748.1| hypothetical protein AALP_AA4G164900 [Arabis alpina]
Length=314

 Score =   100 bits (248),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI DF  W +  +  +D+L+NNA V++N    NSVE +  VI+TNYYG K
Sbjct  90   FHRLDILDSCSIQDFCKWIKEKYGFIDVLINNAGVNYNIGTNNSVEFSHMVISTNYYGTK  149

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R +SS ARI+N++SRLG+     +KL+N  +R
Sbjct  150  NIINAMVPLMRHASSGARIVNVTSRLGRLKGRHSKLENEAVR  191


 Score = 62.4 bits (150),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +V++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSR  69



>ref|XP_004241656.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Solanum lycopersicum]
Length=313

 Score =   100 bits (248),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  S+  F+ W +  +  LDIL+NNA V+FN    NSVE+AETVI TNY+G K
Sbjct  89   FHQLDIVDPVSVETFSDWIKENYGGLDILINNAGVNFNFGTDNSVEYAETVIQTNYFGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +  A++P+ R S   ARI+N++SRLG+ N  +N
Sbjct  149  SMTKAMIPLMRPSPFGARIVNVTSRLGRLNGRRN  182


 Score = 62.0 bits (149),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTA---RVTQEALRL  241
            P   + RWWS ET+A+VTG+N+GIGF +  +LA  GLTVVLT+   RV +EA ++
Sbjct  25   PYSDQQRWWSNETIAVVTGSNRGIGFEIAHQLASHGLTVVLTSRETRVGEEATKI  79



>emb|CDO98293.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   103 bits (256),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ +  SI  F  W +  +  LDILVNNA ++ N   +NSVEHAE VI TNY+G K
Sbjct  90   FHQLDIVNPSSIETFTEWIQQNYGGLDILVNNAGININIGSENSVEHAEKVIETNYFGTK  149

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I A++P+ R S+S ARI++++SRLG+ N  +N
Sbjct  150  SMIKAMIPLLRPSASGARIVSVTSRLGRLNGRRN  183


 Score = 58.9 bits (141),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            P     RWWS +TVA+VTGAN+GIGF +  +LA  GLTV+LT+R T
Sbjct  26   PYSDHQRWWSSDTVAVVTGANRGIGFEIAHQLAMHGLTVILTSRET  71



>ref|XP_008246053.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Prunus mume]
Length=316

 Score =   103 bits (257),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 70/104 (67%), Gaps = 4/104 (4%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V+ H+LDV D  SI +F  W +  +  LDIL+NNAAV+FN    NSVE+A  VI TNYYG
Sbjct  90   VFCHQLDVLDTLSINEFCDWLKQNYGGLDILINNAAVNFNQGSDNSVEYASQVITTNYYG  149

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             K +I A++P+ + SS   RI+N+SSRLG+     NKL++  LR
Sbjct  150  IKNMIQAMIPLMKHSSHGGRIVNVSSRLGRINGKRNKLEDANLR  193


 Score = 58.5 bits (140),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS ETVA+VTG N+GIGF + ++LA  G+TV+LT+R
Sbjct  28   PYSDHQRWWSAETVAVVTGGNRGIGFEISRQLAAHGVTVILTSR  71



>gb|AFJ66164.1| hypothetical protein 11M19.8 [Arabidopsis halleri]
Length=314

 Score = 99.8 bits (247),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI +F  W +  +  +D+L+NNA V++N    NSVE +  VI+TNYYG K
Sbjct  90   FHRLDILDSSSIQEFCKWIKEKYGLIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTK  149

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFN----KLQNPKLR  570
             +I A++P+ R +S  ARI+N++SRLG+      KL+N  +R
Sbjct  150  NIIKAMIPLMRHASQGARIVNVTSRLGRLKGRHSKLENEAVR  191


 Score = 62.4 bits (150),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +V++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSR  69



>ref|XP_010099540.1| (+)-neomenthol dehydrogenase [Morus notabilis]
 gb|EXB79420.1| (+)-neomenthol dehydrogenase [Morus notabilis]
Length=250

 Score =   104 bits (260),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LDV D  SI +FA W    +  LDILVNNA V+FN   +NSVE A  V+ATNY+G
Sbjct  89   VAFHQLDVLDPLSIKNFADWLHQNYGGLDILVNNAGVNFNIGSENSVEQARMVVATNYFG  148

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K +I A++P+ + S+  ARI+N+SSRLG+ N  +N
Sbjct  149  TKKMIEAMIPLMKPSAVGARIVNVSSRLGRLNGRRN  184


 Score = 57.0 bits (136),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS +T+A+VTG N+GIGF + ++LA  GLTV+LT+R +   L
Sbjct  27   PYSDHQRWWSAKTIAVVTGGNRGIGFDISRQLAAHGLTVILTSRDSNVGL  76



>gb|KHN09697.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=286

 Score =   101 bits (252),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI  FA W +  +  +DILVNNA V+FN   +N+VE+A  VI TNYYG K 
Sbjct  63   HQLDILDPSSINQFAEWMKENYGGVDILVNNAGVNFNHGSENNVENARNVIDTNYYGTKS  122

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S++ ARI+N+SSRLG+     N+++N  LR
Sbjct  123  MIEAMIPLMKPSAAGARIVNVSSRLGRLNGKRNRVENDALR  163


 Score = 60.1 bits (144),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            RWWS+ET+A+VTG N+GIGF + ++LA+ G+TV+LT+R
Sbjct  3    RWWSKETIAVVTGGNRGIGFEICRQLADHGVTVILTSR  40



>ref|XP_008392685.1| PREDICTED: (+)-neomenthol dehydrogenase [Malus domestica]
Length=313

 Score =   101 bits (252),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 72/104 (69%), Gaps = 4/104 (4%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V+ H+LDV D  SI +F  W +  +  LDIL+NNAAV+FN    N+VE+A  VI TNYYG
Sbjct  87   VFCHQLDVLDTASITEFCDWLKQNYGGLDILINNAAVNFNQGFDNTVEYASQVITTNYYG  146

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFN----KLQNPKLR  570
             K +I A++P+ + S++ ARI+N+SSRLG+ N    K+++  LR
Sbjct  147  TKNMIQAMIPLMKPSAAGARIVNVSSRLGRINGKRSKIEDVCLR  190


 Score = 60.1 bits (144),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS ETVA+VTG N+GIGF + K+LA  G+TV+LT+R
Sbjct  25   PYSDHQRWWSAETVAVVTGGNRGIGFEISKQLAAQGVTVILTSR  68



>ref|XP_008464357.1| PREDICTED: LOW QUALITY PROTEIN: carbonyl reductase [NADPH] 1-like 
[Cucumis melo]
Length=313

 Score =   105 bits (262),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LDV D  SI  FA W    +  LDIL+NNA V+FN    NSVE A+ VIATNYYG
Sbjct  87   VAFHQLDVLDALSIKQFADWLLQNYGGLDILINNAGVNFNLGSSNSVEFAQMVIATNYYG  146

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K +I A++P+ + SS+ ARI+N+SSRLG+ N  +N
Sbjct  147  TKNMIQAMIPLMKPSSAGARIVNVSSRLGKLNGRRN  182


 Score = 55.8 bits (133),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS ET+A+VTG N+GIGF + ++ A  G+TV+LT+R
Sbjct  25   PYSDHQRWWSTETIAVVTGGNRGIGFEISRQFAMHGMTVILTSR  68



>ref|XP_004138015.1| PREDICTED: short-chain dehydrogenase/reductase 2b-like [Cucumis 
sativus]
 gb|KGN63428.1| hypothetical protein Csa_1G000030 [Cucumis sativus]
Length=313

 Score =   105 bits (262),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LDV D  SI  FA W    +  LDIL+NNA V+FN    NSVE A+ VIATNYYG
Sbjct  87   VAFHQLDVLDALSIKQFADWLLQNYGGLDILINNAGVNFNLGSSNSVEFAQMVIATNYYG  146

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K +I A++P+ + SS+ ARI+N+SSRLG+ N  +N
Sbjct  147  TKNMIQAMIPLMKPSSAGARIVNVSSRLGKLNGRRN  182


 Score = 55.8 bits (133),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS ET+A+VTG N+GIGF + ++ A  G+TV+LT+R
Sbjct  25   PYSDHQRWWSTETIAVVTGGNRGIGFEISRQFAMHGMTVILTSR  68



>emb|CDY45793.1| BnaC03g16160D [Brassica napus]
Length=310

 Score = 97.8 bits (242),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI DF  W +  +  +D+L+NNA V++N    NSVE++  VI+TNY G K
Sbjct  86   FHRLDILDTSSIQDFCQWIKEKYGFIDVLINNAGVNYNVGTHNSVEYSHMVISTNYNGTK  145

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R +S  ARI+N++SRLG+     +KL+N  +R
Sbjct  146  NIIKAMIPLMRQASPGARIVNVTSRLGRLKGRHSKLENEAVR  187


 Score = 63.2 bits (152),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +VK+LA  GLTV+LT+R
Sbjct  22   PYSDHQRWWTSETVAVVTGANRGIGFEMVKQLAGHGLTVILTSR  65



>ref|XP_009132676.1| PREDICTED: (+)-neomenthol dehydrogenase [Brassica rapa]
 emb|CDX84895.1| BnaA03g13350D [Brassica napus]
Length=310

 Score = 97.8 bits (242),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI DF  W +  +  +D+L+NNA V++N    NSVE++  VI+TNY G K
Sbjct  86   FHRLDILDTSSIQDFCQWIKEKYGFIDVLINNAGVNYNVGTHNSVEYSHMVISTNYNGTK  145

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R +S  ARI+N++SRLG+     +KL+N  +R
Sbjct  146  NIIKAMIPLMRQASPGARIVNVTSRLGRLKGRHSKLENEAVR  187


 Score = 63.5 bits (153),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +VK+LA  GLTV+LT+R
Sbjct  22   PYSDHQRWWTSETVAVVTGANRGIGFEMVKQLAGHGLTVILTSR  65



>gb|KDP22525.1| hypothetical protein JCGZ_26356 [Jatropha curcas]
Length=313

 Score = 96.7 bits (239),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI  F  W R T+  +DILVNNA V++N    NSVE+A  VI TNYYG K
Sbjct  89   FHQLDILDSSSIQQFTDWIRETYGGIDILVNNAGVNYNLGSDNSVENARMVINTNYYGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQ  540
             +I A++P+ R S + ARI+ +SSRLG+
Sbjct  149  NVIKAMIPLMRPSVAGARIVCVSSRLGK  176


 Score = 64.3 bits (155),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS ET+A+VTGAN+GIGF +V++LA+ GLTV+LT+R +   L
Sbjct  25   PYSDHQRWWSAETIAVVTGANRGIGFEIVRQLADHGLTVILTSRESSAGL  74



>ref|XP_009373662.1| PREDICTED: carbonyl reductase [NADPH] 1 [Pyrus x bretschneideri]
Length=313

 Score =   100 bits (249),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 71/104 (68%), Gaps = 4/104 (4%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V+ H+LDV D  SI +F  W +  +  LDIL+NNAAV+FN    N+VE+A  VI TNYYG
Sbjct  87   VFCHQLDVLDTASITEFCDWLKQNYGGLDILINNAAVNFNQGFDNTVEYASQVITTNYYG  146

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFN----KLQNPKLR  570
             K +I A++P+ + S + ARI+N+SSRLG+ N    K+++  LR
Sbjct  147  TKNMIQAMIPLMKPSVAGARIVNVSSRLGRINGKRSKIEDVCLR  190


 Score = 60.5 bits (145),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS ETVA+VTG N+GIGF + K+LA  G+TVVLT+R
Sbjct  25   PYSDHQRWWSAETVAVVTGGNRGIGFEISKQLAAQGVTVVLTSR  68



>ref|XP_003602735.1| Carbonyl reductase-like protein [Medicago truncatula]
 gb|AES72986.1| short chain dehydrogenase/reductase [Medicago truncatula]
Length=311

 Score =   100 bits (248),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  S+ +FA W +  +  LDILVNNA V+ N    NSVE+A   I TNYYG K 
Sbjct  88   HQLDILDSSSVNEFAEWLKEEYGGLDILVNNAGVNSNMGSDNSVENARKCIETNYYGTKR  147

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S++  RI+N+SSRLG+     N+++N +LR
Sbjct  148  MIEAMIPLMKPSAAGGRIVNVSSRLGRLNGKRNRIENEELR  188


 Score = 60.8 bits (146),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ET+A+VTG N+GIGF + ++LA+ G+TVVLT+R
Sbjct  23   PYSDHQRWWSKETIAVVTGGNRGIGFEISRQLADHGVTVVLTSR  66



>ref|XP_006366284.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Solanum tuberosum]
Length=286

 Score =   101 bits (251),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI  F+ W +  +  LDIL+NNA V+FN    NSVE+AETVI TNY+G K
Sbjct  62   FHQLDIVDPASIETFSDWIKENYGGLDILINNAGVNFNFGTDNSVEYAETVIRTNYFGTK  121

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I  ++P+ R S   ARI+N++SRLG+ N  +N
Sbjct  122  SMIKTMIPLMRPSPFGARIVNVTSRLGRLNGRRN  155


 Score = 59.7 bits (143),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ  226
            RWWS ET+A+VTG+N+GIGF +  +LA  GLTVVLT+R T+
Sbjct  4    RWWSNETMAVVTGSNRGIGFEIAHQLASHGLTVVLTSRETR  44



>ref|XP_006280830.1| hypothetical protein CARUB_v10026806mg [Capsella rubella]
 gb|EOA13728.1| hypothetical protein CARUB_v10026806mg [Capsella rubella]
Length=316

 Score =   105 bits (262),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V+FH+LDV+D  SI +FA W +  F  LDILVNNA V++N    NSVE AETVI+TNY+G
Sbjct  89   VYFHQLDVTDASSIREFACWIKQAFGGLDILVNNAGVNYNLGSDNSVEFAETVISTNYFG  148

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K +  A++P+ R     ARI+N+SSRLG+ N  +N
Sbjct  149  TKNMTKAMIPLMRPFPHCARIVNVSSRLGRVNGRRN  184


 Score = 55.5 bits (132),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            RWWS + VA+VTG+N+GIG  + ++LA  GLTVVLTAR     L
Sbjct  31   RWWSCDNVAVVTGSNRGIGLEIARQLAGHGLTVVLTARNVDAGL  74



>gb|EPS72810.1| hypothetical protein M569_01947, partial [Genlisea aurea]
Length=314

 Score =   106 bits (264),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD++D  S+  FA W    +  +DILVNNA V+FN    NS+E AE VIATNY+G K
Sbjct  88   FHQLDITDESSVRAFARWVLERYGGIDILVNNAGVNFNTGSSNSIEFAEEVIATNYFGTK  147

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I A++P+ R S S ARI+N+SSRLG+ N  +N
Sbjct  148  NMIEAMIPLMRPSDSGARIINVSSRLGRLNGRRN  181


 Score = 54.3 bits (129),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
            WWS  T+A VTGAN+GIGF +  +LA  GLTV+LT+R T + 
Sbjct  31   WWSSNTIAAVTGANRGIGFEIAHQLASHGLTVILTSRGTADG  72



>dbj|BAB10083.1| carbonyl reductase-like protein [Arabidopsis thaliana]
Length=304

 Score =   102 bits (254),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 70/106 (66%), Gaps = 6/106 (6%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V+FH+LDV+D  SI +F  W + TF  LDILVNNA V++N    N+VE AETVI+TNY G
Sbjct  75   VYFHQLDVTDSSSIREFGCWLKQTFGGLDILVNNAGVNYNLGSDNTVEFAETVISTNYQG  134

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLG------QFNKLQNPKLR  570
             K +  A++P+ R S   AR++N+SSRL       +  +L N +LR
Sbjct  135  TKNMTKAMIPLMRPSPHGARVVNVSSRLENLVEIHELQRLANVELR  180


 Score = 58.5 bits (140),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            RWWS E VA+VTG+N+GIGF + ++LA  GLTVVLTAR     L
Sbjct  17   RWWSCENVAVVTGSNRGIGFEIARQLAVHGLTVVLTARNVNAGL  60



>ref|XP_006279834.1| hypothetical protein CARUB_v10028182mg [Capsella rubella]
 gb|EOA12732.1| hypothetical protein CARUB_v10028182mg [Capsella rubella]
Length=314

 Score = 98.6 bits (244),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI DF  W +  +  +D+L+NNA V++N    NSVE ++ VI+TNYYG K
Sbjct  90   FHRLDILDPSSIQDFCKWIKEKYGCIDVLINNAGVNYNVGSDNSVEFSQMVISTNYYGTK  149

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R +   ARI+N++SRLG+     +KL N  +R
Sbjct  150  NIIRAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLDNEAVR  191


 Score = 62.4 bits (150),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +V++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSR  69



>ref|XP_010442583.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Camelina sativa]
Length=314

 Score = 98.6 bits (244),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI DF +W +  +  +D+L+NNA V++N    NSVE +  VI+TNYYG K
Sbjct  90   FHRLDILDPSSIQDFCNWIKEKYECIDVLINNAGVNYNVGSGNSVEFSNMVISTNYYGTK  149

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R +   ARI+N++SRLG+     +KL+N  +R
Sbjct  150  NIITAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEAVR  191


 Score = 62.4 bits (150),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +V++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSR  69



>ref|XP_003589619.1| Carbonyl reductase [Medicago truncatula]
 gb|AES59870.1| short chain dehydrogenase/reductase [Medicago truncatula]
Length=316

 Score = 99.8 bits (247),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            +HRLD+    SI  F  W +  +  LDILVNNA V+FN    NSVE+A  VI TNYYG K
Sbjct  92   YHRLDIVHESSINHFVEWLQQNYGGLDILVNNAGVNFNLGSDNSVENARKVIETNYYGIK  151

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             L  AL+PM + S   ARI+N+SSRLG+ N  +N
Sbjct  152  KLTEALIPMMKPSVVGARIVNVSSRLGRLNGRRN  185


 Score = 60.5 bits (145),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  80   SSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            S P     RWWS+ET+A+VTG N+GIGF + ++LA  GLTV+LT+R
Sbjct  26   SIPYSDHQRWWSKETIAVVTGGNRGIGFEICRQLAAHGLTVILTSR  71



>gb|EYU21766.1| hypothetical protein MIMGU_mgv1a010388mg [Erythranthe guttata]
Length=313

 Score =   100 bits (250),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI     W + T+  +DILVNNA V+F+   +NSVE A+ VI TNY+G K
Sbjct  89   FHQLDIVDPPSIESCVDWIKETYGGIDILVNNAGVNFSTGSENSVESADKVIGTNYFGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I A++P+ R S + ARI+N+SSRLG+ N  +N
Sbjct  149  NMIKAMIPLMRPSEAGARIVNVSSRLGRLNGRKN  182


 Score = 59.7 bits (143),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            P     RWW+ ET+A+VTGAN+GIGF +V +LA  GLTV+LT+R T
Sbjct  25   PYSDHQRWWTSETIAVVTGANRGIGFEIVHQLALHGLTVILTSRET  70



>ref|XP_004503038.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Cicer arietinum]
Length=311

 Score = 99.0 bits (245),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI +FA W +  +  LDILVNNA V+ N     SVE+A  V+ TNYYG K 
Sbjct  88   HQLDILDSSSINEFAEWLKEKYGGLDILVNNAGVNSNTGSDISVENARKVMETNYYGTKR  147

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S++ ARI+N+SSRLG+     N+++N  +R
Sbjct  148  MIEAMMPLMKPSAAGARIVNVSSRLGRLNGKRNRIENEDMR  188


 Score = 61.2 bits (147),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ET+A+VTG N+GIGF + ++LA+ G+TVVLT+R
Sbjct  23   PYSDHQRWWSKETIAVVTGGNRGIGFEISRQLADHGVTVVLTSR  66



>ref|XP_007209374.1| hypothetical protein PRUPE_ppa008867mg [Prunus persica]
 gb|EMJ10573.1| hypothetical protein PRUPE_ppa008867mg [Prunus persica]
Length=316

 Score =   101 bits (252),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 4/104 (4%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V+ H+LDV D  SI +F  W +  +  LDIL+NNAAV+FN    NSVE+A  VI TNYYG
Sbjct  90   VFCHQLDVLDTLSINEFCDWLKQNYGGLDILINNAAVNFNQGSDNSVEYASQVITTNYYG  149

Query  451  PKLLIAALLPMFRCSSSTARILNISSRL----GQFNKLQNPKLR  570
             K +I A++P+ + S+   RI+N+SSRL    G+ NKL++  LR
Sbjct  150  IKNMIQAMIPLMKHSAHGGRIVNVSSRLGRTNGKRNKLEDANLR  193


 Score = 58.5 bits (140),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS ETVA+VTG N+GIGF + ++LA  G+TV+LT+R
Sbjct  28   PYSDHQRWWSAETVAVVTGGNRGIGFEISRQLAAHGVTVILTSR  71



>ref|XP_003523181.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
Length=314

 Score = 99.8 bits (247),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            ++LD+ D  SI  FA W +  +  LDILVNNA V+FN   +N+VE+A  VI TNYYG K 
Sbjct  91   NQLDILDPSSINQFAHWLKENYGGLDILVNNAGVNFNQGSENNVENARNVIDTNYYGTKS  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S++ ARI+N+SSRLG+     N+++N  LR
Sbjct  151  MIEAMIPLMKPSAAGARIVNVSSRLGRLNGKRNRVENDALR  191


 Score = 60.5 bits (145),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ETVA+VTG N+GIGF + ++LA  G+TVVLT+R
Sbjct  25   PYSDHQRWWSKETVAVVTGGNRGIGFEICRQLAGHGVTVVLTSR  68



>ref|XP_002277858.1| PREDICTED: carbonyl reductase [NADPH] 1 [Vitis vinifera]
 emb|CAN79560.1| hypothetical protein VITISV_036558 [Vitis vinifera]
 emb|CBI35626.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   101 bits (252),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LDV D  SI  FA W +  +  +DIL+NNA V++N   +NSVE+AE VIATNY+G K 
Sbjct  90   HQLDVLDPSSIEQFAEWVQQNYGFVDILINNAGVNYNMGSENSVENAENVIATNYFGTKN  149

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S+S ARI+N+SSRLG+     NK+++  LR
Sbjct  150  VIKAMVPLMKPSASGARIVNVSSRLGRINGRRNKIEDSALR  190


 Score = 58.2 bits (139),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ET+A+VTGAN+GIGF + ++L   GLTV+LT+R
Sbjct  25   PYSDHQRWWNSETIAVVTGANRGIGFEIARQLCGHGLTVILTSR  68



>gb|KHG13984.1| Carbonyl reductase [NADPH] 1 [Gossypium arboreum]
Length=489

 Score = 97.8 bits (242),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI+ F  W +  +  +DILVNNA V+FN    NSVE A  V+ TNYYG K 
Sbjct  91   HQLDILDGESISAFVEWIKQKYGGIDILVNNAGVNFNLGFDNSVEFARQVVDTNYYGTKN  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S+++ARI+N+SSRLG+     N++Q+  LR
Sbjct  151  MIKAMIPVMKPSAASARIVNVSSRLGRLNGRRNRIQDATLR  191


 Score = 62.0 bits (149),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ETVA+VTGAN+GIGF + ++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWSQETVAVVTGANRGIGFEIARQLAGHGLTVILTSR  69



>gb|KHG13985.1| Carbonyl reductase [NADPH] 1 [Gossypium arboreum]
Length=476

 Score = 97.8 bits (242),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI+ F  W +  +  +DILVNNA V+FN    NSVE A  V+ TNYYG K 
Sbjct  91   HQLDILDGESISAFVEWIKQKYGGIDILVNNAGVNFNLGFDNSVEFARQVVDTNYYGTKN  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S+++ARI+N+SSRLG+     N++Q+  LR
Sbjct  151  MIKAMIPVMKPSAASARIVNVSSRLGRLNGRRNRIQDATLR  191


 Score = 62.0 bits (149),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ETVA+VTGAN+GIGF + ++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWSQETVAVVTGANRGIGFEIARQLAGHGLTVILTSR  69



>gb|KHN31241.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=286

 Score =   100 bits (248),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            ++LD+ D  SI  FA W +  +  LDILVNNA V+FN   +N+VE+A  VI TNYYG K 
Sbjct  63   NQLDILDPSSINQFAHWLKENYGGLDILVNNAGVNFNQGSENNVENARNVIDTNYYGTKS  122

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S++ ARI+N+SSRLG+     N+++N  LR
Sbjct  123  MIEAMIPLMKPSAAGARIVNVSSRLGRLNGKRNRVENDALR  163


 Score = 59.3 bits (142),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            RWWS+ETVA+VTG N+GIGF + ++LA  G+TVVLT+R
Sbjct  3    RWWSKETVAVVTGGNRGIGFEICRQLAGHGVTVVLTSR  40



>gb|KJB40075.1| hypothetical protein B456_007G045400 [Gossypium raimondii]
Length=314

 Score = 96.7 bits (239),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI+ F  W +  +  +DILVNNA V++N    NSVE A  V+ TNYYG K 
Sbjct  91   HQLDILDGESISAFVEWIKQKYGGIDILVNNAGVNYNLGFDNSVEFARQVVDTNYYGTKN  150

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S++ ARI+N+SSRLG+     N++Q+  LR
Sbjct  151  MIKAMIPVMKPSAAGARIVNVSSRLGRLNGRRNRIQDATLR  191


 Score = 62.4 bits (150),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ETVA+VTGAN+GIGF + ++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWSQETVAVVTGANRGIGFEIARQLAGHGLTVILTSR  69



>ref|NP_199916.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAB08749.1| carbonyl reductase-like protein [Arabidopsis thaliana]
 gb|AAV74232.1| At5g51030 [Arabidopsis thaliana]
 gb|AAW39010.1| At5g51030 [Arabidopsis thaliana]
 gb|AED96023.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=314

 Score = 96.7 bits (239),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI +F  W +  +  +D+L+NNA V++N    NSVE +  VI+TNYYG K
Sbjct  90   FHRLDILDSSSIQEFCEWIKEKYGFIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTK  149

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R +   ARI+N++SRLG+     +KL+N  +R
Sbjct  150  NIINAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEDVR  191


 Score = 62.4 bits (150),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +V++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSR  69



>ref|XP_002865838.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42097.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=314

 Score = 96.3 bits (238),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI +F  W +  +  +D+L+NNA V++N    NSVE +  VI+TNYYG K
Sbjct  90   FHRLDILDSSSIQEFCIWIKEKYGLIDVLINNAGVNYNVGSDNSVEFSHMVISTNYYGTK  149

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+ R +   ARI+N++SRLG+     +KL+N  +R
Sbjct  150  NIIKAMIPLMRHACQGARIVNVTSRLGRLKGRHSKLENEAVR  191


 Score = 62.4 bits (150),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +V++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSR  69



>ref|XP_008810480.1| PREDICTED: carbonyl reductase [NADPH] 1 isoform X2 [Phoenix dactylifera]
Length=316

 Score =   100 bits (248),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LDV D  S+  F  W    +  LDILVNNA V+FN    NSVE AE VIATNYYG K 
Sbjct  92   HQLDVLDAASVESFEKWVVLKYGGLDILVNNAGVNFNVGSDNSVEFAEKVIATNYYGTKR  151

Query  460  LIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
            +I  ++P+ + S+  ARILN+SSRLG+ N  +N
Sbjct  152  MIETMIPIMKHSAFGARILNVSSRLGRVNGRRN  184


 Score = 58.5 bits (140),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
            P  P  RWWS ETVAIVTGAN+GIG+ + ++LA  GL V+L +R     
Sbjct  27   PYPPLRRWWSSETVAIVTGANRGIGYEIARQLAGHGLCVILASRAADRG  75



>ref|XP_009771378.1| PREDICTED: carbonyl reductase [NADPH] 1 isoform X1 [Nicotiana 
sylvestris]
Length=313

 Score =   100 bits (248),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI  F+ W +  +  L+IL+NNA V+FN    NSVE AETVI TNY+G K
Sbjct  89   FHQLDIVDPASIQTFSDWIKEKYGGLNILINNAGVNFNFGSDNSVEFAETVIQTNYFGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I A++P+ R S   ARI+N++SRLG+ N  +N
Sbjct  149  SMIKAMIPLMRPSPFGARIINVTSRLGRLNGRRN  182


 Score = 58.5 bits (140),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ  226
            P     RWWS +T+ +VTGAN+GIGF +  +LA  GLTVVLT+R T+
Sbjct  25   PYSDHQRWWSTDTIVVVTGANRGIGFEIAHQLASHGLTVVLTSRDTR  71



>ref|XP_009596907.1| PREDICTED: carbonyl reductase [NADPH] 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=313

 Score = 99.8 bits (247),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI   + W +  +  LDIL+NNA V+FN    NSVE AETVI TNY+G K
Sbjct  89   FHQLDIVDPASIQSLSDWIKEKYGGLDILINNAGVNFNFGSDNSVEFAETVIKTNYFGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             ++ A++P+ R S   ARI+N++SRLG+ N  +N
Sbjct  149  SMVKAMIPLMRPSPFGARIVNVTSRLGRLNGRRN  182


 Score = 57.8 bits (138),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ  226
            P     RWWS +++A+VTGAN+GIGF +  +LA  GLTV+LT+R T+
Sbjct  25   PYSDHQRWWSSDSIAVVTGANRGIGFEIAHQLASHGLTVLLTSRETR  71



>ref|XP_006341464.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Solanum tuberosum]
Length=313

 Score = 95.5 bits (236),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI  F  W + T+  LDIL+NNA V+FN    NSVE +E VI  NY+G K
Sbjct  89   FHQLDIVDPASIQTFCDWIKETYGGLDILINNAGVNFNFGKDNSVEFSEMVIQVNYFGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I AL P+ R S + +RI++++SRLG+ N  +N
Sbjct  149  NMIKALTPLMRPSPAGSRIVSVTSRLGRLNSKRN  182


 Score = 61.2 bits (147),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR---VTQEALRL  241
            P     RWWS ET+A+VTGAN+GIGF +  +LA  G+TVVLT+R   V +EA+++
Sbjct  25   PYSDHQRWWSSETIAVVTGANRGIGFEIAHQLASHGITVVLTSRETAVGEEAVKV  79



>ref|XP_010265011.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Nelumbo nucifera]
 ref|XP_010265012.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Nelumbo nucifera]
Length=313

 Score = 99.0 bits (245),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LD+ D  S+  FA W    F  +DILVNNA V++N    NSVE AE VI TNY+G
Sbjct  87   VAFHQLDILDPVSVKQFAEWMDQNFGGIDILVNNAGVNYNLGSNNSVEFAEKVILTNYFG  146

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K ++  ++P+ + SS  ARI+N+SSRLG+ N  +N
Sbjct  147  TKRMVETMIPLMKHSSPGARIVNVSSRLGRLNGRRN  182


 Score = 58.2 bits (139),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P   + RWWS ETVA+VTGAN+GIG+ + ++LA  GL V++T+R
Sbjct  25   PYAAEDRWWSSETVAVVTGANRGIGYEIARQLAGHGLKVIITSR  68



>gb|ACU23671.1| unknown [Glycine max]
Length=313

 Score = 95.1 bits (235),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            +H+LDV D  SI  F  W R     LDILVNNA V+FN    NSVE+A  VI TNYYG K
Sbjct  89   YHQLDVVDYSSINQFVEWLRENCGGLDILVNNAGVNFNLGSDNSVENARKVIETNYYGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +  A++ + + S   ARI+N+SSRLG+ N  +N
Sbjct  149  RMTEAIISLMKPSLVGARIVNVSSRLGRLNGRRN  182


 Score = 61.6 bits (148),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  74   QYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            Q + P     RWWS+ETVA+VTG N+GIGF + ++LA  GLTV+LT+R T
Sbjct  21   QRTIPYSHHQRWWSKETVAVVTGGNRGIGFEICRQLATHGLTVILTSRDT  70



>ref|XP_009596908.1| PREDICTED: carbonyl reductase [NADPH] 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=286

 Score = 99.4 bits (246),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI   + W +  +  LDIL+NNA V+FN    NSVE AETVI TNY+G K
Sbjct  62   FHQLDIVDPASIQSLSDWIKEKYGGLDILINNAGVNFNFGSDNSVEFAETVIKTNYFGTK  121

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             ++ A++P+ R S   ARI+N++SRLG+ N  +N
Sbjct  122  SMVKAMIPLMRPSPFGARIVNVTSRLGRLNGRRN  155


 Score = 57.4 bits (137),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ  226
            RWWS +++A+VTGAN+GIGF +  +LA  GLTV+LT+R T+
Sbjct  4    RWWSSDSIAVVTGANRGIGFEIAHQLASHGLTVLLTSRETR  44



>ref|XP_006844645.1| hypothetical protein AMTR_s00016p00233930 [Amborella trichopoda]
 gb|ERN06320.1| hypothetical protein AMTR_s00016p00233930 [Amborella trichopoda]
Length=321

 Score = 98.6 bits (244),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+SD  SI  F+ W    +  LD+L+NNA V+FN    NS+E AE VI TNY G K
Sbjct  97   FHQLDISDHDSITRFSEWIVQKYDGLDVLINNAGVNFNLGSDNSMEFAEEVIRTNYLGTK  156

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
            L+I A++P  + S   ARI+N+SSRLG+ N  +N
Sbjct  157  LMIEAMVPRMKPSPFGARIVNVSSRLGRLNGRRN  190


 Score = 57.8 bits (138),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 3/53 (6%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT---QEAL  235
            P   + RWW  ET A+VTG+N+GIGF +V++L++ GL V+LT+R     QEA+
Sbjct  33   PYTQQQRWWCSETTAVVTGSNRGIGFEIVRQLSKHGLRVILTSRDVSKGQEAM  85



>ref|XP_004235853.1| PREDICTED: carbonyl reductase [NADPH] 3-like [Solanum lycopersicum]
Length=313

 Score = 95.1 bits (235),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LD+ D  SI  F  W + T+  LDIL+NNA V+FN    NSVE +E VI  NY+G K
Sbjct  89   FHQLDIVDPVSIQTFCDWIKETYGGLDILINNAGVNFNCGKDNSVEFSEMVIQVNYFGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I AL P+ R S + +RI++++SRLG+ N  +N
Sbjct  149  NMIKALTPLMRPSPAGSRIVSVTSRLGRLNSKRN  182


 Score = 61.2 bits (147),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 3/55 (5%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR---VTQEALRL  241
            P     RWWS ET+A+VTGAN+GIGF +  +LA  G+TVVLT+R   V +EA+++
Sbjct  25   PYSDHQRWWSSETIAVVTGANRGIGFEIAHQLASHGVTVVLTSRETAVGEEAVKV  79



>ref|XP_003533937.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
 gb|KHN46359.1| Short-chain dehydrogenase/reductase 2 [Glycine soja]
Length=313

 Score = 95.1 bits (235),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            +H+LDV D  SI  F  W R     LDILVNNA V+FN    NSVE+A  VI TNYYG K
Sbjct  89   YHQLDVVDYSSINQFVEWLRENCGGLDILVNNAGVNFNLGSDNSVENARKVIETNYYGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +  A++ + + S   ARI+N+SSRLG+ N  +N
Sbjct  149  RMTEAIISLMKPSLVGARIVNVSSRLGRLNGRRN  182


 Score = 60.8 bits (146),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  74   QYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            Q + P     RWWS+ETVA+VTG N+GIGF + ++LA  GLTV+LT+R
Sbjct  21   QRTIPYSHHQRWWSKETVAVVTGGNRGIGFEICRQLATHGLTVILTSR  68



>gb|EYU24543.1| hypothetical protein MIMGU_mgv1a010391mg [Erythranthe guttata]
Length=313

 Score = 99.0 bits (245),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI  F    +  +  +DILVNNA V++N    NSVE AE V+ATNY+G K
Sbjct  89   FHRLDIVDPSSIEAFTESIKEIYGGIDILVNNAGVNYNVGSDNSVEFAEQVVATNYFGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I A++P+ R S + ARI+N+SSRLG+ N  +N
Sbjct  149  NIIKAMIPLMRPSETGARIVNVSSRLGRLNGRRN  182


 Score = 55.8 bits (133),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR---VTQEALRL  241
            P     RWW+  T+A+VTGAN+GIGF +  +LA  GLTV+LT+R   V +EA ++
Sbjct  25   PYSDHQRWWTSSTIAVVTGANRGIGFEIAHQLALHGLTVILTSRDAVVGEEAAKV  79



>ref|XP_010908903.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Elaeis guineensis]
Length=316

 Score = 97.1 bits (240),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LDV D  S+  F  W    +  LDILVN+A V+FN    NSVE AE VIATNY G K 
Sbjct  92   HQLDVLDAASVESFVKWVVLKYGGLDILVNSAGVNFNVGSNNSVEFAEKVIATNYNGTKQ  151

Query  460  LIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
            +I  ++P+ + S+S ARILN+SSRLG+ N  +N
Sbjct  152  MIETMIPIMKPSASGARILNVSSRLGRVNGRRN  184


 Score = 57.8 bits (138),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P  P  RWWS ETVA+VTGAN+GIG+ + ++LA  GL V+L +R
Sbjct  27   PYPPLQRWWSSETVAVVTGANRGIGYEIARQLAGHGLCVILASR  70



>ref|XP_004498298.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X1 [Cicer 
arietinum]
 ref|XP_004498299.1| PREDICTED: (+)-neomenthol dehydrogenase-like isoform X2 [Cicer 
arietinum]
Length=313

 Score = 94.4 bits (233),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            +H+LDV D  SI  F  W    +  LDILVNNA V+FN    NSVE+A  VI  NYYG K
Sbjct  89   YHQLDVIDNSSINHFVEWLHENYGGLDILVNNAGVNFNLGSDNSVENARKVIEINYYGTK  148

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             L  +L+P+ + S   ARI+N+SSRLG+ N  +N
Sbjct  149  NLTESLIPLMKPSIVGARIVNVSSRLGRINGRRN  182


 Score = 59.7 bits (143),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  80   SSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            S P     RWWS+ET+A+VTG N+GIGF + ++LA  GLTV+LT+R
Sbjct  23   SIPYSHHQRWWSKETIAVVTGGNRGIGFEICRQLAAHGLTVILTSR  68



>ref|XP_009396770.1| PREDICTED: carbonyl reductase [NADPH] 1-like [Musa acuminata 
subsp. malaccensis]
Length=316

 Score = 97.1 bits (240),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F +LDVS   S+  FA W    +  LDILVNNA V+FN    NSVE AE VIATNY+G
Sbjct  89   VEFRQLDVSRPESVESFAKWIAEKYGGLDILVNNAGVNFNTGADNSVEFAEEVIATNYFG  148

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K +I   + M   S+S ARILN+SSRLG+ N  +N
Sbjct  149  TKRMIEIFISMMCPSTSGARILNVSSRLGRVNGRRN  184


 Score = 56.6 bits (135),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            RWWS ETVA+VTGAN+GIG+ + ++LA  GL V++TAR
Sbjct  33   RWWSSETVAVVTGANRGIGYEIARQLAVHGLRVIVTAR  70



>ref|XP_006436983.1| hypothetical protein CICLE_v10032162mg [Citrus clementina]
 ref|XP_006485064.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Citrus sinensis]
 gb|ESR50223.1| hypothetical protein CICLE_v10032162mg [Citrus clementina]
Length=314

 Score = 90.9 bits (224),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LDV D  SI +F  W R  +  +DILVNNA V++N    NSVE A+ VI TNYYG K 
Sbjct  91   HQLDVLDSSSIQEFCDWIRERYGGIDILVNNAGVNYNLGSDNSVEFAKEVIQTNYYGTKA  150

Query  460  LIAALLPMFRCSSSTARILNISS  528
            +I A++P+ R S++ ARI+++SS
Sbjct  151  MIKAMIPLMRPSAAGARIVSVSS  173


 Score = 62.0 bits (149),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            P     RWWS ET+A+VTGAN+GIGF + ++LA  GLTV+LT+R T   L
Sbjct  26   PYSDHQRWWSPETIAVVTGANRGIGFEMARQLAAQGLTVILTSRDTSVGL  75



>gb|ADN33869.1| short-chain dehydrogenase/reductase family protein [Cucumis melo 
subsp. melo]
Length=337

 Score = 94.7 bits (234),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 67/113 (59%), Gaps = 17/113 (15%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDIL-----------------VNNAAVSFNDVD  399
            V FH+LDV D  SI  FA W    +  LDIL                 +NNA V+FN   
Sbjct  87   VAFHQLDVLDALSIKQFADWLLQNYGGLDILANDITSKFPIYVQLCPQINNAGVNFNLGS  146

Query  400  QNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             NSVE A+ VIATNYYG K +I A++P+ + SS+ ARI+N+SSRLG+ N  +N
Sbjct  147  SNSVEFAQMVIATNYYGTKNMIQAMIPLMKPSSAGARIVNVSSRLGKLNGRRN  199


 Score = 55.8 bits (133),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS ET+A+VTG N+GIGF + ++ A  G+TV+LT+R
Sbjct  25   PYSDHQRWWSTETIAVVTGGNRGIGFEISRQFAMHGMTVILTSR  68



>gb|AFJ66224.1| hypothetical protein 34G24.29 [Capsella rubella]
Length=357

 Score = 86.3 bits (212),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI DF  W +  +  +D+L+NNA V++N    NSVE ++ VI+TNYYG K
Sbjct  90   FHRLDILDPSSIQDFCKWIKEKYGCIDVLINNAGVNYNVGSDNSVEFSQMVISTNYYGTK  149

Query  457  LLIAALLPMFRCSSSTARILN  519
             +I A++P+ R +   ARI+N
Sbjct  150  NIIRAMIPLMRHACQGARIVN  170


 Score = 62.0 bits (149),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +V++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSR  69



>gb|KEH20958.1| short-chain dehydrogenase-reductase [Medicago truncatula]
Length=310

 Score = 87.4 bits (215),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 65/101 (64%), Gaps = 7/101 (7%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LDV D  SI  F+ W +  +  L+IL   A ++FN    NSVE+A TVI TNY+G K 
Sbjct  90   HQLDVLDSSSITQFSDWLKENYGGLNIL---ARINFNFGSDNSVENAHTVIDTNYFGTKR  146

Query  460  LIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
            +I A++P+ + S++  RI+N+S+RLG+     N+L N  LR
Sbjct  147  MIEAMIPLMKASAAGGRIVNVSTRLGRLNGKRNRLDNDDLR  187


 Score = 60.8 bits (146),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWWS+ET+A+VTG N+GIGF + ++LAE G+TV+LT R
Sbjct  25   PYSDHQRWWSKETIAVVTGGNRGIGFEISRQLAEHGVTVILTTR  68



>ref|XP_004171147.1| PREDICTED: salutaridine reductase-like, partial [Cucumis sativus]
Length=299

 Score = 94.7 bits (234),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 67/113 (59%), Gaps = 17/113 (15%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDIL-----------------VNNAAVSFNDVD  399
            V FH+LDV D  SI  FA W    +  LDIL                 +NNA V+FN   
Sbjct  56   VAFHQLDVLDALSIKQFADWLLQNYGGLDILANDITSKFPIYVQLCSQINNAGVNFNLGS  115

Query  400  QNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             NSVE A+ VIATNYYG K +I A++P+ + SS+ ARI+N+SSRLG+ N  +N
Sbjct  116  SNSVEFAQMVIATNYYGTKNMIQAMIPLMKPSSAGARIVNVSSRLGKLNGRRN  168


 Score = 53.1 bits (126),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WWS ET+A+VTG N+GIGF + ++ A  G+TV+LT+R
Sbjct  1    WWSTETIAVVTGGNRGIGFEISRQFAMHGMTVILTSR  37



>ref|XP_008810479.1| PREDICTED: carbonyl reductase [NADPH] 1 isoform X1 [Phoenix dactylifera]
Length=340

 Score = 86.7 bits (213),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 62/117 (53%), Gaps = 24/117 (21%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDIL------------------------VNNAAVSF  387
            H+LDV D  S+  F  W    +  LDIL                        VNNA V+F
Sbjct  92   HQLDVLDAASVESFEKWVVLKYGGLDILKFAWSNLPGFVAHGEYGSVRQLKKVNNAGVNF  151

Query  388  NDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
            N    NSVE AE VIATNYYG K +I  ++P+ + S+  ARILN+SSRLG+ N  +N
Sbjct  152  NVGSDNSVEFAEKVIATNYYGTKRMIETMIPIMKHSAFGARILNVSSRLGRVNGRRN  208


 Score = 58.5 bits (140),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
            P  P  RWWS ETVAIVTGAN+GIG+ + ++LA  GL V+L +R     
Sbjct  27   PYPPLRRWWSSETVAIVTGANRGIGYEIARQLAGHGLCVILASRAADRG  75



>ref|XP_010695750.1| PREDICTED: carbonyl reductase [NADPH] 1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=253

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LD+ D  SI +FA W + T   LDIL+NNA V+FN   +NSVE+AE VI TNYYG
Sbjct  27   VEFHQLDIVDPQSIKEFADWIQVTHGGLDILINNAGVNFNVGSENSVEYAEQVIKTNYYG  86

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K LI A++P+ + S S ARI+N++SRLG+ N  +N
Sbjct  87   TKNLIEAMIPLMKPSPSGARIVNVTSRLGRLNGRRN  122



>gb|AFJ66193.1| hypothetical protein 7G9.11 [Boechera stricta]
Length=299

 Score = 81.6 bits (200),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 59/98 (60%), Gaps = 11/98 (11%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FHRLD+ D  SI DF  W +  +  +DI  NNA V++N    NSVE +  VI+TNYYG K
Sbjct  90   FHRLDILDSSSIQDFCKWIKEKYGFIDI--NNAGVNYNVGSDNSVEFSHMVISTNYYGTK  147

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             +I A++P+ R +S  ARI+         NKL+N  +R
Sbjct  148  NIIKAMIPLMRHASQGARIV---------NKLENEAVR  176


 Score = 62.4 bits (150),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  86   PSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P     RWW+ ETVA+VTGAN+GIGF +V++LA  GLTV+LT+R
Sbjct  26   PYSDHQRWWTSETVAVVTGANRGIGFEMVRQLAGHGLTVILTSR  69



>ref|XP_002980435.1| hypothetical protein SELMODRAFT_112611 [Selaginella moellendorffii]
 gb|EFJ18695.1| hypothetical protein SELMODRAFT_112611 [Selaginella moellendorffii]
Length=330

 Score = 83.2 bits (204),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFND-VDQNSVEHAETVIATNYYGP  453
            FH LDV    SI +FA W    F+ +DILVNNA +S ND +   +VE ++ VI+TNYYG 
Sbjct  70   FHVLDVRSPSSIQNFAKWIETKFNGVDILVNNAGISRNDHLGNPTVESSKDVISTNYYGT  129

Query  454  KLLIAALLPMFRCSSS-TARILNISSRLGQFNKLQN  558
            +++I  LLP+ R  S   +RI+N+SS   + + L+N
Sbjct  130  RMVIECLLPLLRSQSPHGSRIINVSSATSRMDALRN  165


 Score = 60.8 bits (146),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            TRWWS++T+A+VTG+NKG+GFA+ + LA  G+T +LT+R  Q  L
Sbjct  7    TRWWSKDTIAVVTGSNKGLGFAIAQGLALKGVTTILTSRDEQRGL  51



>ref|NP_001136617.1| uncharacterized protein LOC100216741 [Zea mays]
 ref|XP_008673224.1| PREDICTED: uncharacterized protein LOC100383687 isoform X1 [Zea 
mays]
 gb|ACF82277.1| unknown [Zea mays]
Length=324

 Score = 95.9 bits (237),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
             +LDV+D  S+  FA+W   T+  + +LVNNA V+FN    NSVE AE VI TNYYG K 
Sbjct  100  RKLDVADAASVEAFAAWAVETYGGIHVLVNNAGVNFNKGADNSVEFAEQVIETNYYGTKR  159

Query  460  LIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
            +I A++P+ + S+  ARI+N+SSRLG+ N  +N
Sbjct  160  MIDAMIPLMKRSAYGARIVNVSSRLGRANGRRN  192


 Score = 47.8 bits (112),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 3/49 (6%)
 Frame = +2

Query  80   SSPSLPKTRWWSE---ETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            S P  P  RWW       VA+VTGAN+GIGF   ++LA  GL VVL  R
Sbjct  25   SLPYEPHQRWWDRLAPRAVAVVTGANRGIGFEAARQLALHGLHVVLACR  73



>ref|XP_002983044.1| hypothetical protein SELMODRAFT_117556, partial [Selaginella 
moellendorffii]
 gb|EFJ15853.1| hypothetical protein SELMODRAFT_117556, partial [Selaginella 
moellendorffii]
Length=276

 Score = 76.3 bits (186),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVS   S+A  ASW    +   DILVNNAAV  N+    S +  + ++ TNY G
Sbjct  57   VEFRELDVSSSDSVAGLASWLEKEYKGFDILVNNAAVVGNEF---SFQAVKNLVDTNYDG  113

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKL  552
             K     L P+ R S + ARI+NISS+LGQ ++L
Sbjct  114  VKRTTRVLSPLLRPSQAGARIVNISSQLGQLHRL  147


 Score = 64.7 bits (156),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            RWWS++TVA+VTG NKGIGF +V++LA+ G++VVLTAR  +  L
Sbjct  1    RWWSKDTVAVVTGGNKGIGFEIVRQLAKKGISVVLTARDEKRGL  44



>ref|XP_002965558.1| hypothetical protein SELMODRAFT_83967, partial [Selaginella moellendorffii]
 gb|EFJ32978.1| hypothetical protein SELMODRAFT_83967, partial [Selaginella moellendorffii]
Length=276

 Score = 77.0 bits (188),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V F  LDVS   S+A  ASW    +   DILVNNAAV  N+    S +  + ++ TNY G
Sbjct  57   VEFRELDVSSSDSVAGLASWLEKEYKGFDILVNNAAVVGNEF---SFQAVKNLVDTNYEG  113

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKL  552
             K     L P+ R S + ARI+NISS+LGQ ++L
Sbjct  114  VKRTTRVLSPLLRPSQAGARIVNISSQLGQLHRL  147


 Score = 63.9 bits (154),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            RWWS++TVA+VTG NKGIGF ++++LA+ G++VVLTAR  +  L
Sbjct  1    RWWSKDTVAVVTGGNKGIGFEIIRQLAKKGISVVLTARDEKRGL  44



>gb|EAZ14715.1| hypothetical protein OsJ_04640 [Oryza sativa Japonica Group]
Length=330

 Score = 94.4 bits (233),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            + +LDV+D  S+  FA+W   T   + +LVNNA V+FN    NSVE AE VI TNY+G K
Sbjct  104  WRQLDVTDAASVEGFATWVERTHGGVHVLVNNAGVNFNRGADNSVEFAEQVIETNYFGTK  163

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+   S    RI+N+SSRLG+     N++ +P LR
Sbjct  164  RMIEAMMPLMITSPHGGRIVNVSSRLGRVNGRRNRIGDPSLR  205


 Score = 46.2 bits (108),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (57%), Gaps = 9/53 (17%)
 Frame = +2

Query  86   PSLPKTRWWSE---------ETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P  P  RWW             VA+VTGAN+GIG+   ++LA  GL VVLT+R
Sbjct  27   PYEPHQRWWDGLAPPPPPPGRAVAVVTGANRGIGYEAARQLATHGLHVVLTSR  79



>ref|XP_001764466.1| predicted protein [Physcomitrella patens]
 gb|EDQ70733.1| predicted protein [Physcomitrella patens]
Length=284

 Score = 84.0 bits (206),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH LDV    S +  + W + T+  +DIL+NNA V + +    S+E   T + TNYYG K
Sbjct  63   FHPLDVCSEESASALSKWLKQTYGGVDILINNAGVLYKE--NESLEDITTTLQTNYYGVK  120

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +  A+LP+ R S + AR++ +SS+LGQ N L+N
Sbjct  121  YVTKAMLPVLRQSPAGARVIIVSSKLGQLNSLRN  154


 Score = 56.2 bits (134),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WWS +TVA+VTGANKG+G+ + ++LA  GLT V+TAR
Sbjct  4    WWSADTVAVVTGANKGVGYEIARQLARNGLTTVVTAR  40



>ref|XP_002980432.1| hypothetical protein SELMODRAFT_419963 [Selaginella moellendorffii]
 gb|EFJ18692.1| hypothetical protein SELMODRAFT_419963 [Selaginella moellendorffii]
Length=327

 Score = 81.3 bits (199),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFND-VDQNSVEHAETVIATNYYGP  453
            FH LDV    SI +FA W    F+ +DILVNNA +S ND +   +VE ++ VI+TNYYG 
Sbjct  67   FHVLDVRSPSSIQNFAKWIETKFNGVDILVNNAGISRNDHLGNPTVESSKDVISTNYYGT  126

Query  454  KLLIAALLPMFRCSSS-TARILNISSRLGQFNKLQN  558
            +++I  LLP  R  S   +RI N+SS   + + L+N
Sbjct  127  RMVIECLLPFLRSQSPHGSRITNVSSATSRMDSLRN  162


 Score = 58.5 bits (140),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  92   LPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            +  ++WWS++T+A+VTG+NKG+GFA+ + LA  G+T +LT+R  Q  L
Sbjct  1    MADSQWWSKDTIAVVTGSNKGLGFAIAQGLALKGVTTILTSRDEQRGL  48



>ref|XP_004971162.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Setaria italica]
Length=324

 Score = 90.5 bits (223),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V + +LDV++  S+  FA+W   T   + +LVNNA V+FN    NSVE AE VI TNYYG
Sbjct  97   VEWRQLDVAEAASVEAFAAWALETHGGIHVLVNNAGVNFNKGPDNSVEFAEQVIKTNYYG  156

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K +  A++P+ + S   ARI+N+SSRLG+ N  +N
Sbjct  157  MKQMTDAMIPLMKPSPYGARIVNVSSRLGRVNGRRN  192


 Score = 48.5 bits (114),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 3/47 (6%)
 Frame = +2

Query  86   PSLPKTRWWSE---ETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P  P  RWW       VA+VTGAN+G+GF   ++LA  GL VVLT+R
Sbjct  27   PYEPHQRWWDHLEPRAVAVVTGANRGMGFEAARQLALHGLHVVLTSR  73



>ref|XP_002459028.1| hypothetical protein SORBIDRAFT_03g044750 [Sorghum bicolor]
 gb|EES04148.1| hypothetical protein SORBIDRAFT_03g044750 [Sorghum bicolor]
Length=324

 Score = 90.9 bits (224),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
             +LDV+D  S+  FA+W   T   + +LVNNA V+FN    NSVE AE VI TNYYG K 
Sbjct  100  RQLDVADAASVEAFAAWAVETHGGIHVLVNNAGVNFNKGADNSVEFAEQVIKTNYYGTKR  159

Query  460  LIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
            +I  ++P+ + S   ARI+N+SSRLG+ N  +N
Sbjct  160  MIDTMIPLMKHSPYGARIVNVSSRLGRANGRRN  192


 Score = 48.1 bits (113),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 3/47 (6%)
 Frame = +2

Query  86   PSLPKTRWWSE---ETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P  P  RWW       VA+VTGAN+GIGF   ++LA  GL VVL +R
Sbjct  27   PYEPHQRWWDRLAPRAVAVVTGANRGIGFEAARQLALHGLHVVLASR  73



>gb|EAY77081.1| hypothetical protein OsI_05042 [Oryza sativa Indica Group]
Length=331

 Score = 92.4 bits (228),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (63%), Gaps = 4/102 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            + +LDV+D  S+  FA+W   T   + +LVNNA V+FN    NSVE AE V  TNY+G K
Sbjct  105  WRQLDVTDAASVEGFATWVERTHGGVHVLVNNAGVNFNRGADNSVEFAEQVTETNYFGTK  164

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             +I A++P+   S    RI+N+SSRLG+     N++ +P LR
Sbjct  165  RMIEAMMPLMITSPHGGRIVNVSSRLGRVNGRRNRIGDPSLR  206


 Score = 45.8 bits (107),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 30/54 (56%), Gaps = 10/54 (19%)
 Frame = +2

Query  86   PSLPKTRWWSE----------ETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P  P  RWW              VA+VTGAN+GIG+   ++LA  GL VVLT+R
Sbjct  27   PYEPHQRWWDGLAPPPPPPPGRAVAVVTGANRGIGYEAARQLATHGLHVVLTSR  80



>gb|ADE77110.1| unknown [Picea sitchensis]
Length=280

 Score = 75.5 bits (184),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH LDV    SIA  +   +  +   DILVNNAA +      NS E  + V+ TNY+G K
Sbjct  63   FHTLDVCSTDSIASLSQNIKQKYGGFDILVNNAATADYG---NSYEELKLVLQTNYWGVK  119

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +   LLP+ R SSS ARI+N+SS LG   +++N
Sbjct  120  NVTKGLLPLLRPSSSGARIINVSSHLGMLERIKN  153


 Score = 62.4 bits (150),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  92   LPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQ  226
            +  +RWWS +TVA+VTGANKGIG+ +V++LA+  +TV+LTAR  Q
Sbjct  1    MASSRWWSRDTVAVVTGANKGIGYEIVRQLAKEDVTVILTARNEQ  45



>gb|EMS48166.1| (+)-neomenthol dehydrogenase [Triticum urartu]
Length=173

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  361  LVNNAAVSFNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQ  540
            +VNNA VSFN++D NSVEHAETV+ TN+YG K+LI ALLP+FR SS T+RILN+SS+LG 
Sbjct  42   VVNNAGVSFNEIDTNSVEHAETVLKTNFYGAKMLIEALLPLFRRSSGTSRILNLSSQLGL  101

Query  541  FNKLQNPKLR  570
             NK+++P LR
Sbjct  102  LNKVRDPSLR  111


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVT  223
            WW+ ETVA+VTGAN+GIG AL  RLAE GL+VV  A V+
Sbjct  11   WWTGETVAVVTGANRGIGHALAARLAEQGLSVVNNAGVS  49



>ref|XP_002961336.1| hypothetical protein SELMODRAFT_270248 [Selaginella moellendorffii]
 gb|EFJ38875.1| hypothetical protein SELMODRAFT_270248 [Selaginella moellendorffii]
Length=276

 Score = 86.7 bits (213),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 58/95 (61%), Gaps = 4/95 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH LDVS   S++  A+W +  F A+DILVNNA +      +N VE A+ +  TNYYG K
Sbjct  59   FHELDVSSSQSVSAMAAWLQQKFGAIDILVNNAGIKSKGF-ENEVEGAQALFETNYYGAK  117

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNP  561
             +  A+LP+ +      RI+NISSRLGQ N   +P
Sbjct  118  RMAQAVLPIIKPG---GRIINISSRLGQLNNDYDP  149


 Score = 48.9 bits (115),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  116  EETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            E  VA+VTG+NKGIGF +V++LA  G T VLTAR  +  +
Sbjct  5    ESKVAVVTGSNKGIGFEIVRQLASKGFTTVLTARDAKRGI  44



>ref|XP_002963056.1| hypothetical protein SELMODRAFT_78745, partial [Selaginella moellendorffii]
 gb|EFJ36519.1| hypothetical protein SELMODRAFT_78745, partial [Selaginella moellendorffii]
Length=320

 Score = 76.6 bits (187),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFND-VDQNSVEHAETVIATNYYGP  453
            FH LDV    SI +FA W    F  LDILVNNA +S N+ +   +VE ++ VI+TN+YG 
Sbjct  63   FHVLDVRSTSSIQNFAKWIETKFGGLDILVNNAGISRNEHLGNPTVEGSKDVISTNFYGT  122

Query  454  KLLIAALLPMFRCSS-STARILNISSRLGQFNKLQN  558
            +++   LL + R  S   ARI+N+SS   + + L+N
Sbjct  123  RMVTECLLHLMRSQSHHGARIINVSSATSRMDALRN  158


 Score = 58.5 bits (140),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            RWWS++T+A+VTG+NKG+GFA+ + LA  G+  VLTAR  Q  L
Sbjct  1    RWWSKDTIAVVTGSNKGLGFAIAQGLALKGVMTVLTARDEQRGL  44



>ref|NP_001045283.1| Os01g0929500 [Oryza sativa Japonica Group]
 dbj|BAF07197.1| Os01g0929500, partial [Oryza sativa Japonica Group]
Length=300

 Score = 94.4 bits (233),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 66/104 (63%), Gaps = 4/104 (4%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V + +LDV+D  S+  FA+W   T   + +LVNNA V+FN    NSVE AE VI TNY+G
Sbjct  72   VEWRQLDVTDAASVEGFATWVERTHGGVHVLVNNAGVNFNRGADNSVEFAEQVIETNYFG  131

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQF----NKLQNPKLR  570
             K +I A++P+   S    RI+N+SSRLG+     N++ +P LR
Sbjct  132  TKRMIEAMMPLMITSPHGGRIVNVSSRLGRVNGRRNRIGDPSLR  175


 Score = 41.2 bits (95),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  VAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            VA+VTGAN+GIG+   ++LA  GL VVLT+R
Sbjct  19   VAVVTGANRGIGYEAARQLATHGLHVVLTSR  49



>gb|EMT26587.1| hypothetical protein F775_43997 [Aegilops tauschii]
Length=197

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  364  VNNAAVSFNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQF  543
            VNNAAVSFN++D NSVEHAETV+ TN+YG KLL  ALLP+FR S +T+RILNISS+LG  
Sbjct  4    VNNAAVSFNEIDTNSVEHAETVLNTNFYGTKLLTEALLPLFRRSPATSRILNISSQLGLL  63

Query  544  NKLQNPKLR  570
            NK++NP LR
Sbjct  64   NKVRNPSLR  72



>ref|XP_002983227.1| hypothetical protein SELMODRAFT_271617 [Selaginella moellendorffii]
 gb|EFJ15569.1| hypothetical protein SELMODRAFT_271617 [Selaginella moellendorffii]
Length=276

 Score = 85.9 bits (211),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDVS   S++  A+W +  F A+DILVNNA +     + N VE A+ +  TNYYG K
Sbjct  59   FHQLDVSSSQSVSAMAAWLQQKFGAIDILVNNAGIKSKGFE-NEVEGAQALFETNYYGAK  117

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFN  546
             +  A+LP+ +      RI+NISSRLGQ N
Sbjct  118  RMAQAVLPIIKPG---GRIINISSRLGQLN  144


 Score = 48.9 bits (115),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  116  EETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            E  VA+VTG+NKGIGF +V++LA  G T VLTAR  +  +
Sbjct  5    ESKVAVVTGSNKGIGFEIVRQLASKGFTTVLTARDAKRGI  44



>gb|EMS52254.1| (+)-neomenthol dehydrogenase [Triticum urartu]
Length=230

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  364  VNNAAVSFNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQF  543
            VNNAAVSFN++D NSVEHAETV+ TN+YG KLL  ALLP+FR S +T+RILNISS+LG  
Sbjct  37   VNNAAVSFNEIDTNSVEHAETVLNTNFYGTKLLTEALLPLFRRSPATSRILNISSQLGLL  96

Query  544  NKLQNPKLR  570
            NK++NP LR
Sbjct  97   NKVRNPSLR  105



>ref|XP_002977743.1| hypothetical protein SELMODRAFT_107407, partial [Selaginella 
moellendorffii]
 gb|EFJ21081.1| hypothetical protein SELMODRAFT_107407, partial [Selaginella 
moellendorffii]
Length=319

 Score = 77.8 bits (190),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQ-NSVEHAETVIATNYYGP  453
            FHRLDV+   SI +FA W +  F  LDILVNNA +S        ++E+++ VI TNY   
Sbjct  64   FHRLDVTSASSIQEFARWIKTKFGGLDILVNNAGISGATPGALTNLENSKAVIDTNYLAV  123

Query  454  KLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKL  567
            + L  +L+ + R SS  ARI+N+SS   + + LQN  L
Sbjct  124  RKLTESLISLMRPSSHGARIVNVSSGTSRLDALQNQAL  161


 Score = 55.8 bits (133),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            RWWS ET+A+VTG+NKG+G A+ + LA  G+T +LTAR
Sbjct  2    RWWSRETIAVVTGSNKGLGLAIARGLAMEGVTTILTAR  39



>ref|XP_002979536.1| hypothetical protein SELMODRAFT_110901, partial [Selaginella 
moellendorffii]
 gb|EFJ19425.1| hypothetical protein SELMODRAFT_110901, partial [Selaginella 
moellendorffii]
Length=325

 Score = 77.8 bits (190),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQ-NSVEHAETVIATNYYGP  453
            FHRLDV+   SI +FA W +  F  LDILVNNA +S        ++E+++ VI TNY   
Sbjct  64   FHRLDVTSASSIQEFARWIKTKFGGLDILVNNAGISGATPGALTNLENSKAVIDTNYLAV  123

Query  454  KLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKL  567
            + L  +L+ + R SS  ARI+N+SS   + + LQN  L
Sbjct  124  RKLTESLISLMRPSSHGARIVNVSSGTSRLDALQNQAL  161


 Score = 55.5 bits (132),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            RWWS ET+A+VTG+NKG+G A+ + LA  G+T +LTAR
Sbjct  2    RWWSRETIAVVTGSNKGLGLAIARGLAMEGVTTILTAR  39



>ref|XP_009771379.1| PREDICTED: carbonyl reductase [NADPH] 1 isoform X2 [Nicotiana 
sylvestris]
Length=298

 Score =   100 bits (248),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LD+ D  SI  F+ W +  +  L+IL+NNA V+FN    NSVE AETVI TNY+G
Sbjct  72   VVFHQLDIVDPASIQTFSDWIKEKYGGLNILINNAGVNFNFGSDNSVEFAETVIQTNYFG  131

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K +I A++P+ R S   ARI+N++SRLG+ N  +N
Sbjct  132  TKSMIKAMIPLMRPSPFGARIINVTSRLGRLNGRRN  167


 Score = 32.7 bits (73),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +2

Query  149  KGIGFALVKRLAELGLTVVLTARVTQ  226
            +GIGF +  +LA  GLTVVLT+R T+
Sbjct  31   RGIGFEIAHQLASHGLTVVLTSRDTR  56



>ref|XP_002980278.1| hypothetical protein SELMODRAFT_112669, partial [Selaginella 
moellendorffii]
 gb|EFJ18538.1| hypothetical protein SELMODRAFT_112669, partial [Selaginella 
moellendorffii]
Length=320

 Score = 75.5 bits (184),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFND-VDQNSVEHAETVIATNYYGP  453
            FH LDV    SI +FA W    F  LDILVNNA +S N+ +   +VE ++ VI+TN+YG 
Sbjct  63   FHVLDVRSPSSIQNFAKWIENKFGGLDILVNNAGISRNEHLGNPTVEGSKDVISTNFYGT  122

Query  454  KLLIAALLPMFRCSS-STARILNISSRLGQFNKLQN  558
            +++   LL + R  S   ARI+N+SS   + + L+N
Sbjct  123  RMVTECLLHLMRSQSHHGARIINVSSATSRMDALRN  158


 Score = 57.4 bits (137),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            RWWS++T+A+VTG+NKG+GF + + LA  G+  VLTAR  Q  L
Sbjct  1    RWWSKDTIAVVTGSNKGLGFGIAQGLALKGVMTVLTARDEQRGL  44



>ref|XP_010555589.1| PREDICTED: (+)-neomenthol dehydrogenase isoform X2 [Tarenaya 
hassleriana]
Length=262

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H+LD+ D  SI +F  W    +  +D+L+NNA V++N    NSV HAE VI+TNYYG K 
Sbjct  39   HQLDILDPSSIEEFCQWITEKYGGVDVLINNAGVNYNVGSDNSVGHAEMVISTNYYGTKN  98

Query  460  LIAALLPMFRCSSSTARILNISSRLGQFN----KLQNPKLR  570
            +I A+LP+ R S+  ARI+N++SRLG+ N    KL+N  +R
Sbjct  99   IIKAMLPLMRPSAPGARIVNVTSRLGRLNGRHSKLENDAVR  139



>ref|XP_001766843.1| predicted protein [Physcomitrella patens]
 gb|EDQ68245.1| predicted protein, partial [Physcomitrella patens]
Length=286

 Score = 74.7 bits (182),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 3/84 (4%)
 Frame = +1

Query  280  HRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKL  459
            H LDV    S   FA W + T+  LDILVNNA V+   V+   VE+ + V+ TNY+G K 
Sbjct  60   HPLDVQSEDSARKFADWIKYTYGGLDILVNNAGVAKRAVN---VENVDLVMQTNYFGVKN  116

Query  460  LIAALLPMFRCSSSTARILNISSR  531
            +  ALLP+FR SS+ +R++ ++SR
Sbjct  117  VTQALLPLFRPSSAGSRVVIVASR  140


 Score = 57.0 bits (136),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  RWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            RWW+++ V +VTGANKGIGF L ++LA+ GLT VLT+R
Sbjct  1    RWWTKDMVVVVTGANKGIGFELTRQLAKKGLTTVLTSR  38



>gb|EAZ31223.1| hypothetical protein OsJ_15322 [Oryza sativa Japonica Group]
Length=214

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  361  LVNNAAVSFNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQ  540
            +VNNAAVSFN++D NSVEHAETV+ TN+YG K+L  ALLP+FR S +T+RILNISS+LG 
Sbjct  1    MVNNAAVSFNEIDTNSVEHAETVLRTNFYGAKMLTEALLPLFRRSPATSRILNISSQLGL  60

Query  541  FNKLQNPKLR  570
             NK+ +P+L+
Sbjct  61   LNKVSDPELK  70



>ref|XP_008661479.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=328

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  358  ILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLG  537
            I VNNAAVSFN++D NSVEHAETV+ TN+YG K+L  ALLP+FR SS+T+RILNISS+LG
Sbjct  135  IKVNNAAVSFNEIDTNSVEHAETVLRTNFYGAKMLTEALLPLFRQSSATSRILNISSQLG  194

Query  538  QFNKLQNPKLR  570
              NK+ +P L+
Sbjct  195  LLNKVGDPSLK  205



>ref|XP_008661480.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=319

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  355  DILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRL  534
            D  VNNAAVSFN++D NSVEHAETV+ TN+YG K+L  ALLP+FR SS+T+RILNISS+L
Sbjct  125  DEEVNNAAVSFNEIDTNSVEHAETVLRTNFYGAKMLTEALLPLFRQSSATSRILNISSQL  184

Query  535  GQFNKLQNPKLR  570
            G  NK+ +P L+
Sbjct  185  GLLNKVGDPSLK  196



>ref|XP_002979924.1| hypothetical protein SELMODRAFT_111807 [Selaginella moellendorffii]
 gb|EFJ18794.1| hypothetical protein SELMODRAFT_111807 [Selaginella moellendorffii]
Length=310

 Score = 75.1 bits (183),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 60/94 (64%), Gaps = 5/94 (5%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            +H+LD++   S+   A W   ++  ++IL+NNA V  N +    +E A+ V+ TNYYG K
Sbjct  62   YHQLDITSPDSVDALADWVSRSYGRIEILINNAGV--NSIGVPDLEQAKYVVETNYYGTK  119

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I A++P+ +     ARI+N+SS++G F+ L+N
Sbjct  120  RVIEAMVPLLKPG---ARIVNVSSKVGDFSYLKN  150


 Score = 55.5 bits (132),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WWS++T+A+VTGANKGIG  L + LA  GLT +LT+R
Sbjct  2    WWSKDTIALVTGANKGIGLQLARELARRGLTTILTSR  38



>ref|XP_007139902.1| hypothetical protein PHAVU_008G068200g [Phaseolus vulgaris]
 gb|ESW11896.1| hypothetical protein PHAVU_008G068200g [Phaseolus vulgaris]
Length=294

 Score = 83.6 bits (205),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 64/120 (53%), Gaps = 21/120 (18%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSV-------------  411
            V FH+LDV+D  SI   A++ +  F  LDILVNNA VS   VD +++             
Sbjct  59   VVFHQLDVTDPKSIESLANFIKTQFGKLDILVNNAGVSGTSVDHDAIAAAGEKLGSVDWR  118

Query  412  -------EHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
                   E AE+ I TNYYG KL+  A +P+   S S  RI+N+SS +G+  K+ N   R
Sbjct  119  KFAHETYESAESSIRTNYYGAKLMCEAFIPLLELSDS-PRIVNVSSVMGKLEKIPNESAR  177


 Score = 46.6 bits (109),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIGF + K+L   G+TVVLTAR  +  + 
Sbjct  9    AVVTGANKGIGFGICKQLISNGITVVLTARDEKRGIE  45



>gb|ABK26346.1| unknown [Picea sitchensis]
Length=322

 Score = 69.7 bits (169),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 60/124 (48%), Gaps = 24/124 (19%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEH-----------  417
            V FH LD+    S+  FA W +  F  LDIL+NNA +    VD + +E            
Sbjct  80   VVFHTLDIQRDDSVTAFAQWLKNEFGGLDILINNAGLGGAKVDWDLLEKRQMDFRKILED  139

Query  418  -------------AETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
                         A+  + TNYYG K +  AL+P+ + S + ARI+N+SS LG    L++
Sbjct  140  GSCAEALTEDEETAKECLGTNYYGTKRISKALIPLLKPSIAEARIVNVSSVLGLLKFLRS  199

Query  559  PKLR  570
              L+
Sbjct  200  ETLQ  203


 Score = 59.7 bits (143),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQE  229
            WW +ETVA+VTGAN+GIG  +V+ LA+ G+TVVLTAR  Q+
Sbjct  22   WWRKETVAVVTGANRGIGTEIVRLLADKGITVVLTARCRQQ  62



>ref|XP_002987405.1| hypothetical protein SELMODRAFT_126117 [Selaginella moellendorffii]
 gb|EFJ11492.1| hypothetical protein SELMODRAFT_126117 [Selaginella moellendorffii]
Length=310

 Score = 72.4 bits (176),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 58/94 (62%), Gaps = 5/94 (5%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            +H+LD++   S+   A W   ++ +++IL+NNA V  N +    +E A+ V+ TNYYG K
Sbjct  62   YHQLDITSPDSVDALADWVSRSYGSIEILINNAGV--NSIGVPDLEQAKYVVETNYYGTK  119

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             +I A++P+ +     ARI+N+SS+ G    L+N
Sbjct  120  RVIEAMVPLLKPG---ARIVNVSSKAGDLAYLKN  150


 Score = 55.5 bits (132),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WWS++T+ +VTGANKGIG  LV+ LA  GLT +LT+R
Sbjct  2    WWSKDTIVLVTGANKGIGLQLVRELARRGLTTILTSR  38



>ref|XP_002962657.1| hypothetical protein SELMODRAFT_78232, partial [Selaginella moellendorffii]
 gb|EFJ36120.1| hypothetical protein SELMODRAFT_78232, partial [Selaginella moellendorffii]
Length=183

 Score = 83.6 bits (205),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFND-VDQNSVEHAETVIATNYYGP  453
            FH LDV    SI +FA W    F+ +DILVNNA +S ND +   +VE ++ VI+TNYYG 
Sbjct  56   FHVLDVRSPSSIQNFAKWIETKFNGVDILVNNAGISRNDHLGNPTVESSKDVISTNYYGT  115

Query  454  KLLIAALLPMFRCSSS-TARILNISSRLGQFNKLQN  558
            +++I  LLP+ R  S   +RI+N+SS   + + L+N
Sbjct  116  RMVIECLLPLLRSQSPHGSRIINVSSATSRMDALRN  151


 Score = 43.9 bits (102),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  125  VAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            +A+VTG+NKG+GFA+ + LA  G+T +LT+R  Q  L
Sbjct  1    IAVVTGSNKGLGFAIAQGLALKGVTTILTSRDEQRGL  37



>ref|XP_002994618.1| hypothetical protein SELMODRAFT_138880 [Selaginella moellendorffii]
 gb|EFJ04318.1| hypothetical protein SELMODRAFT_138880 [Selaginella moellendorffii]
Length=321

 Score = 71.6 bits (174),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 57/90 (63%), Gaps = 5/90 (6%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            +H+LD++   S+   A W   ++  ++IL+NNA V  N +    +E A+ V+ TNYYG K
Sbjct  62   YHQLDITSPDSVDALADWVSRSYGRIEILINNAGV--NSIGVPDLEQAKYVVETNYYGTK  119

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFN  546
             +I A++P+ +     ARI+N+SS++G F+
Sbjct  120  RVIEAMVPLLKPG---ARIVNVSSKVGDFS  146


 Score = 55.8 bits (133),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WWS++T+A+VTGANKGIG  L + LA  GLT +LT+R
Sbjct  2    WWSKDTIALVTGANKGIGLQLARELARRGLTTILTSR  38



>ref|XP_011091821.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Sesamum indicum]
Length=350

 Score = 70.9 bits (172),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 59/118 (50%), Gaps = 23/118 (19%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS----------------------  384
            V FH+LDV+D  SI   A + +  F  LDILVNNA +S                      
Sbjct  113  VIFHQLDVTDLESIFSLAEFIKSQFGKLDILVNNAGISGAIFHVEKIEAVGPFIREANVN  172

Query  385  FNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
            ++D+   + E A   + TNYYG K L  ALLP+ R S S  RI+N+SS  G+   + N
Sbjct  173  WDDIVTQTYEAAAEGLQTNYYGAKRLSEALLPLLRLSDS-PRIVNVSSASGKLKYITN  229


 Score = 56.6 bits (135),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 10/75 (13%)
 Frame = +2

Query  14   HYCLLITHHFFPAAMASILSQYSSPSLPKTRWWSEETVAIVTGANKGIGFALVKRLAELG  193
            H+ LLI+H    ++MA    + SS  +  TR+      A+V+GANKGIGF + ++LA  G
Sbjct  35   HFLLLISHRHSHSSMA----EASSTVIKATRY------AVVSGANKGIGFEICRQLASHG  84

Query  194  LTVVLTARVTQEALR  238
            +TVVLTAR   + L+
Sbjct  85   ITVVLTARDENKGLQ  99



>ref|XP_010025877.1| PREDICTED: (+)-neomenthol dehydrogenase [Eucalyptus grandis]
Length=245

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  358  ILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLG  537
            I VNNAAVSFND+ +NSV++AE V+ TN+YG KLL  ALLPMFR S S  RILN+SSRLG
Sbjct  53   IQVNNAAVSFNDIHENSVDNAELVVKTNFYGSKLLTEALLPMFRRSPSIGRILNVSSRLG  112

Query  538  QFNKLQNPKL  567
              NK++NP +
Sbjct  113  SVNKVRNPNM  122



>ref|XP_002973095.1| hypothetical protein SELMODRAFT_173170 [Selaginella moellendorffii]
 gb|EFJ25469.1| hypothetical protein SELMODRAFT_173170 [Selaginella moellendorffii]
Length=333

 Score = 71.6 bits (174),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTF-SALDILVNNAAVSFNDVDQNSVEHAETVIATNYY  447
            V +HRLDV D  S+ + A W    + S +DIL+NNA V    +D++ +E A T+I TNYY
Sbjct  60   VVYHRLDVCDAGSVEEIARWIAAEYPSGIDILINNAGVMLL-LDRDRLEAARTIIGTNYY  118

Query  448  GPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
            G K    A+LP+ +      RI+N++S+ G    ++N
Sbjct  119  GLKRTTEAILPLLK---RGGRIINMNSKAGDIAFVKN  152


 Score = 53.9 bits (128),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WWS++T+A+VTGANKG+G  +V+ LA  G+T +LT+R
Sbjct  5    WWSKDTIALVTGANKGLGLQIVRELASRGITTILTSR  41



>ref|XP_006829842.1| hypothetical protein AMTR_s00119p00110100 [Amborella trichopoda]
 gb|ERM97258.1| hypothetical protein AMTR_s00119p00110100 [Amborella trichopoda]
Length=310

 Score = 80.1 bits (196),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 66/127 (52%), Gaps = 27/127 (21%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVD-----------------  399
            V FH+LDV D  SI+ FA + +  +  LDILVNNAA S   VD                 
Sbjct  67   VTFHQLDVRDPISISSFAKFIQIQYGKLDILVNNAAASGVSVDAEALRAMNIDPECWLSG  126

Query  400  ----------QNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNK  549
                      + + E AE  + TNYYG K L+ AL+P+ + S S A ++N++S  G+  +
Sbjct  127  KATNMVQWVVRQTYELAEECLDTNYYGLKRLVEALVPLLQLSDSGANLVNVTSLRGELKR  186

Query  550  LQNPKLR  570
            + NPK+R
Sbjct  187  MPNPKVR  193


 Score = 45.4 bits (106),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALRLPS  247
            A+VTGAN+GIG  +V++LA  G+ V+LT+R T+  ++  S
Sbjct  18   AVVTGANRGIGLEIVRQLASQGINVILTSRNTERGIKATS  57



>ref|XP_002976772.1| hypothetical protein SELMODRAFT_443296 [Selaginella moellendorffii]
 gb|EFJ22441.1| hypothetical protein SELMODRAFT_443296 [Selaginella moellendorffii]
Length=333

 Score = 71.6 bits (174),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTF-SALDILVNNAAVSFNDVDQNSVEHAETVIATNYY  447
            V +HRLDV D  S+ + A W    + S +DIL+NNA V    +D++ +E A T+I TNYY
Sbjct  60   VVYHRLDVCDAGSVEEIARWIAAEYPSGIDILINNAGVMLL-LDRDRLEAARTIIGTNYY  118

Query  448  GPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
            G K    A+LP+ +      RI+N++S+ G    ++N
Sbjct  119  GLKRTTEAILPLLK---RGGRIINMNSKAGDIAFVKN  152


 Score = 53.9 bits (128),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  WWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            WWS++T+A+VTGANKG+G  +V+ LA  G+T +LT+R
Sbjct  5    WWSKDTIALVTGANKGLGLQIVRELASRGITTILTSR  41



>gb|KHM99404.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=297

 Score = 77.8 bits (190),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 64/120 (53%), Gaps = 21/120 (18%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSV-------------  411
            V FH+LDV+D  SI   A++ +  F  LDILVNNA +    VD++++             
Sbjct  62   VVFHQLDVTDPKSIESLANFIKTQFGKLDILVNNAGIHGAYVDRDALAAAGEKVANVDWR  121

Query  412  -------EHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
                   E AE  I TNYYG KL+  AL+P+    S T RI+N+SS +G+  K+ N   R
Sbjct  122  KISTENFEAAEAGIRTNYYGVKLMCEALIPLLEL-SGTPRIVNVSSSMGKLEKIPNAWAR  180


 Score = 47.8 bits (112),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIGF + K+L   G+TVVLTAR  +  L 
Sbjct  12   AVVTGANKGIGFGICKQLVSNGITVVLTARDEKRGLE  48



>ref|XP_009400596.1| PREDICTED: uncharacterized protein LOC103984761 [Musa acuminata 
subsp. malaccensis]
Length=911

 Score = 81.6 bits (200),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 66/129 (51%), Gaps = 30/129 (23%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQN---------------  405
            + FH+LDV+D  SIA  A + R  F  LDILVNNAAV    VD +               
Sbjct  667  IIFHQLDVTDASSIASLADFIRTQFGKLDILVNNAAVGALTVDMDALKASKPTDDENTQD  726

Query  406  --------------SVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQF  543
                          S E AET + TNYYG K +I A +P+ + SS + RI+N+SS LGQ 
Sbjct  727  TGDIPDWLKPHVVQSFEMAETCLQTNYYGAKAVIKAFIPLLQ-SSLSGRIINVSSTLGQL  785

Query  544  NKLQNPKLR  570
              + N +L+
Sbjct  786  RVISNERLQ  794


 Score = 42.4 bits (98),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 5/41 (12%)
 Frame = +2

Query  95   PKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P+  W     +A+VTGANKGIG  + ++LA  G+ V+LTAR
Sbjct  612  PRQNW-----IAVVTGANKGIGLEVCRQLAFNGVKVILTAR  647


 Score = 67.4 bits (163),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 22/121 (18%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAV-----------SFNDVDQNSVEH  417
            V FH+LDV+D  S+A  A + R  F  LD+LVNNAAV           SF  V     ++
Sbjct  65   VLFHQLDVADSASVASLADFVRDQFGKLDVLVNNAAVSGLALSPEILSSFEQVRDRLTDY  124

Query  418  AETVIAT----------NYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKL  567
            A ++  T          NYYG K +  AL+P+ + SS + RI+N+SS  G+   +   ++
Sbjct  125  ANSITETYDMVEECLYINYYGTKAVTEALIPLLQ-SSQSPRIVNLSSFYGRLRYIPGDRI  183

Query  568  R  570
            +
Sbjct  184  K  184


 Score = 39.7 bits (91),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  113  SEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEA  232
            + + +A+VTGANKGIG  + ++L   G  V+LTAR  Q  
Sbjct  9    TSKMIALVTGANKGIGLEICRQLLSKGSMVILTARDEQRG  48


 Score = 42.4 bits (98),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  125  VAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            +A+VTGANKGIG    ++L   G TV+LTAR  Q  L
Sbjct  321  IALVTGANKGIGLETCRQLLSKGATVILTARDEQRGL  357


 Score = 42.0 bits (97),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAV  381
            V FH+LDV+D  S++  A +    F  LD+LVNNAAV
Sbjct  371  VLFHQLDVADSASVSSLAGFIHDQFGKLDVLVNNAAV  407



>gb|KHN29382.1| (+)-neomenthol dehydrogenase [Glycine soja]
Length=396

 Score = 75.9 bits (185),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 63/118 (53%), Gaps = 21/118 (18%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS--------------------FNDV  396
            FH+LDV D  S++  A + +  F  LDILVNNAAV+                    +N+V
Sbjct  61   FHQLDVDDPASVSALADFIKTEFGKLDILVNNAAVTGGKLLDADAFLRKRNGEQIDWNEV  120

Query  397  DQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
               + E AE  + TN+YG K +  ALLP+ + S+S  RI+NISSR G F  + N   R
Sbjct  121  GYETYELAEQCVETNFYGVKRVTEALLPLLQLSTS-PRIVNISSRAGLFKNIPNEWAR  177


 Score = 47.8 bits (112),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIGF + K+LA  G+ VVLTAR  +   +
Sbjct  9    AVVTGANKGIGFGMCKKLASSGIVVVLTARDEKNGFK  45


 Score = 45.8 bits (107),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  131  IVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            +VTGANKGIGF + K+L   G+TVVLTAR  +  L 
Sbjct  289  VVTGANKGIGFGICKQLVSSGITVVLTARDEKRGLE  324


 Score = 45.4 bits (106),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHA  420
            V FH+LDV+D  SI   A++ +  F  LDILVNNA +    VD++++  A
Sbjct  339  VVFHQLDVTDPKSIESLANFIKTQFGKLDILVNNAGIHGAYVDRDALAAA  388



>ref|XP_003564994.1| PREDICTED: carbonyl reductase [NADPH] 1 [Brachypodium distachyon]
 ref|XP_010232773.1| PREDICTED: carbonyl reductase [NADPH] 1 [Brachypodium distachyon]
Length=324

 Score = 89.4 bits (220),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = +1

Query  286  LDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPKLLI  465
            LDV+D  S+  F +W   T   + +LVNNA V+FN    NSVE AE VI TNY+G K +I
Sbjct  102  LDVADAASLEAFGAWTARTHGGIHVLVNNAGVNFNRGADNSVEFAEQVIETNYFGTKRMI  161

Query  466  AALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             A+LP+ + S    RI+N+SSRLG+ N  +N
Sbjct  162  EAMLPLLKPSPYGGRIVNVSSRLGRVNGRRN  192


 Score = 33.9 bits (76),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 6/50 (12%)
 Frame = +2

Query  86   PSLPKTRWWS------EETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            P  P  RWW          VA+VTGA++GIG  + ++LA  GL VVL +R
Sbjct  27   PYEPHQRWWDLLAPAPARAVAVVTGASRGIGREIARQLALHGLHVVLASR  76



>ref|XP_006588341.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Glycine max]
Length=296

 Score = 75.5 bits (184),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 63/120 (53%), Gaps = 23/120 (19%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS----------------------FN  390
            FH+LDV D  S++  A + +  F  LDILVNNAAV+                      +N
Sbjct  61   FHQLDVDDPASVSALADFIKTEFGKLDILVNNAAVTGGKLLDADAFLRKVGLNGEQIDWN  120

Query  391  DVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
            +V   + E AE  + TN+YG K +  ALLP+ + S+S  RI+NISSR G F  + N   R
Sbjct  121  EVGYETYELAEQCVETNFYGVKRVTEALLPLLQLSTS-PRIVNISSRAGLFKNIPNEWAR  179


 Score = 47.8 bits (112),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIGF + K+LA  G+ VVLTAR  +   +
Sbjct  9    AVVTGANKGIGFGMCKKLASSGIVVVLTARDEKNGFK  45



>ref|XP_004510823.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Cicer arietinum]
Length=274

 Score = 74.3 bits (181),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 57/96 (59%), Gaps = 6/96 (6%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LDV+D +SIA   ++ R  F  LDILVNNA +          E  E  I TNYYG
Sbjct  64   VLFHQLDVTDPNSIASLENFIRTHFGKLDILVNNAGLL-----TEKEELTEACIKTNYYG  118

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K L  AL+P+ + SSS  +I+N+SS +G+   + N
Sbjct  119  AKGLTKALIPLLQFSSS-PKIVNVSSSMGRLENIPN  153


 Score = 48.9 bits (115),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 5/46 (11%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            T+W+     A+VTGANKGIGF + K+LA  G+TV++TAR  +  + 
Sbjct  5    TKWY-----AVVTGANKGIGFEICKQLASKGITVIVTARDERRGIE  45



>gb|KEH18925.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=557

 Score = 71.6 bits (174),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 23/118 (19%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSV-------------  411
            V FH+LDV D  SI  F  + +  F  LD+LVNNA +    VD  ++             
Sbjct  59   VVFHQLDVIDHASIRSFVDFIKNQFGNLDLLVNNAGIPGAQVDGEALAAANTAENGGQID  118

Query  412  ---------EHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
                     E  E  I TNYYG K L  AL+P+ + SSS  +++N+SS +G+  KL N
Sbjct  119  WSKIITQTYEETELGIKTNYYGAKDLTEALIPLLQLSSS-PKVVNVSSSMGKLEKLPN  175


 Score = 50.8 bits (120),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIGFA+ K+LA  G+TVVLTAR  +  L 
Sbjct  9    AVVTGANKGIGFAVCKQLASKGITVVLTARDEKRGLE  45


 Score = 71.6 bits (174),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 23/118 (19%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSV-------------  411
            V FH+LDV D  SI  F  + +  F  LD+LVNNA +    VD  ++             
Sbjct  319  VVFHQLDVIDHASIRSFVDFIKNQFGNLDLLVNNAGIPGAQVDGEALAAANTAENGGQID  378

Query  412  ---------EHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
                     E  E  I TNYYG K L  AL+P+ + SSS  +++N+SS +G+  KL N
Sbjct  379  WSKIITQTYEETELGIKTNYYGAKDLTEALIPLLQLSSS-PKVVNVSSSMGKLEKLPN  435


 Score = 49.3 bits (116),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  131  IVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            +VTGANKGIGFA+ K+LA  G+TVVLTAR  +  L 
Sbjct  270  VVTGANKGIGFAVCKQLASKGITVVLTARDEKRGLE  305



>ref|XP_010685513.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Beta vulgaris subsp. 
vulgaris]
Length=303

 Score = 72.0 bits (175),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 27/127 (21%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSV-------------  411
            V FH++DV++ +SI     + +  F  LDIL+NNA  S  +VD+  +             
Sbjct  60   VVFHQVDVTNINSITLLVHFIKAKFGRLDILINNAGASGMEVDEEGLRALHIDPATWISG  119

Query  412  --------------EHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNK  549
                          E AE    TNYYG K +  ALLP+ + S++++RI+NISS  G+  +
Sbjct  120  KAANLVQGVMKTTYEKAEECFNTNYYGTKSVTEALLPLLKLSTTSSRIVNISSLRGELWR  179

Query  550  LQNPKLR  570
            + N ++R
Sbjct  180  IPNDQIR  186


 Score = 50.8 bits (120),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  113  SEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALRLPS  247
              E +A+VTGANKGIGF +V++LA  G+ VVLTAR  Q  +   S
Sbjct  6    ENEMIAVVTGANKGIGFEIVRQLAAAGVVVVLTARDEQRGVEATS  50



>ref|XP_009338796.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri]
Length=296

 Score = 71.2 bits (173),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 23/122 (19%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS----------------------  384
            V FH+LDV++  +IA  A + +  F  LDILVNNA V                       
Sbjct  59   VVFHQLDVANPSTIAPLAEFIKTQFGKLDILVNNAGVGGSILDADAFKAEIASGWKETID  118

Query  385  FNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPK  564
            +N V   + E A+  +  NYYG K    AL+P+ R S S  RI+N+SS +G  NK+ + +
Sbjct  119  WNKVMTETYELAKECVQINYYGAKRTTEALIPLLRLSES-PRIVNVSSSMGNLNKIPSDR  177

Query  565  LR  570
            ++
Sbjct  178  VK  179


 Score = 51.6 bits (122),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIGF +VK+LA  G+TVVLTAR  +  L 
Sbjct  9    AVVTGANKGIGFGIVKQLASDGITVVLTARDEKRGLE  45



>ref|XP_005707751.1| carbonyl reductase (NADPH) [Galdieria sulphuraria]
 gb|EME31231.1| carbonyl reductase (NADPH) [Galdieria sulphuraria]
Length=273

 Score = 76.6 bits (187),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH+LD++   SI+ FA+W +  F  LDILVNNA +++   D    E A+  +  NY+G
Sbjct  59   VLFHQLDITKEPSISAFANWLKDRFQGLDILVNNAGMAYRG-DAFGYEVAKDTVDCNYFG  117

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
               +I  L P+ R     AR++N+SSR G+F++L +P+LR
Sbjct  118  TLHVIEKLSPLLR---EGARVVNVSSRAGKFSRL-SPQLR  153


 Score = 45.8 bits (107),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = +2

Query  125  VAIVTGANKGIGFALVKRLAE--LGLTVVLTARVTQEA  232
            VA+VTGANKGIG+A+V++LA+  L LTVVLT+R  +  
Sbjct  8    VAVVTGANKGIGYAIVRQLADPNLSLTVVLTSRDEERG  45



>gb|KEH18924.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=297

 Score = 71.6 bits (174),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 23/118 (19%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSV-------------  411
            V FH+LDV D  SI  F  + +  F  LD+LVNNA +    VD  ++             
Sbjct  59   VVFHQLDVIDHASIRSFVDFIKNQFGNLDLLVNNAGIPGAQVDGEALAAANTAENGGQID  118

Query  412  ---------EHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
                     E  E  I TNYYG K L  AL+P+ + SSS  +++N+SS +G+  KL N
Sbjct  119  WSKIITQTYEETELGIKTNYYGAKDLTEALIPLLQLSSS-PKVVNVSSSMGKLEKLPN  175


 Score = 50.8 bits (120),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIGFA+ K+LA  G+TVVLTAR  +  L 
Sbjct  9    AVVTGANKGIGFAVCKQLASKGITVVLTARDEKRGLE  45



>ref|XP_004510835.1| PREDICTED: uncharacterized protein LOC101496709 [Cicer arietinum]
Length=599

 Score = 73.2 bits (178),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 62/108 (57%), Gaps = 13/108 (12%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS-------FNDVDQ-----NSVE  414
            V FH+LDV++  S+A  A + +  F  LDILVNNA ++        ++ D+      + +
Sbjct  372  VLFHQLDVANAASVATLADFVKSKFGKLDILVNNAGITGTSPLQALSEDDRRKGLTQTYK  431

Query  415  HAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             AE  +  NYYG KL   +LLP+ + S S  RI+N+SS LGQF  + N
Sbjct  432  LAEECLQINYYGAKLTTQSLLPLLKLSDS-PRIVNVSSTLGQFESIPN  478


 Score = 49.3 bits (116),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  113  SEETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            S E  A+VTGANKGIGF +V++LA  G+ VVLTAR  +  L+
Sbjct  317  SAERYAVVTGANKGIGFEIVRQLASSGIKVVLTARDEKRGLQ  358


 Score = 50.8 bits (120),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 57/113 (50%), Gaps = 25/113 (22%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS---FNDVD--------------  399
            V FH++DV++  SIA  A + +  F  LDILVNNA +S    ND D              
Sbjct  60   VVFHQVDVANAASIATLADFVKSKFGKLDILVNNAGISGTVINDKDLARLLIINPGALSE  119

Query  400  -------QNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLG  537
                     + E AE  +  NYYG K+   +LLP+ + S S  +I+N+SS LG
Sbjct  120  DEKKKAMTQTYELAEECLQINYYGAKITTQSLLPLLQLSDS-PKIVNVSSTLG  171


 Score = 42.7 bits (99),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIG  +V++LA  G+ VVLTAR  +  L+
Sbjct  10   AVVTGANKGIGVEIVRQLALSGIKVVLTARDEKRGLQ  46



>ref|XP_003608084.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
Length=264

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 61/74 (82%), Gaps = 4/74 (5%)
 Frame = +1

Query  361  LVNNAAVSFNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSST----ARILNISS  528
             VNNAAVSFN++D+NSV+HAE V+ TN+YGPKLLI ALLP+FRCSSS+     RILN+SS
Sbjct  61   FVNNAAVSFNELDENSVDHAENVMKTNFYGPKLLIEALLPLFRCSSSSNSSITRILNVSS  120

Query  529  RLGQFNKLQNPKLR  570
            RLG  +K+ N +++
Sbjct  121  RLGSLDKVTNVEMK  134



>ref|XP_002966142.1| hypothetical protein SELMODRAFT_143767 [Selaginella moellendorffii]
 gb|EFJ32169.1| hypothetical protein SELMODRAFT_143767 [Selaginella moellendorffii]
Length=313

 Score = 65.1 bits (157),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V+   L+++   S+  F  W +  F  +DILVNNA +  + V  N +E A+ V+  NYYG
Sbjct  62   VYASPLNITLPESVEAFGKWIQNKFGGIDILVNNAGLLLDPVHHN-LEEAKPVLEVNYYG  120

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             K  I  +LP+ R S    RI+N+S+   + + L N
Sbjct  121  TKRFIKEMLPLMRESDHGPRIVNLSTLGSRLDILGN  156


 Score = 57.0 bits (136),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  TRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            T+WWSE+TVA+VTGA KGIG  +VK LA  G++VVLT R
Sbjct  3    TQWWSEKTVAVVTGAGKGIGLEIVKALASRGISVVLTLR  41



>ref|XP_009343607.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri]
Length=299

 Score = 70.9 bits (172),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 23/122 (19%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS----------------------  384
            V FH+LDV++  +IA  A + +  F  LDILVNNA V                       
Sbjct  59   VVFHQLDVANPSTIAPLAEFIKTQFGKLDILVNNAGVGGSILDADAFKAEIASGWKETID  118

Query  385  FNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPK  564
            +N V   + E A+  +  NYYG K    AL+P+ R S S  RI+N+SS +G  NK+ + +
Sbjct  119  WNKVMTENYELAKECVQINYYGAKRTTEALIPLLRLSES-PRIVNVSSSMGNLNKIPSDR  177

Query  565  LR  570
            ++
Sbjct  178  VK  179


 Score = 51.2 bits (121),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIGF +VK+LA  G+TVVLTAR  +  L 
Sbjct  9    AVVTGANKGIGFGIVKQLASDGITVVLTARDEKRGLE  45



>ref|XP_009343598.1| PREDICTED: (+)-neomenthol dehydrogenase-like [Pyrus x bretschneideri]
Length=296

 Score = 70.9 bits (172),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 23/122 (19%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS----------------------  384
            V FH+LDV++  +IA  A + +  F  LDILVNNA V                       
Sbjct  59   VVFHQLDVANPSTIAPLAEFIKTQFGKLDILVNNAGVGGSILDADAFKAEIASGWKETID  118

Query  385  FNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPK  564
            +N V   + E A+  +  NYYG K    AL+P+ R S S  RI+N+SS +G  NK+ + +
Sbjct  119  WNKVMTENYELAKECVQINYYGAKRTTEALIPLLRLSES-PRIVNVSSSMGNLNKIPSDR  177

Query  565  LR  570
            ++
Sbjct  178  VK  179


 Score = 51.6 bits (122),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIGF +VK+LA  G+TVVLTAR  +  L 
Sbjct  9    AVVTGANKGIGFGIVKQLASDGITVVLTARDEKRGLE  45



>ref|XP_006652563.1| PREDICTED: salutaridine reductase-like [Oryza brachyantha]
Length=302

 Score = 78.6 bits (192),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 63/126 (50%), Gaps = 26/126 (21%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFND----VDQNSVE--------  414
            V FH+LD++D  S+A  A + +  F  LDILVNNAAV   D    VD N  +        
Sbjct  59   VVFHQLDITDSSSVARLADFLKARFGKLDILVNNAAVGGMDYAQGVDTNEEQFVGMEKMQ  118

Query  415  --------------HAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKL  552
                           A+  + TNYYG KL+I ALLP+   SSS  RI+N+SS  G    +
Sbjct  119  RIEWLRQQGRETHKAAKNGVQTNYYGTKLVIQALLPLLVKSSSEGRIVNVSSGFGLLRVI  178

Query  553  QNPKLR  570
             N  L+
Sbjct  179  SNEDLK  184


 Score = 43.1 bits (100),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  125  VAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            VA+VTG NKGIG  + ++LA  G+TVVLTAR
Sbjct  9    VAVVTGGNKGIGLEVCRQLAADGVTVVLTAR  39



>ref|XP_003600307.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 ref|XP_003627599.1| (+)-neomenthol dehydrogenase [Medicago truncatula]
 gb|AET02075.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=298

 Score = 70.5 bits (171),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 61/120 (51%), Gaps = 25/120 (21%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS---FNDVD--------------  399
            V F+++DV++  S+A  A + +  F  LDILVNNA +S    ND D              
Sbjct  59   VVFYQVDVANAASVATLADFVKSQFGKLDILVNNAGISGTVINDKDLATLLISNPGALTE  118

Query  400  -------QNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
                     + E AE  +  NYYG K+   +LLP+ + S S  RI+N+SS LG+   +QN
Sbjct  119  DEKKKAVTQTYELAEECLQINYYGAKITTESLLPLLKLSDS-PRIVNVSSTLGKLEGIQN  177


 Score = 51.6 bits (122),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  119  ETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            E +A+VTGANKGIGF +VK+LA  G+ VVLTAR  +  L
Sbjct  6    ERIAVVTGANKGIGFEIVKQLASAGIKVVLTARDEKRGL  44



>ref|XP_002320110.2| hypothetical protein POPTR_0014s07580g [Populus trichocarpa]
 gb|EEE98425.2| hypothetical protein POPTR_0014s07580g [Populus trichocarpa]
Length=300

 Score = 80.5 bits (197),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 66/121 (55%), Gaps = 22/121 (18%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS---------------------F  387
            V FH+LDV D  SIA    + +  F  LDILVNNAA+S                     +
Sbjct  63   VVFHQLDVVDPDSIASLVEFVKTKFGKLDILVNNAAISGVVLNADAFKRAFELSDGEEVW  122

Query  388  NDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKL  567
            N+++  S E AE  I TNYYG + ++ AL P+ + S S ARI+N++S+LG    + N ++
Sbjct  123  NEIETQSFELAEQCIKTNYYGVRGMVEALTPLLQLSDS-ARIINVTSKLGLLKNIPNGRV  181

Query  568  R  570
            +
Sbjct  182  K  182


 Score = 41.2 bits (95),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIG  + ++L   G+ VVLTAR  +  L 
Sbjct  12   AVVTGANKGIGLEICRQLTSHGIVVVLTARDEKRGLE  48



>ref|XP_003601313.1| Short-chain dehydrogenase/reductase [Medicago truncatula]
 gb|AES71564.1| short chain dehydrogenase/reductase [Medicago truncatula]
Length=306

 Score = 74.3 bits (181),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 63/128 (49%), Gaps = 28/128 (22%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVE------------  414
            V FH+LDV D  SI   A + +  F  LDIL+NNA  S  +VD+  ++            
Sbjct  62   VMFHQLDVLDALSIESLAKFIQHKFGRLDILINNAGASCVEVDKEGLKALNVDPATWLAG  121

Query  415  ----------------HAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFN  546
                             AE  + TNYYG K +  ALLP+ + S + ARI+N+SS  G+  
Sbjct  122  KVSNTLLQGVLTQTYKKAEECLNTNYYGVKRVTMALLPLLQLSPAKARIVNLSSLRGELK  181

Query  547  KLQNPKLR  570
            ++ N +LR
Sbjct  182  RIPNERLR  189


 Score = 47.8 bits (112),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            A+VTGANKGIG  +VK+LA LG+TVVLTAR
Sbjct  13   AVVTGANKGIGLEIVKQLAFLGVTVVLTAR  42



>ref|XP_007139903.1| hypothetical protein PHAVU_008G068300g, partial [Phaseolus vulgaris]
 gb|ESW11897.1| hypothetical protein PHAVU_008G068300g, partial [Phaseolus vulgaris]
Length=267

 Score = 74.3 bits (181),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 1/98 (1%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYGPK  456
            FH+LDV D  S+A  A + +  F  LDIL N   V +++V   + E AE  + TN+YG +
Sbjct  54   FHQLDVDDPASVAALAHFIKTKFGKLDILRNGEKVDWSEVGYQTYELAEQCVETNFYGVE  113

Query  457  LLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             +  AL+P+ + S+S  RI+NISSR G    + N   R
Sbjct  114  RITEALIPLLQLSTS-PRIINISSRAGLLKNIPNEWAR  150


 Score = 47.4 bits (111),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIGF + K+LA  G+ VVLTAR     L+
Sbjct  2    AVVTGANKGIGFGVCKKLASNGIVVVLTARDEGRGLK  38



>gb|KEH18922.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=298

 Score = 71.2 bits (173),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 61/122 (50%), Gaps = 25/122 (20%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSV-------------  411
            V FH+LDV D  SI  F  + +  F  LDILVNNA ++  +VD  ++             
Sbjct  59   VVFHQLDVIDAASIRSFVDFIKNQFGKLDILVNNAGITGAEVDGEALVAANIEENGGQID  118

Query  412  ---------EHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN--  558
                     E  E  I TNYYG K L  A +P+ + SSS  +++N+SS +G+   L N  
Sbjct  119  WSKIITQTYEQTELGIKTNYYGAKDLTEAFIPLLQLSSS-PKVVNVSSSMGKLENLPNGW  177

Query  559  PK  564
            PK
Sbjct  178  PK  179


 Score = 50.4 bits (119),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  122  TVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            T A+VTGANKGIGFA+  +LA  G+TVVLTAR  +  L 
Sbjct  7    TYAVVTGANKGIGFAVCNQLASKGITVVLTARDEKRGLE  45



>ref|XP_004298764.1| PREDICTED: short-chain dehydrogenase/reductase 2b-like [Fragaria 
vesca subsp. vesca]
Length=285

 Score = 77.8 bits (190),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 7/106 (7%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAV---SFNDVDQNSVEHAETV---I  432
            V FH+LDV++  +IA  A++    F  LDILVNNA V    +   D + V+  ET    +
Sbjct  63   VVFHQLDVTEPTTIASLANFLETQFGKLDILVNNAGVVGSVYLTADYDPVQTYETARDCL  122

Query  433  ATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQNPKLR  570
             TNYYG K L  AL+P+ + S + ARI+N+SS LGQ   + N K +
Sbjct  123  KTNYYGLKQLTEALVPLLQKSEA-ARIVNVSSGLGQLRNIGNEKAK  167


 Score = 43.9 bits (102),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  110  WSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            +  + +A+VTGANKGIG  + K+LA  G+ VVLTAR
Sbjct  8    FGSKKIAVVTGANKGIGLEISKQLAAKGVGVVLTAR  43



>gb|ACJ84741.1| unknown [Medicago truncatula]
Length=298

 Score = 70.5 bits (171),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 61/120 (51%), Gaps = 25/120 (21%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS---FNDVD--------------  399
            V F+++DV++  S+A  A + +  F  LDILVNNA +S    ND D              
Sbjct  59   VVFYQVDVANAASVATLADFVKSQFGKLDILVNNAGISGTVINDKDLATLLISNPGALTE  118

Query  400  -------QNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
                     + E AE  +  NYYG K+   +LLP+ + S S  RI+N+SS LG+   +QN
Sbjct  119  DEKKKAVTQTYELAEECLQINYYGAKITTESLLPLLKLSDS-PRIVNVSSTLGKLEGIQN  177


 Score = 50.8 bits (120),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  119  ETVAIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            E +A+VTGANKGIGF +VK+LA  G+ VVLTAR  +  L
Sbjct  6    ERIAVVTGANKGIGFEIVKQLAPAGIKVVLTARDEKRGL  44



>gb|KEH18926.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=391

 Score = 71.6 bits (174),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 23/118 (19%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSV-------------  411
            V FH+LDV D  SI  F  + +  F  LD+LVNNA +    VD  ++             
Sbjct  153  VVFHQLDVIDHASIRSFVDFIKNQFGNLDLLVNNAGIPGAQVDGEALAAANTAENGGQID  212

Query  412  ---------EHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
                     E  E  I TNYYG K L  AL+P+ + SSS  +++N+SS +G+  KL N
Sbjct  213  WSKIITQTYEETELGIKTNYYGAKDLTEALIPLLQLSSS-PKVVNVSSSMGKLEKLPN  269


 Score = 49.7 bits (117),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  131  IVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            +VTGANKGIGFA+ K+LA  G+TVVLTAR  +  L 
Sbjct  104  VVTGANKGIGFAVCKQLASKGITVVLTARDEKRGLE  139



>ref|XP_008374039.1| PREDICTED: salutaridine reductase-like [Malus domestica]
Length=303

 Score = 77.4 bits (189),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 64/124 (52%), Gaps = 25/124 (20%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAV-----------------------  381
            V FH+LDV+D  SIA  A + +     LDILVNNAAV                       
Sbjct  62   VVFHQLDVTDPSSIASLAEFLKTQLGKLDILVNNAAVVGSIFLTDDKEKLAIDDLIGPKA  121

Query  382  -SFNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
             + N V + + E A   + TNYYG K L  AL+P+ + S S ARI+N+SS+LGQ   + N
Sbjct  122  ANKNQVLKQTYETAGDCLKTNYYGIKQLTEALIPLLQQSDS-ARIVNVSSQLGQLRVIPN  180

Query  559  PKLR  570
             K +
Sbjct  181  EKAK  184


 Score = 43.5 bits (101),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  110  WSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            +  + +A+VTG NKGIGF + ++LA  G+ VVLTAR
Sbjct  6    FGSKRIAVVTGGNKGIGFEISRQLAANGVGVVLTAR  41



>gb|KEH24287.1| short chain dehydrogenase [Medicago truncatula]
Length=270

 Score = 74.3 bits (181),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 58/96 (60%), Gaps = 6/96 (6%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSVEHAETVIATNYYG  450
            V FH LDV D  SI+  A++ +  F  LDILVNNA +    + +N  E  E ++ TNYYG
Sbjct  66   VIFHHLDVVDPKSISSLANFIKIHFGKLDILVNNAGL----LTENE-ELTEAILKTNYYG  120

Query  451  PKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
            PK LI  L P+ + SSS  RI+N+SS +G+     N
Sbjct  121  PKGLIKTLFPLLQFSSS-PRIVNVSSTVGRLKYFPN  155


 Score = 46.6 bits (109),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTGANKGIGF +  +LA +G+TV++TAR     L+
Sbjct  11   AVVTGANKGIGFEICNQLASIGITVIVTARDECRGLQ  47



>ref|NP_001053401.1| Os04g0531900 [Oryza sativa Japonica Group]
 emb|CAE03870.2| OSJNBa0081C01.20 [Oryza sativa Japonica Group]
 emb|CAE04562.2| OSJNBb0039L24.1 [Oryza sativa Japonica Group]
 dbj|BAF15315.1| Os04g0531900 [Oryza sativa Japonica Group]
 dbj|BAG92290.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77695.1| hypothetical protein OsI_16758 [Oryza sativa Indica Group]
 gb|EEE61397.1| hypothetical protein OsJ_15573 [Oryza sativa Japonica Group]
Length=307

 Score = 75.9 bits (185),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 61/126 (48%), Gaps = 26/126 (21%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS----------------------  384
            V FH+L+V+D  S+A  A + +  F  LDILVNNAAV                       
Sbjct  63   VVFHQLEVTDSSSVARLADFLKTRFGKLDILVNNAAVGGMEYVQGVDTNKEQFVSMDKKQ  122

Query  385  ----FNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKL  552
                 N   + + + A+  + TNYYG K++I ALLP+   SS   RI+N+SS  G    +
Sbjct  123  RLAWLNKQGRETYDAAKNGVQTNYYGTKIVIQALLPLLLQSSGEGRIVNVSSDFGLLRVV  182

Query  553  QNPKLR  570
             N  LR
Sbjct  183  NNEDLR  188


 Score = 44.7 bits (104),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 6/43 (14%)
 Frame = +2

Query  89   SLPKTRWWSEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            SLP  R      VA+VTG NKGIG  + ++LA  G+TVVLTAR
Sbjct  7    SLPTKR------VAVVTGGNKGIGLEVCRQLAADGITVVLTAR  43



>ref|XP_002521626.1| carbonyl reductase, putative [Ricinus communis]
 gb|EEF40733.1| carbonyl reductase, putative [Ricinus communis]
Length=305

 Score = 71.6 bits (174),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 65/127 (51%), Gaps = 27/127 (21%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS----------------------  384
            V FH+LDV D  SI   A++ + TF  LDILVNNA  S                      
Sbjct  62   VVFHQLDVLDPVSIHSLANFIQNTFGRLDILVNNAGASGVVVDDEHLRALNIDPETWLSG  121

Query  385  -----FNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNK  549
                   +V + + E AE  + TNY+G + L  ALLP+ + S+S ARI+N+SS   +  +
Sbjct  122  KAVNLLQEVMKTTYEKAEECLNTNYFGVRRLTEALLPLLQLSTSGARIVNVSSLRSELRR  181

Query  550  LQNPKLR  570
            +++ +LR
Sbjct  182  IRSEELR  188


 Score = 48.9 bits (115),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  113  SEETVAIVTGANKGIGFALVKRLAELGLTVVLTAR  217
            S E  A+VTGANKGIGF  V++LA  G+TVVLTAR
Sbjct  8    SAEKYAVVTGANKGIGFETVRQLASRGVTVVLTAR  42



>gb|KDP28664.1| hypothetical protein JCGZ_14435 [Jatropha curcas]
Length=299

 Score = 74.3 bits (181),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 61/113 (54%), Gaps = 27/113 (24%)
 Frame = +1

Query  277  FHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVS------------------------  384
            FH+LDV+D  S+A  A + +  F  LDILVNNA +S                        
Sbjct  60   FHQLDVTDPRSVASLADFVKIQFGKLDILVNNAGISGVTIDHDVFQRASELSGGWPDGKQ  119

Query  385  --FNDVDQNSVEHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLG  537
              ++++   S+E AE  + TNYYG KL++ AL P+ + S + ARI+N+SS LG
Sbjct  120  VTWDEIQTPSLELAEQCLKTNYYGAKLMVEALTPLLQLSKA-ARIVNVSSALG  171


 Score = 46.2 bits (108),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEALR  238
            A+VTG NKGIGF + +RLA  G+ VVLTAR     L 
Sbjct  7    AVVTGGNKGIGFEICRRLASNGIVVVLTARDENRGLE  43



>gb|KDP28662.1| hypothetical protein JCGZ_14433 [Jatropha curcas]
Length=294

 Score = 75.5 bits (184),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 21/116 (18%)
 Frame = +1

Query  271  VWFHRLDVSDRHSIADFASWFRCTFSALDILVNNAAVSFNDVDQNSV-------------  411
            V FH+LDV++  SI+  A + +  F  LDILVNNA +S N+ D +++             
Sbjct  60   VLFHQLDVANTASISALADFIKTQFGKLDILVNNAGISGNEADADALRAFDREGAGINWH  119

Query  412  -------EHAETVIATNYYGPKLLIAALLPMFRCSSSTARILNISSRLGQFNKLQN  558
                   E AE  +A NYYG K ++ A +P+ + S S  RI+N+SS +G+   ++N
Sbjct  120  KITTETYELAEECVAINYYGAKRMVEAFVPLLQLSDS-PRIVNVSSTMGKLKNVKN  174


 Score = 45.1 bits (105),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  128  AIVTGANKGIGFALVKRLAELGLTVVLTARVTQEAL  235
            A+VTGANKGIGF + ++L   G+ VVLTAR  +  L
Sbjct  10   AVVTGANKGIGFEICRQLGSNGIVVVLTARDEKRGL  45



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515